| Basic Information | |
|---|---|
| Family ID | F075470 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 50 residues |
| Representative Sequence | AQEGYLVSLIDGRLDLQKLLILSPFDQFTTLFNLAKLQHERAITIPQ |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.32 % |
| % of genes from short scaffolds (< 2000 bps) | 95.80 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.479 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.294 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.496 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.67% β-sheet: 0.00% Coil/Unstructured: 61.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00512 | HisKA | 42.86 |
| PF02518 | HATPase_c | 15.13 |
| PF00989 | PAS | 1.68 |
| PF13188 | PAS_8 | 1.68 |
| PF06793 | UPF0262 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG5328 | Uncharacterized conserved protein, UPF0262 family | Function unknown [S] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.48 % |
| Unclassified | root | N/A | 2.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001334|A2165W6_1284720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300001359|A3035W6_1104621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300003366|JGI25321J50212_10154986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300004081|Ga0063454_101804754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300004114|Ga0062593_102900373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300005093|Ga0062594_102032262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300005172|Ga0066683_10428436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300005178|Ga0066688_10775420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300005179|Ga0066684_10919180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300005181|Ga0066678_10069796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2054 | Open in IMG/M |
| 3300005328|Ga0070676_10522634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300005328|Ga0070676_10633221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300005334|Ga0068869_101867408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300005337|Ga0070682_100742960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300005340|Ga0070689_101991923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300005341|Ga0070691_10397264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300005343|Ga0070687_100936285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300005344|Ga0070661_101832285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005364|Ga0070673_100923096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300005438|Ga0070701_11070240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300005444|Ga0070694_100762211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300005445|Ga0070708_100938259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300005451|Ga0066681_10592733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300005451|Ga0066681_10817387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300005459|Ga0068867_102070096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300005467|Ga0070706_101629059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300005534|Ga0070735_10078095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2117 | Open in IMG/M |
| 3300005536|Ga0070697_100565481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 998 | Open in IMG/M |
