NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075361

Metagenome / Metatranscriptome Family F075361

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075361
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 44 residues
Representative Sequence MRLVTFEDPVRRSRIGAVTADGSIVDLNSACALYLRDVEHE
Number of Associated Samples 108
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 32.77 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.28 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.672 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.605 % of family members)
Environment Ontology (ENVO) Unclassified
(21.849 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.580 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.29%    β-sheet: 21.74%    Coil/Unstructured: 57.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF01321Creatinase_N 14.29
PF01641SelR 10.08
PF04519Bactofilin 5.88
PF04075F420H2_quin_red 5.04
PF01565FAD_binding_4 4.20
PF03301Trp_dioxygenase 3.36
PF08291Peptidase_M15_3 2.52
PF07687M20_dimer 1.68
PF00117GATase 1.68
PF08818DUF1801 1.68
PF00155Aminotran_1_2 1.68
PF10459Peptidase_S46 0.84
PF01996F420_ligase 0.84
PF00582Usp 0.84
PF00795CN_hydrolase 0.84
PF01546Peptidase_M20 0.84
PF12779WXXGXW 0.84
PF00296Bac_luciferase 0.84
PF13450NAD_binding_8 0.84
PF12704MacB_PCD 0.84
PF01625PMSR 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 14.29
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 10.08
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 5.88
COG3483Tryptophan 2,3-dioxygenase (vermilion)Amino acid transport and metabolism [E] 3.36
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 1.68
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 1.68
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 1.68
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 0.84
COG1478F420-0:Gamma-glutamyl ligase (F420 biosynthesis)Coenzyme transport and metabolism [H] 0.84
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.84

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.67 %
UnclassifiedrootN/A19.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10712349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300004091|Ga0062387_100065089All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1818Open in IMG/M
3300004091|Ga0062387_100075392All Organisms → cellular organisms → Bacteria1725Open in IMG/M
3300005177|Ga0066690_10572983All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005178|Ga0066688_10247147All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300005332|Ga0066388_104504572All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300005355|Ga0070671_100184591All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300005366|Ga0070659_100613036All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300005434|Ga0070709_10209257All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1386Open in IMG/M
3300005468|Ga0070707_100350005All Organisms → cellular organisms → Bacteria1435Open in IMG/M
3300005468|Ga0070707_100923035All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005541|Ga0070733_10107240All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1788Open in IMG/M
3300005543|Ga0070672_100210736All Organisms → cellular organisms → Bacteria1627Open in IMG/M
3300005558|Ga0066698_10643896Not Available708Open in IMG/M
3300005559|Ga0066700_11052392Not Available533Open in IMG/M
3300005561|Ga0066699_10074390Not Available2171Open in IMG/M
3300005598|Ga0066706_10323160All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1219Open in IMG/M
3300005617|Ga0068859_100741683All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1071Open in IMG/M
3300005712|Ga0070764_10012582All Organisms → cellular organisms → Bacteria4160Open in IMG/M
3300006041|Ga0075023_100079424All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300006163|Ga0070715_10829988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300006173|Ga0070716_100089105All Organisms → cellular organisms → Bacteria1863Open in IMG/M
3300006173|Ga0070716_101313180Not Available585Open in IMG/M
3300006174|Ga0075014_100845440Not Available544Open in IMG/M
3300006354|Ga0075021_10044321All Organisms → cellular organisms → Bacteria2560Open in IMG/M
3300006804|Ga0079221_10175833All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300006871|Ga0075434_101124541Not Available798Open in IMG/M
3300006893|Ga0073928_10424700Not Available967Open in IMG/M
3300007788|Ga0099795_10114993All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300007982|Ga0102924_1018724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin3455169Open in IMG/M
3300009012|Ga0066710_104880354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300009038|Ga0099829_10520437All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300009137|Ga0066709_103694630All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300010048|Ga0126373_11981968All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300010048|Ga0126373_12963879All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300010362|Ga0126377_10659363All Organisms → cellular organisms → Bacteria → Acidobacteria1096Open in IMG/M
3300010366|Ga0126379_10542811All Organisms → cellular organisms → Bacteria1241Open in IMG/M
3300010366|Ga0126379_11691033All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300010375|Ga0105239_12877004All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300010397|Ga0134124_10597236All Organisms → cellular organisms → Bacteria → Acidobacteria1081Open in IMG/M
3300011269|Ga0137392_10355453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1214Open in IMG/M
3300012189|Ga0137388_12045909Not Available500Open in IMG/M
3300012205|Ga0137362_11210229All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300012209|Ga0137379_11814434All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300012917|Ga0137395_11248501Not Available517Open in IMG/M
3300013296|Ga0157374_11429084All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300014165|Ga0181523_10505248All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300014497|Ga0182008_10351549All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300016294|Ga0182041_10748784All Organisms → cellular organisms → Bacteria → Acidobacteria870Open in IMG/M
3300016404|Ga0182037_11034533All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300017823|Ga0187818_10083727All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300017927|Ga0187824_10079561All Organisms → cellular organisms → Bacteria → Acidobacteria1038Open in IMG/M
3300017943|Ga0187819_10001412All Organisms → cellular organisms → Bacteria12411Open in IMG/M
3300017955|Ga0187817_11006085Not Available534Open in IMG/M
3300017959|Ga0187779_11019836All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300017961|Ga0187778_10066534All Organisms → cellular organisms → Bacteria2210Open in IMG/M