| 3300005559|Ga0066700_10799014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300005561|Ga0066699_11271678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300005566|Ga0066693_10257557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300005598|Ga0066706_11201910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300005618|Ga0068864_102497677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300005891|Ga0075283_1069275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300005896|Ga0075282_1053061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300005903|Ga0075279_10045894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300005904|Ga0075280_10019343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1175 | Open in IMG/M |
| 3300005952|Ga0080026_10256216 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005993|Ga0080027_10176032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300005994|Ga0066789_10246031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300006032|Ga0066696_10886695 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006055|Ga0097691_1198316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300006237|Ga0097621_101041070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300006237|Ga0097621_102416561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300006358|Ga0068871_102223704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300006794|Ga0066658_10939246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300006797|Ga0066659_11664613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300006854|Ga0075425_102029289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300006893|Ga0073928_10791923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300006903|Ga0075426_11378697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300007004|Ga0079218_10883243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300007004|Ga0079218_13386243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300009012|Ga0066710_104030009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300009088|Ga0099830_11769127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300009147|Ga0114129_13114522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300009174|Ga0105241_11244075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300009177|Ga0105248_11471370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300009509|Ga0123573_11645650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300009789|Ga0126307_11558155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300010333|Ga0134080_10452659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300010333|Ga0134080_10693779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300010364|Ga0134066_10118891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300010397|Ga0134124_10225974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1711 | Open in IMG/M |
| 3300010403|Ga0134123_13014840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300011007|Ga0139299_1051661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300011269|Ga0137392_10943217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300011271|Ga0137393_11641285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300011445|Ga0137427_10315529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300012040|Ga0137461_1018034 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300012045|Ga0136623_10474490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300012189|Ga0137388_10206543 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300012189|Ga0137388_10997816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300012960|Ga0164301_10975776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300012975|Ga0134110_10423640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300013503|Ga0120127_10015000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1324 | Open in IMG/M |
| 3300014054|Ga0120135_1031458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300014166|Ga0134079_10706562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300014745|Ga0157377_10434364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300014865|Ga0180078_1065457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300014877|Ga0180074_1038069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300014968|Ga0157379_10484290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1145 | Open in IMG/M |
| 3300015051|Ga0137414_1205444 | All Organisms → cellular organisms → Bacteria | 2898 | Open in IMG/M |
| 3300015164|Ga0167652_1069461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300015193|Ga0167668_1067180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300018084|Ga0184629_10130251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1260 | Open in IMG/M |
| 3300018482|Ga0066669_11721983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300019888|Ga0193751_1159429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300021362|Ga0213882_10386014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300021362|Ga0213882_10429272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300021363|Ga0193699_10150396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300024279|Ga0247692_1028010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300025289|Ga0209002_10630329 | Not Available | 572 | Open in IMG/M |
| 3300025604|Ga0207930_1115714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300025878|Ga0209584_10349036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300025910|Ga0207684_11264778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300025922|Ga0207646_11892445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300025925|Ga0207650_10286251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1343 | Open in IMG/M |
| 3300025931|Ga0207644_11202424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300025937|Ga0207669_11444145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300025938|Ga0207704_11850518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300025939|Ga0207665_10734418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300025942|Ga0207689_10563269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300025960|Ga0207651_11199729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300026041|Ga0207639_10846732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300026088|Ga0207641_11643515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300026308|Ga0209265_1112915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300026315|Ga0209686_1093155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1055 | Open in IMG/M |
| 3300026326|Ga0209801_1129938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
| 3300027843|Ga0209798_10166280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
| 3300027986|Ga0209168_10083717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1660 | Open in IMG/M |
| 3300031716|Ga0310813_11404120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300031852|Ga0307410_10982983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300032002|Ga0307416_102492638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300032955|Ga0335076_10452575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1167 | Open in IMG/M |