3300018007|Ga0187805_10489798Not Available576Open in IMG/M
3300018037|Ga0187883_10109762All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1430Open in IMG/M
3300018085|Ga0187772_10067205All Organisms → cellular organisms → Bacteria2244Open in IMG/M
3300018088|Ga0187771_11910107All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300018468|Ga0066662_10921480All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300018482|Ga0066669_11311685All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300019789|Ga0137408_1151768All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300019879|Ga0193723_1077436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae956Open in IMG/M
3300019885|Ga0193747_1071019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium859Open in IMG/M
3300020581|Ga0210399_10404455All Organisms → cellular organisms → Bacteria → Acidobacteria1138Open in IMG/M
3300020583|Ga0210401_11064490All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300021168|Ga0210406_10356566All Organisms → cellular organisms → Bacteria → Acidobacteria1179Open in IMG/M
3300021178|Ga0210408_11348561All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300021180|Ga0210396_10305038All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1409Open in IMG/M
3300021403|Ga0210397_11626475All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300021405|Ga0210387_10179237All Organisms → cellular organisms → Bacteria1829Open in IMG/M
3300021406|Ga0210386_10248004All Organisms → cellular organisms → Bacteria → Acidobacteria1518Open in IMG/M
3300021420|Ga0210394_11438720Not Available585Open in IMG/M
3300021432|Ga0210384_10821692Not Available828Open in IMG/M
3300021433|Ga0210391_11158600Not Available599Open in IMG/M
3300021475|Ga0210392_10122069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1745Open in IMG/M
3300021477|Ga0210398_11001260Not Available667Open in IMG/M
3300021560|Ga0126371_12078705All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300021560|Ga0126371_12628450All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300022557|Ga0212123_10766719All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300025155|Ga0209320_10291768All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium681Open in IMG/M
3300025320|Ga0209171_10468159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300025322|Ga0209641_10533666All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300025482|Ga0208715_1096681All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300025905|Ga0207685_10643751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300025912|Ga0207707_10262274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1499Open in IMG/M
3300025932|Ga0207690_11517065All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300025939|Ga0207665_10773066All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium758Open in IMG/M
3300025939|Ga0207665_10839663All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300025939|Ga0207665_11566058All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300026309|Ga0209055_1233195All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300026318|Ga0209471_1113348All Organisms → cellular organisms → Bacteria → Acidobacteria1160Open in IMG/M