| 3300033488|Ga0316621_11200027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300034135|Ga0334929_128473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300034779|Ga0334945_109416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.20% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.36% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.36% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.36% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.52% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.68% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.68% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.68% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.84% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.84% |
| Basal Ice | Environmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice | 0.84% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.84% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.84% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.84% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.84% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001334 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300003366 | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/23 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011007 | Basal ice microbial communities from Matanuska glacier, Alaska, USA - MataB | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034135 | Biocrust microbial communities from Mojave Desert, California, United States - 25HNC | Environmental | Open in IMG/M |
| 3300034779 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 41SMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2165W6_12847202 | 3300001334 | Permafrost | MQAVPKLTAEFLTNFDRFNLTAQEGYLVSLIDGRLDLQKLSMLSPFDPFSTLFIL |
| A3035W6_11046212 | 3300001359 | Permafrost | NFDRFNLNAQEGYLISLIDGRLDLQKLLILSPFDAFTTLFNVAKLQYERAVMVPQ* |
| JGI25321J50212_101549862 | 3300003366 | Deep Subsurface | HFDRFNLNAQEGYLVSLIDGRLSIQKLIILSPFDPFTTIFILAKLQQEKAITVP* |
| Ga0063454_1018047542 | 3300004081 | Soil | TNFDRFNLSAQEGYLVSLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAITIPQ* |
| Ga0062593_1029003732 | 3300004114 | Soil | AEFLTNFDHFNLNAQEGYLVSLIDGRMDLQKLLILSPFDPFTTLFTLAKLQNERAISVPQ |
| Ga0062594_1020322622 | 3300005093 | Soil | SAEFMSNFDRFNLNAQEGYLVSLIDGRLDVQKLLILSPFDPFNTIFILAKLQQEKAITVPQ* |
| Ga0066683_104284363 | 3300005172 | Soil | DRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDPFTTLFNLAKLQHERAINIPQ* |
| Ga0066688_107754201 | 3300005178 | Soil | GYLISLIDGRLALQKLLILSPFDPFTTLFNLAKLQHERAITVP* |
| Ga0066684_109191802 | 3300005179 | Soil | MSLIDGRLDLQKLLILSPFDQFTTLFTLAKLQHERAITVPQ* |
| Ga0066678_100697964 | 3300005181 | Soil | DRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDSFTTLFNLAKLQQERAITVP* |
| Ga0070676_105226342 | 3300005328 | Miscanthus Rhizosphere | AQEGYLISLIDGRLQLQKLLVLSPFDQFTTLFNLAKLQHERAITIPQ* |
| Ga0070676_106332212 | 3300005328 | Miscanthus Rhizosphere | DRFNLSAQEGFLVSLIDGRLDLQKLLILSPFDPFTTFFILAKLQHERAITVPQ* |
| Ga0068869_1018674082 | 3300005334 | Miscanthus Rhizosphere | NFDRFNLSAQEGYLVSLIDGRMDIQKLLILSPFDPFTTLFTLAKLQNERAISVPQ* |
| Ga0070682_1007429602 | 3300005337 | Corn Rhizosphere | YLMSLIDGRLDLQKLLILSPFDQFTTLFTLAKLQHERAITVPQ* |
| Ga0070689_1019919231 | 3300005340 | Switchgrass Rhizosphere | SAEFMSNFDRFNLNAQEGYLVSLIDGRLDVQKLMILSPFDPFNTIFILAKLQAERAITVPQ* |
| Ga0070691_103972641 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | NAQEGYLVSLIDGRMDLQKLQILSPFDPFTTMFIIAKLINERAITIPQ* |
| Ga0070687_1009362851 | 3300005343 | Switchgrass Rhizosphere | FDRFNLSAQEGYLVSLIDGRLDLQKLLILSPFDPFTTFFTLAKLQNERAISVPQ* |
| Ga0070661_1018322852 | 3300005344 | Corn Rhizosphere | GYLVSLIDGRLDLQKLVLLSPFDQFMTLFVLAKLANERAITVPQ* |
| Ga0070673_1009230962 | 3300005364 | Switchgrass Rhizosphere | FDKFDLNAQEGYLVSLIDGRMDLQKLQILSPFDPFNTLFILAKLAQERAITMPR* |
| Ga0070701_110702401 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | NFDRFNLSAQEGYLVSLIDGRFDLQKLLILSPFDQFSTFFNLAKLQQERAIIVPQ* |