3300026324|Ga0209470_1383738All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300026331|Ga0209267_1113403All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300027466|Ga0207484_100287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1629Open in IMG/M
3300027570|Ga0208043_1096369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae805Open in IMG/M
3300027604|Ga0208324_1148777Not Available638Open in IMG/M
3300027842|Ga0209580_10612869Not Available539Open in IMG/M
3300027853|Ga0209274_10695524All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300027869|Ga0209579_10448800Not Available700Open in IMG/M
3300027875|Ga0209283_10859489All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300027882|Ga0209590_10845287All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300028807|Ga0307305_10085755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1456Open in IMG/M
3300028906|Ga0308309_10721649All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300029701|Ga0222748_1104765Not Available555Open in IMG/M
3300031720|Ga0307469_11652776All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300031720|Ga0307469_11697810All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300031768|Ga0318509_10780768All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031820|Ga0307473_10594726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4763Open in IMG/M
3300031820|Ga0307473_11354867Not Available534Open in IMG/M
3300031879|Ga0306919_11078593Not Available613Open in IMG/M
3300032205|Ga0307472_100025802All Organisms → cellular organisms → Bacteria3315Open in IMG/M
3300032783|Ga0335079_10296387All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1766Open in IMG/M
3300032783|Ga0335079_11292675Not Available729Open in IMG/M
3300032892|Ga0335081_10833564All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300032893|Ga0335069_11252821Not Available809Open in IMG/M
3300032955|Ga0335076_10588067All Organisms → cellular organisms → Bacteria → Acidobacteria995Open in IMG/M
3300033134|Ga0335073_10343136All Organisms → cellular organisms → Bacteria1772Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.40%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.04%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.20%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.20%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring3.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.36%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.36%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.52%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.52%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.68%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.68%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.84%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.84%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025482Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300027466Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-B (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1071234923300001593Forest SoilMRFITFDDPVRRSRIGALAPDGRIVDLNSACALYLRDVENEGS
Ga0062387_10006508943300004091Bog Forest SoilMRLVTFEDPAQRRRIGAVADDARIVDLRSACALYLREVESESA
Ga0062387_10007539253300004091Bog Forest SoilMRLVTFEDGAQRNRTGAVTDGGRFVDLHSACALYLRDVENE
Ga0066690_1057298323300005177SoilMRLVTFENPVRQPRIGALTPSHRIADLNSACAIYLRDVESESAYQRLADA
Ga0066688_1024714713300005178SoilMRLVTFEDPVRQSRVGALTTDGRIIDLHSACALYLREVENE
Ga0066388_10450457213300005332Tropical Forest SoilMRLVTFEDPVRRSRIGAVTADGSIVDLNSACALYLRDVEHE
Ga0070671_10018459153300005355Switchgrass RhizosphereMRLVTFETSAKQSRIGAISADGRVIDLNSACALYLRDVESESA
Ga0070659_10061303623300005366Corn RhizosphereMRFITFDDPVRRSRIGALAPDGRIVDLNSACALYLRDVENEGAYD
Ga0070709_1020925713300005434Corn, Switchgrass And Miscanthus RhizosphereMRLITFYDTVRRSRIGALALDGRIVDLNSACALYLRNVENEGA
Ga0070707_10035000533300005468Corn, Switchgrass And Miscanthus RhizosphereMRLVTFEDPVHQSRIGALTPDGRIVDLHSACALYLRDVEH
Ga0070707_10092303513300005468Corn, Switchgrass And Miscanthus RhizosphereMRLVTFENPVRQARIGALTTDRRIVDLNSACAMYLRDVEGENAHVRLADA
Ga0070733_1010724033300005541Surface SoilMRLVTFEDPAQRLRIGAVTDDARFVDLHSACSLYLRDVENESAFERLADALVP
Ga0070672_10021073613300005543Miscanthus RhizosphereMRLVTFETSAKQSRIGAISADGRVIDLNSACALYL
Ga0066698_1064389613300005558SoilMRLVTFEDSVRRSRIGAIDAADRVVDLHSACALYLREVE
Ga0066700_1105239213300005559SoilMRLVTFENPGRQARVGALTTDRRIVDLNSACALYLRDVEGENAHDRLAD
Ga0066699_1007439033300005561SoilMRLVTFENPVRQACIGALTTDRRIVDLNSACALYLRDVEGE
Ga0066706_1032316013300005598SoilMRLVTFEDPTRRSRVGAVTSDGRIADLHTACALYLRDVEAESAFYRLADAM
Ga0068859_10074168333300005617Switchgrass RhizosphereMRLVTFETSAKQSRIGAISADGRVIDLNSACALYLRDV
Ga0070764_1001258273300005712SoilMRLITFEDPAKRTRIGAVTDNGRFVDLHSACALYLRDVENE
Ga0075023_10007942433300006041WatershedsMRLVTYENPVRHSRTGALTSDGRVVDLNSACALYLRDIE
Ga0070715_1082998813300006163Corn, Switchgrass And Miscanthus RhizosphereMRLISFLNSARQSRIGAMTTGGRIIDLNSACALYLRDVE
Ga0070716_10008910553300006173Corn, Switchgrass And Miscanthus RhizosphereMRLVTFETSAKQSRIGAISADGRVIDLNSACALYLRDVES
Ga0070716_10131318033300006173Corn, Switchgrass And Miscanthus RhizosphereMRLITFEDSVKRSRIGAVTPDGRIGDLKIVDLNSACALY
Ga0075014_10084544023300006174WatershedsMRLVTFENSVRQPRVGAMTRDGRIVDLNCAAALYLR
Ga0075021_1004432113300006354WatershedsMRLITFEDSVRRSRIGALAPDGRIGDLKIVDLNSACALYLRDVEDEGAFKR
Ga0079221_1017583313300006804Agricultural SoilMRLVTFENPARESRIGAMAADDRVVDLHSACALYLRDVENESAFYRLAD
Ga0075434_10112454133300006871Populus RhizosphereMRLVSFEDPARQSRIGAMAADGRIVDLHSACALYLRDVENE
Ga0073928_1042470013300006893Iron-Sulfur Acid SpringMRLVTFEDPVRRSRIGGVTDDGRIVDLRSACALYLRDVENESTFERLADA
Ga0099795_1011499313300007788Vadose Zone SoilMRFITFDDPVRRSRIGALAPDGRIVDLNTACAVYVRD
Ga0102924_101872453300007982Iron-Sulfur Acid SpringMRLVTFEDAVKRSRVGAVTDDGQIVDLNSACALYLAEVENESAYY
Ga0066710_10488035413300009012Grasslands SoilMRLVTFEDPVRQSRIGAVLNDGRIVDLHSACALYLRDVESEAAFYRIAD
Ga0099829_1052043723300009038Vadose Zone SoilMRLVTFEDRSRRSWIGALTPQGLIIDLNTACSLYLRDVEKESAFYRIAEARVPP
Ga0066709_10369463013300009137Grasslands SoilMRLVTFENPVRRPRIGALTPQHRIADLNSACAIYLRDVESES
Ga0126373_1198196823300010048Tropical Forest SoilMRLITFENSVRQSRIGSLTRGDRIVDLNSAYALYL
Ga0126373_1296387923300010048Tropical Forest SoilMRLVTFENPVRTFRIGALVDNDRIVDLHSACALYLRDAE
Ga0126377_1065936323300010362Tropical Forest SoilMKLVTFENASRQSSIGAVTEDGRIVDLHTACALYLRDVENEN
Ga0126379_1054281113300010366Tropical Forest SoilMRLVTFENPARQSRIGTMTSEGRVVDLHSACALYLRDVENESAFYRLADAL
Ga0126379_1169103313300010366Tropical Forest SoilMKLVTFETASRQSSVGAVTSDGKIIDLHAACALYLRDVENENAFNRLADALVPANM
Ga0105239_1287700413300010375Corn RhizosphereMRFITFDDPVRRSRIGALAPDGRIVDLNSSCALYLRDVENEGAYDRISAALVPPNMRK
Ga0134124_1059723623300010397Terrestrial SoilMKLITFEDSVRRSRVGALVADGRILDLNSACALYLREVENESAFDRLADALVPPNMRE
Ga0137392_1035545333300011269Vadose Zone SoilMRLITFEDPVRQFRIGALTADGRVVDLHSACALYLRDVENES