| Ga0070694_1007622112 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | NAQEGYLVSLIDGRLDVQKLLILSPFDSFNTIFILAKLQVERAITVSQ* |
| Ga0070708_1009382591 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SLIDGRLDLQKLVVLSPFDPFTTLFNLAKLQQERAITVP* |
| Ga0066681_105927331 | 3300005451 | Soil | QEGYLISLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAISVPQ* |
| Ga0066681_108173871 | 3300005451 | Soil | QEGYLVSLIDGRFDLQKLLILSPFDPFTTLFSLAKLQNERAISVPQ* |
| Ga0068867_1020700962 | 3300005459 | Miscanthus Rhizosphere | FLTNFDRFNLNAQEGYLVSLIDGRLDLQKLILLSPFDQFTTLFILAKLANERAITVPQ* |
| Ga0070706_1016290591 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TNFDRFNLSAQEGYLISLIDGRLALQKLLILSPFDAFTTLFNLAKLQHERAITVP* |
| Ga0070735_100780954 | 3300005534 | Surface Soil | LIDGRLDLQKLLILSPFDQFTTLFNLAKLQHERAITVPE* |
| Ga0070697_1005654812 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TAQEGYLISLIDGRMDMQKLLVLSPFDPFTTLFNLAKLQHERAITIPQ* |
| Ga0066700_107990141 | 3300005559 | Soil | VPRLTAEFLTNFDRFNLNAQEGYLISLIDGRLDLQKLLILSPFDPFTTLFNVAKLQYERAVMVPQ* |
| Ga0066699_112716782 | 3300005561 | Soil | AQEGYLISLIDGRLDLQKLLILSPFDPFTTLFNVAKLQYERAVMVPQ* |
| Ga0066693_102575571 | 3300005566 | Soil | RMDLQKLQILSPFDPFNTLFILAKLANERAITIPQ* |
| Ga0066706_112019101 | 3300005598 | Soil | SLIDGRMDLQKLQILSPFDPFTTMFIMAKLLQEQAITIPS* |
| Ga0068864_1024976772 | 3300005618 | Switchgrass Rhizosphere | DGRLDLQRLTILSPFDQFTTLFTLAKLQQERAMTMPQ* |
| Ga0075283_10692751 | 3300005891 | Rice Paddy Soil | QEGYLVSLIDGRLDIQKLTILSPFDPFTTIFILAKLQQERAITVPQ* |
| Ga0075282_10530611 | 3300005896 | Rice Paddy Soil | LIDGRLDLQKLLVLSPFDQFTTLFNLAKLQHERAITVP* |
| Ga0075279_100458941 | 3300005903 | Rice Paddy Soil | DGRLDLQKLLVLSPFDQFTTLFNLAKLQHERAITVP* |
| Ga0075280_100193431 | 3300005904 | Rice Paddy Soil | AVPKLTAEFLTNFDRFNLSAQEGYLVSLIDGRFDLQKLVILSPFDPFTTFFNLAKLQQERAITVPQ* |
| Ga0080026_102562163 | 3300005952 | Permafrost Soil | SAQEGFLVSLIDGRLDMQKLLILSPFDAFTTFFILAKLQNERAITVPA* |
| Ga0080027_101760322 | 3300005993 | Prmafrost Soil | FLVSLIDGRMDISKLMILSPFDPFTTLFNLAKLENERAITIPK* |
| Ga0066789_102460311 | 3300005994 | Soil | DGRMDISKLMILSPFDPFTTLFNLAKLENERAITIPK* |
| Ga0066696_108866952 | 3300006032 | Soil | LSAEFLTNFDRFNLSAQEGYLVSLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAISVPQ* |
| Ga0097691_11983162 | 3300006055 | Arctic Peat Soil | LISLIDGRMDIQKLTILSPFDPFTTVFILAKLQNERAITVPQ* |
| Ga0097621_1010410702 | 3300006237 | Miscanthus Rhizosphere | LTAEFLSNFDRFNLTAQEGYLISLIDGRLDLQKLLILSPFDPFTTLFNLAKLQHERAITVPQ* |
| Ga0097621_1024165611 | 3300006237 | Miscanthus Rhizosphere | QEGYLVSLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAITVPQ* |
| Ga0068871_1022237042 | 3300006358 | Miscanthus Rhizosphere | SNFDRFNLTAQEGYLISLIDGRLDLQKLLILSPFDAFTTLFNLAKLQHERAITVPQ* |
| Ga0066658_109392461 | 3300006794 | Soil | RLDLQKLQILSPFDPFNTMFIMAKLVNERAITIPQ* |
| Ga0066659_116646131 | 3300006797 | Soil | VPRLSAEFLTNFDRFNLSAQEGYLVSLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAISVPQ* |
| Ga0075425_1020292891 | 3300006854 | Populus Rhizosphere | LIDGRFDLQKLLILSPFDPFTTLFTLAKLQNERAISVPQ* |
| Ga0073928_107919231 | 3300006893 | Iron-Sulfur Acid Spring | LISLIDGRLDLQKMLILSPFDPFTTLFNLAKLQQERAITVP* |
| Ga0075426_113786971 | 3300006903 | Populus Rhizosphere | NAQEGYLVSLIDGRLDLQKLVLLSPFDQFTTLFILAKLAQERAITVPQ* |
| Ga0079218_108832432 | 3300007004 | Agricultural Soil | AQEGYLVSLIDGRLDVSKLLILSPFDPFNTIFILAKLLREKAITVPQ* |
| Ga0079218_133862431 | 3300007004 | Agricultural Soil | VPRLSAEFMSNFDRFNLNAQEGYLVSLIDGRLDIQKLLILSPFDPFNTIFSLARLQQERAITVPQ* |
| Ga0066710_1040300091 | 3300009012 | Grasslands Soil | LAVPKLTAEFLTNFDRFNLSAQEGYLISLIDGRLALQKLLILSPFDPFTTLFNLAKLQHERAITVPS |
| Ga0099830_117691272 | 3300009088 | Vadose Zone Soil | SNFDRFNLTAQEGYLISLIDGRLDLQKLVILSPFDQFNTLFNLAKLQHERAITVPQ* |
| Ga0114129_131145222 | 3300009147 | Populus Rhizosphere | DRFNLSAQEGFLVSLIDGRLDLQKLLILSPFDSFTTFFILAKLQHERAITVPQ* |
| Ga0105241_112440751 | 3300009174 | Corn Rhizosphere | DGRLDLQKLLILSPFDQFTTLFTLAKLQHERAITVPQ* |
| Ga0105248_114713702 | 3300009177 | Switchgrass Rhizosphere | AEFLTNFDKFNLSAQEGYLVSLIDGRLQLQKLLILSPFDQFTTLFNLSKLQHERAITIPQ |
| Ga0123573_116456502 | 3300009509 | Mangrove Sediment | LNEFDKFNLSAQEGYLISQIDGRTNIEKLLKLSPFDPFTTFFSLARMYQVRAIEISE* |
| Ga0126307_115581552 | 3300009789 | Serpentine Soil | LIDGRMDVQKLMILSPFDPFNTIFILATLQHERAITVP* |
| Ga0134080_104526592 | 3300010333 | Grasslands Soil | FDLQKLLILSPFDPFTTLFTLAKLQNERAISVPQ* |
| Ga0134080_106937792 | 3300010333 | Grasslands Soil | IDGRLALQKLLILSPFDPFTTLFNLAKLQHERAITVP* |
| Ga0134066_101188912 | 3300010364 | Grasslands Soil | LIDGRLDLQKLTILSPFDAFNTFFILAKLQQERAITVPQ* |
| Ga0134124_102259741 | 3300010397 | Terrestrial Soil | NFDRFNLNAQEGYLVSLIDGRLDLQKLVLLSPFDQFTTLFILAKLAYERAITVPQ* |
| Ga0134123_130148402 | 3300010403 | Terrestrial Soil | FDRFNLSAQEGFLVSLIDGRMDISKLMILSPFDPFSTLFNLAKLQNERAITIPQ* |
| Ga0139299_10516612 | 3300011007 | Basal Ice | NFDQFNLSAQEGYLISLIDGRLDLQKLMIISPFDQFTTLFYFAKLQQQRAILLPQ* |
| Ga0137392_109432171 | 3300011269 | Vadose Zone Soil | LNAQEGYLVSLIDGRMDLQKLQILSPFDPFNTMFIMAKLLQEHAITIPS* |
| Ga0137393_116412852 | 3300011271 | Vadose Zone Soil | RFNLTAQEGYLISLIDGRLDLQKLAILSPFDQFNTLFNLAKLQHERAITVPQ* |
| Ga0137427_103155291 | 3300011445 | Soil | MDVQKLMILSPFDQFTTLFLLAKLEHERAITVPT* |
| Ga0137461_10180343 | 3300012040 | Soil | FDRFNLNAQEGYLVSLIDGRMDLQKLLILSPFDPFTSLFTLAKLQNERAISVPQ* |
| Ga0136623_104744902 | 3300012045 | Polar Desert Sand | LSDFGRFNLSAQEGYLVSLIDGRLDLQKLLILSPFDAFTTLFNIAKLNSQKAITLPT* |
| Ga0137388_102065433 | 3300012189 | Vadose Zone Soil | FDRFNLSAQEGYLISLIDGRLDLNKLLILSPFDQFATLFNLAKLQHERAITIPQ* |
| Ga0137388_109978161 | 3300012189 | Vadose Zone Soil | RLSAEFLTNFDRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDPFTTLFNLAKMQHERAITIPQ* |
| Ga0164301_109757762 | 3300012960 | Soil | RFNLNAQEGYLVSLIDGRLDLQKLTILSPFDAFNTFFILAKLQQERAITVPQ* |
| Ga0134110_104236402 | 3300012975 | Grasslands Soil | DRFNLSAQEGYLISLIDGRLALQKLLILSPFDPFTTLFNLAKLQHERAITVP* |
| Ga0120127_100150003 | 3300013503 | Permafrost | FNLSAQEGFLVSLIDGRLDLQKLLILSPFDPFTTFFILAKLQHELAITVPS* |
| Ga0120135_10314582 | 3300014054 | Permafrost | GRMDLQKLLILSPFDAFTTFFILAKLQNERAITVPT* |
| Ga0134079_107065622 | 3300014166 | Grasslands Soil | RLSAEFLTNFDRFNLNAQEGYLVSLIDGRLDLQKLTILSPFDAFNTFFILAKLQQERAITVPQ* |
| Ga0157377_104343641 | 3300014745 | Miscanthus Rhizosphere | GRMDVQKLMILSPFDPFNTIFILAKLQHEKAITVPS* |
| Ga0180078_10654571 | 3300014865 | Soil | LSAEFLTNFDRFNLNAQEGYLVSLIDGRMDLQKLLILSPFDPFTSLFTLAKLQNERAISVPQ* |
| Ga0180074_10380691 | 3300014877 | Soil | RFNLNAQEGYLVSLIDGRLDVQKLMILSPFDPFTTIFILAKLQNERAIVVP* |
| Ga0157379_104842901 | 3300014968 | Switchgrass Rhizosphere | IDGRLDLQKLVLLSPFDQFTTLFILAKLAYERAITVPQ* |
| Ga0137414_12054446 | 3300015051 | Vadose Zone Soil | GYLMSLIDGRLDLQKLLILSPFDQFTTLFNLAKLQNERAITVPQ* |
| Ga0167652_10694611 | 3300015164 | Glacier Forefield Soil | LSAQEGYLVSLIDGRFDLQKLLILSPFDPFTTLFNLSKLQQERAITVPQ* |
| Ga0167668_10671802 | 3300015193 | Glacier Forefield Soil | DRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDPFTTLFNLAKLQHELAINIPQ* |
| Ga0136617_102571302 | 3300017789 | Polar Desert Sand | GFKLTEQEGYLISLVEGSLSIEKLLRLSPTDHFTTLFNLARLAHLKAIVFSP |
| Ga0184629_101302511 | 3300018084 | Groundwater Sediment | KLTAEFLTNFDRFNLNAQEGYLVSLIDGRMDISKLMILSPFDPFSTLFNLAKLQNERAITIPQ |