Ga0137388_1204590913300012189Vadose Zone SoilMRLVTFENPVRQARVGALTTDRRIVDLNSACALYLRDVE
Ga0137362_1121022923300012205Vadose Zone SoilMRLVTFENPIRQLRIGALTTDHRIVDLNSACALYLRDVEGE
Ga0137379_1181443413300012209Vadose Zone SoilMRLVTFENPVRQARIGALTPDRRIVDLNSACALYLRDVDG
Ga0137395_1124850113300012917Vadose Zone SoilMRLVTFEDPVRQSRIGALTPDGRIVDLHSACALYL
Ga0157374_1142908423300013296Miscanthus RhizosphereMRLITFLNSTRQSRIGAMTPESRIVDLNSACALYLRD
Ga0181523_1050524813300014165BogMRLVTFEDGVQRNRIGAVTDDGRSVDLHSACALYLRDVENESAFERLGEALVPSNMLALFEGG
Ga0182008_1035154923300014497RhizosphereMRLITFLNSTRQSRIGAMTPESRIVDLNSACALYLRDIENENAY
Ga0182041_1074878413300016294SoilMRLVTFEDSAKNSRVGAVISDGRIVDLNSAAALYLRDVESEGAFYRLA
Ga0182037_1103453313300016404SoilMRLVTFENSVCQSRIGAWTHDGRIVDLNSAYALYLRDVRHEGA
Ga0187818_1008372733300017823Freshwater SedimentMRLVTFIDPARRSRIGAMAGDETIVDLHSACSLYLRDV
Ga0187824_1007956113300017927Freshwater SedimentMRLVSFEDPVRQSRIGALVPDGRIVDLHSACALYLRDVEHESAFYRLAEALVPPN
Ga0187819_10001412123300017943Freshwater SedimentMRLVTFEDPVKRSRIGAVTGDGSIVDLNSACALYLRDVEHEGAFYR
Ga0187817_1100608513300017955Freshwater SedimentMRLVTFEDPAKRSRIGAVTNDARIVDLHSACALYLRDVESESAFGRLA
Ga0187779_1101983623300017959Tropical PeatlandMRLLTFEDPGRRSRIGALTGDDQIVDLNSACALYLRDVEHESAYDRLA
Ga0187778_1006653433300017961Tropical PeatlandMRLLTFEDPGRRSRIGALTGDDQIVDLNSACALYLRDV
Ga0187805_1048979823300018007Freshwater SedimentMRLVTFESGPHQSRIGAISSEYFLDLNFACALYLRDVEHDPAFYRVA
Ga0187883_1010976233300018037PeatlandMRLVTFEDGVRRNRIGAVTDDGRFVDLHSACALYLRDVENESAFERLAEA
Ga0187772_1006720553300018085Tropical PeatlandMRLVTFQDPARRLRIGAVAGDSRIIDLNSACALYLREVE
Ga0187771_1191010723300018088Tropical PeatlandMRLVTFEDPVQRMRIGAVADDGRVVDLNLACALYLQQVEHEGAFYR
Ga0066662_1092148013300018468Grasslands SoilMRLVTFETPSAPARIGAVSDNDSILDLNTACALYLRDVEGESAYYRLADALVP
Ga0066669_1131168513300018482Grasslands SoilMRLITFLNSTRQSRIGAMTPESRIVDLNSACALYL
Ga0137408_115176813300019789Vadose Zone SoilMRLITFDDPVRRSRIGALATDGRIVDLNTACAVYVRDVENEGAYDRLSGALVPPNMRKLFAG
Ga0193723_107743633300019879SoilMRLVTFENPIRQARIGALTTDHRIVDLNSACALYLRDVEGE
Ga0193747_107101913300019885SoilMRLVTFEDPTRRSRVGAVTSDGRIVDLHTACALYLRDVE
Ga0210399_1040445523300020581SoilMRLVTFEDPVHQSRIGAVTADSRIVDLHSACALYLRDVESESAFY
Ga0210401_1106449023300020583SoilMRLITFEDSVRRSRIGAPTPDGRIVDLNSACALYLRDV
Ga0210406_1035656613300021168SoilMRLVTFEDPVHQSRIGAVTADSRIVDLHSACALYLRDVESESAFYRLADAL
Ga0210408_1134856113300021178SoilMRLITFENSVRQSRIGAFTAEDRIVDLNSAYALYLREVRQEG
Ga0210396_1030503813300021180SoilMRLVTFEDPARQSCVGAVTPDGRIVDLHTACALYLRDVEAESAFYRLADA
Ga0210397_1162647523300021403SoilMRLVTFEDPSKRSRTGAVVKDGRIVDLNSACALYLRDVENESAFYRL
Ga0210387_1017923713300021405SoilMRLITFEDPAQRRRIGAVTDDARFVDLHSACSLYLRDVENE
Ga0210386_1024800413300021406SoilMRLVTFENSVRQSRIGAFTAQDRIVDLNSAYALYLREVRQE
Ga0210394_1143872013300021420SoilMRLVTFEDPAQRRRIGAVTDDARFVDLHSACALYLR
Ga0210384_1082169223300021432SoilMRLVTFEDPVQRSRVGAVTDDARIVDLHSACALYLRDVENESASE
Ga0210391_1115860013300021433SoilMRLVTFEDPVHRSRIGAVTDDGRIVDLHSAGALYLRDVENENAFERL
Ga0210392_1012206923300021475SoilMRLVTFEDPSKRSRTGAVVKDGRIVDLNSACALYLRDVENESAFYRLADAMV
Ga0210398_1100126013300021477SoilMRLVTFEDPAQRRRIGAVTDDGRVVDLHSACALYLRDVEN
Ga0126371_1207870513300021560Tropical Forest SoilMRLVTFEDSNKNSRVGAVIGDGRIVDLNSAAALYLRDVESEGA
Ga0126371_1262845013300021560Tropical Forest SoilMRLITFENSVRQSRIGSLTRDDRIVDLNSAYALYLRE
Ga0212123_1076671933300022557Iron-Sulfur Acid SpringMRLVTFEDPARHSRVGAVTPDGRIVDLHTACALYLRDVE
Ga0209320_1029176813300025155SoilMRLVTFEDRSHRSRIGALTPDNRIVDLNTAFDSFRKDSEG
Ga0209171_1046815933300025320Iron-Sulfur Acid SpringMRLVTFEDPARQSRVGAVTPDGQIVDLHTACALYLRDVEAENAFYRLADALVPHN
Ga0209641_1053366623300025322SoilMRLVTFEDSARRSRSGALTPDGRIVDLNTAYALYLRDAEGEPA
Ga0208715_109668113300025482Arctic Peat SoilMRLVTFEDGVRRSRIGALAPDGRIVDLNSACALYLRDVEDEGAFYHLANALVPPNMR
Ga0207685_1064375113300025905Corn, Switchgrass And Miscanthus RhizosphereMRLISFLNSARQSRIGAMTTGGRIIDLNSACALYLRDVENEN
Ga0207707_1026227413300025912Corn RhizosphereMRLVTFETSAKQSRIGAISADGRVIDLNSACALYLRDVESESAF
Ga0207690_1151706523300025932Corn RhizosphereMRFITFDDPVRRSRIGALAPDGRIVDLNSACALYLRDVEN
Ga0207665_1077306643300025939Corn, Switchgrass And Miscanthus RhizosphereMKLVTFENYVRQPRIGALTADQRIIDLNSAYALYLR
Ga0207665_1083966313300025939Corn, Switchgrass And Miscanthus RhizosphereMRLITFEDSVKRSRIGAVTPDGRIGDLKIVDLNSACALYLRD
Ga0207665_1156605813300025939Corn, Switchgrass And Miscanthus RhizosphereMRLVTFEDPVHQSRIGAMTADGRIVDLHSACALYLRDV
Ga0209055_123319513300026309SoilMRLVTFEDPVRQARVGALTTDRRIVDLNSACALYLRDVE
Ga0209471_111334813300026318SoilMRLVTFETAAKQSRIGAVTTDERIVDLNLACALYL
Ga0209470_138373823300026324SoilMRLVTFEDSVRRSRIGAIAAEDRVVDLHSACALYLREVEGEAAF
Ga0209267_111340313300026331SoilMRLVTFEDPVRQSRVGALTTDGRIIDLHSACALYLREVEN
Ga0207484_10028743300027466SoilMRLVTFESSAKQSRIGAITANDRIIDLNSACALYLRDVESESAFYRLADA
Ga0208043_109636913300027570Peatlands SoilMRLVTFEDPVRRSRVGAVADDGRIVDLHSACALYLRDVE
Ga0208324_114877723300027604Peatlands SoilMRLVTFEDPAKRSRTGAVTNDARIVDLHSACALYLRD
Ga0209580_1061286913300027842Surface SoilMRLVTFEDPAQRRRIGAVTGDARFVDLHSACSLYLRDVE
Ga0209274_1069552423300027853SoilMRLVTFEDPVQRTRIGGVTDDGRFVDLHSACALYLRDVENESAFE
Ga0209579_1044880013300027869Surface SoilMRLVTFEDTAHRSRIGAVTADNRVIDLNNACALYLREVEDESAFSRLADAL
Ga0209283_1085948913300027875Vadose Zone SoilMRLVTFEDPVRQSRIGAMTADGRIVDLHSACALYLRDV
Ga0209590_1084528723300027882Vadose Zone SoilMRLVTFENPVRQACIGALTTDRRIVDLNSACALYLRDV
Ga0307305_1008575523300028807SoilMRLVTFEDPARQSRVGALTPDGRIVDLHTACALYLRDVESE
Ga0308309_1072164913300028906SoilMRLITFEDPVRRSRVGAVTGDEKVVDLNSACALYLREVENESAFYRLADALV
Ga0222748_110476513300029701SoilMRLVTFEDPAQRRRIGAVTDDARFVDLHSACALYLRDVESESAFERLADALFRPTCSLCSRA
Ga0307469_1165277613300031720Hardwood Forest SoilMRLVTFENPVRQARIGALTTDRRIVDLNLACAMYLRDVEGENAHVRLADALVPGNMRAL
Ga0307469_1169781013300031720Hardwood Forest SoilMRLITFEDPLRRSRGGALAPDGRIVDLNSACALYLRDVDKQSAYSRLSDALV
Ga0318509_1078076813300031768SoilMRLLTFEDPGRRSRIGALTAGDQIVDLNSACALYLRDVEHESAYDRLADA
Ga0307473_1059472623300031820Hardwood Forest SoilMRLVTFEDPVRQSRIGAMTADGRIVDLHSACALYLRD
Ga0307473_1135486713300031820Hardwood Forest SoilMRLVTFEDPGRQSRVGALTADERIVDLHSACALYLRDVEKESAFYRLATA
Ga0306919_1107859323300031879SoilMRLVTFEDAVRRTRIGAVLADGRVVDLNSACALYLREVESESAFE
Ga0307472_10002580213300032205Hardwood Forest SoilMRLVTFENPARQSRIGAMTDDGRVVDLHSACALYLRDVENESAFYRLAE
Ga0335079_1029638713300032783SoilMRLVTFETNACQLRVGAFAPDGRIVDLSSACALYLQQEKGESAFYRLADALVPSE
Ga0335079_1129267523300032783SoilMRLVTFINPAGENRIGARAADNDIVDLNRAAALYLRDVEHEAA
Ga0335081_1083356413300032892SoilMRLLTFEDPGRRSRIGALTADDQIVDLNSACALYLREVEHESAYDRLADAL
Ga0335069_1125282113300032893SoilMKLVTFEDPVRRSRIGAVTSDGSIVDLHSACALYLRDVEAEAAFYR
Ga0335076_1058806723300032955SoilMKLVTFEDAVKRSRIGAVTDDGRIVDLNAACALYLRDVEHEEAFGRLAGAL
Ga0335073_1034313613300033134SoilMRLVTFETNACQLRVGAFAPDGRIVDLSSACALYLQQEKGESAFYRLADALVPSEMGAL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.