| Ga0066669_117219832 | 3300018482 | Grasslands Soil | FNLSAQEGYLVSLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAISVPQ |
| Ga0193751_11594291 | 3300019888 | Soil | AQEGYLISLIDGRLDLQKMLILSPFDPFTTLFNLAKLQQERAITVP |
| Ga0213882_103860141 | 3300021362 | Exposed Rock | LTAEFLTNFDRFNLSAQEGYLVSLIDGRFDMQKLLILSPFDQFTTLFTLAKLQQERAITVPQ |
| Ga0213882_104292722 | 3300021362 | Exposed Rock | LIDGRLALQKLAILSPFDPFTTYFVLAKLQNERALTIPK |
| Ga0193699_101503962 | 3300021363 | Soil | RLTPEFLSNFDRFNLTAQEGYLVSLIDGRLDLQKLLILSPFDHFTTLFNLAKLEHERAITVPA |
| Ga0247692_10280101 | 3300024279 | Soil | RLDLQKLLILSPFDPFTTLFNLAKLQQERAITVPK |
| Ga0209002_106303291 | 3300025289 | Soil | EGYLVSLIDGRLDVQKLMILSPFDPFSTIFILAKLQNERAILVP |
| Ga0207930_11157142 | 3300025604 | Arctic Peat Soil | VSLIDGRLDLQKLSILSPFDQFTTLFILAKLQQEGALTIPQ |
| Ga0209584_103490362 | 3300025878 | Arctic Peat Soil | MQAMPKLTPEFLSNFDRFNLTAQEGYLVSLIDGRLDLQKLLLLSPFDHFTTLFNLAKLQHERAITVPQ |
| Ga0207684_112647781 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EFLTNFDRFNLTAQEGYLVSLIDGRFDLQKLLVLSPFDPFTTLFNLAKLQHERAITVPQ |
| Ga0207646_118924452 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LSAEFLTNFDRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDPFTTLFNLAKLQHERAITIPQ |
| Ga0207650_102862513 | 3300025925 | Switchgrass Rhizosphere | IDGRLDLQKLLILSPFDQFTTLFTLAKLQHERAITVPQ |
| Ga0207644_112024241 | 3300025931 | Switchgrass Rhizosphere | EGYLVSLIDGRLDLQKLVLLSPFDQFTTLFILAKLANERAITVPR |
| Ga0207669_114441452 | 3300025937 | Miscanthus Rhizosphere | IDGRMDISKLMILSPFDPFSTLFNLAKLQNERAITIPQ |
| Ga0207704_118505181 | 3300025938 | Miscanthus Rhizosphere | QDGYLVSLIDGRLDLQKLILLSPFDQFTTLFILAKLANERAITVPQ |
| Ga0207665_107344183 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GRLDLQKLLILSPFDPFTTLFNLAKLQQERAITVPK |
| Ga0207689_105632692 | 3300025942 | Miscanthus Rhizosphere | RFNLSAQEGYLVSLIDGRMDIQKLLILSPFDPFTTLFTLAKLQNERAISVPQ |
| Ga0207651_111997292 | 3300025960 | Switchgrass Rhizosphere | AQEGYLVSLIDGRMDLQKLQILSPFDPFNTLFILAKLAQERAITMPR |
| Ga0207639_108467321 | 3300026041 | Corn Rhizosphere | VPKLSPEFLTNFDRFNLNAQEGYLVSLIDGRLDLQKLVLLSPFDQFTTLFILAKLANERAITVPQ |
| Ga0207641_116435152 | 3300026088 | Switchgrass Rhizosphere | IDGRLDLQKLVLLSPFDQFTTLFVLAKLAHERAITVPQ |
| Ga0209265_11129151 | 3300026308 | Soil | AQEGYLMSLIDGRLDLQKLLILSPFDQFTTLFTLAKLQHERAITVPQ |
| Ga0209686_10931551 | 3300026315 | Soil | LSAEFLTNFDRFNLNAQEGYLVSLIDGRMDLQKLQILSPFDPFNTMFIIAKLVYERAITIPQ |
| Ga0209801_11299381 | 3300026326 | Soil | DRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDSFTTLFNLAKLQQERAITVP |
| Ga0209514_101783751 | 3300027819 | Groundwater | QEGYLISLIDGRTNIEKLLKLSPFDSFTTLFNLARLQNQKAIVVP |
| Ga0209798_101662801 | 3300027843 | Wetland Sediment | AQEGYLVSLIDGRLDLQKLLILSPFDQFTTLFNLAKLQHERAITIPQ |
| Ga0209168_100837174 | 3300027986 | Surface Soil | LIDGRLDLQKLLILSPFDQFTTLFNLAKLQHERAITVPE |
| Ga0310813_114041201 | 3300031716 | Soil | RLDLQKLTILSPFDAFNTFFILAKLQQERAITVPQ |
| Ga0307410_109829831 | 3300031852 | Rhizosphere | LTNFDRFNLSAQEGYLVSLIDGRLDISKLVILSPFDQFTTLFILAKLDHERAITIPQ |
| Ga0307416_1024926382 | 3300032002 | Rhizosphere | LIDGRLDISKLLILSPFDPFTTLFNLAKLQYERAITIPQ |
| Ga0335076_104525751 | 3300032955 | Soil | AQEGYLVSLIDGRLDLQKLTILSPFDAFNTFFILSKLQQERAITVPQ |
| Ga0316621_112000272 | 3300033488 | Soil | DFLANAQGIRAIPKLSPEFLADFGRFNLSAQEGYLISLIDGRTNIEKLLKLSPFDQFSTLFNLARLQQQKAIVVPK |
| Ga0334929_128473_3_164 | 3300034135 | Hypolithic Biocrust | DRFNLNAQEGYLVSLIDGRMDVQKLMILSPFDPFNTIFILAKLQHERAITVPS |
| Ga0334945_109416_3_182 | 3300034779 | Sub-Biocrust Soil | DFLSNFDRFNLNAQEGYLVSLIDGRLDLQKLTILSPFDPFTTLFLLAKLQHEKAITVPQ |
| ⦗Top⦘ |