| Basic Information | |
|---|---|
| Family ID | F074905 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MADISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAVGGL |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.16 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.513 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (23.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.345 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.118 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 17.65% Coil/Unstructured: 82.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF13489 | Methyltransf_23 | 1.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.96 % |
| Unclassified | root | N/A | 5.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10009271 | Not Available | 5325 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10019370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3343 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10170692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10175268 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10089712 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10117814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 935 | Open in IMG/M |
| 3300000949|BBAY94_10163604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300001450|JGI24006J15134_10005682 | Not Available | 6474 | Open in IMG/M |
| 3300001450|JGI24006J15134_10019239 | All Organisms → Viruses → Predicted Viral | 3174 | Open in IMG/M |
| 3300005239|Ga0073579_1235051 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005430|Ga0066849_10007543 | All Organisms → Viruses → Predicted Viral | 4418 | Open in IMG/M |
| 3300006025|Ga0075474_10215150 | Not Available | 586 | Open in IMG/M |
| 3300006403|Ga0075514_1945584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
| 3300006571|Ga0075505_1004400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
| 3300006737|Ga0098037_1221712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300006802|Ga0070749_10036542 | All Organisms → Viruses → Predicted Viral | 3035 | Open in IMG/M |
| 3300006920|Ga0070748_1182526 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006929|Ga0098036_1026181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1839 | Open in IMG/M |
| 3300007144|Ga0101670_1083031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300007215|Ga0079272_1121547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300007215|Ga0079272_1211335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
| 3300007236|Ga0075463_10293368 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300007340|Ga0079241_1340909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300007539|Ga0099849_1081711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1306 | Open in IMG/M |
| 3300007539|Ga0099849_1168362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 839 | Open in IMG/M |
| 3300007596|Ga0102802_1104065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300009071|Ga0115566_10079967 | All Organisms → Viruses → Predicted Viral | 2137 | Open in IMG/M |
| 3300009481|Ga0114932_10510396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300009677|Ga0115104_10694987 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300009679|Ga0115105_10591047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300009679|Ga0115105_11280965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300009739|Ga0123362_1083664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
| 3300009790|Ga0115012_10764311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
| 3300010149|Ga0098049_1258415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300010296|Ga0129348_1225603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300010318|Ga0136656_1116468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300012520|Ga0129344_1034267 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012520|Ga0129344_1261358 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012525|Ga0129353_1307654 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300012528|Ga0129352_10108259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300012920|Ga0160423_10141268 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300012920|Ga0160423_10681831 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012963|Ga0129340_1241280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300016732|Ga0182057_1454176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300016733|Ga0182042_1110968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300016735|Ga0182074_1210270 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300016739|Ga0182076_1570601 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300016741|Ga0182079_1249768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300016741|Ga0182079_1458599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300016743|Ga0182083_1650583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
| 3300016747|Ga0182078_10950033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 747 | Open in IMG/M |
| 3300016762|Ga0182084_1120422 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300016771|Ga0182082_1440952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300017697|Ga0180120_10026623 | All Organisms → Viruses → Predicted Viral | 2689 | Open in IMG/M |
| 3300017738|Ga0181428_1072649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 803 | Open in IMG/M |
| 3300017745|Ga0181427_1135776 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300017759|Ga0181414_1069058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 938 | Open in IMG/M |
| 3300017760|Ga0181408_1094328 | Not Available | 781 | Open in IMG/M |
| 3300017764|Ga0181385_1180172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300017771|Ga0181425_1128054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300017772|Ga0181430_1170869 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300017818|Ga0181565_10752051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300017949|Ga0181584_10395718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 866 | Open in IMG/M |
| 3300017952|Ga0181583_10656290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300017956|Ga0181580_10620202 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300017964|Ga0181589_10747294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
| 3300017967|Ga0181590_10954935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300017968|Ga0181587_10798427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300018418|Ga0181567_10657894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300018428|Ga0181568_10002827 | All Organisms → cellular organisms → Bacteria | 15775 | Open in IMG/M |
| 3300019262|Ga0182066_1090573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300019280|Ga0182068_1157204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 783 | Open in IMG/M |
| 3300019280|Ga0182068_1604372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300019281|Ga0182077_1070971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300019282|Ga0182075_1054352 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300019283|Ga0182058_1550424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300019283|Ga0182058_1750549 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300019937|Ga0194022_1010592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1199 | Open in IMG/M |
| 3300020299|Ga0211615_1029838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 796 | Open in IMG/M |
| 3300020371|Ga0211500_1042778 | All Organisms → Viruses → Predicted Viral | 1422 | Open in IMG/M |
| 3300020409|Ga0211472_10011958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3380 | Open in IMG/M |
| 3300020416|Ga0211644_10058918 | All Organisms → Viruses → Predicted Viral | 1554 | Open in IMG/M |
| 3300020432|Ga0211556_10205430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300021364|Ga0213859_10461828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300021379|Ga0213864_10568155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300021959|Ga0222716_10585081 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300021960|Ga0222715_10705522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300021961|Ga0222714_10589594 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300022065|Ga0212024_1084950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300022068|Ga0212021_1126273 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300022159|Ga0196893_1027290 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300022925|Ga0255773_10215699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 852 | Open in IMG/M |
| 3300023116|Ga0255751_10029540 | All Organisms → Viruses → Predicted Viral | 4045 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10043850 | All Organisms → Viruses → Predicted Viral | 1810 | Open in IMG/M |
| 3300025070|Ga0208667_1036926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
| 3300025071|Ga0207896_1054080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
| 3300025102|Ga0208666_1088136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300025108|Ga0208793_1146904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300025120|Ga0209535_1025718 | All Organisms → Viruses → Predicted Viral | 2875 | Open in IMG/M |
| 3300025120|Ga0209535_1175693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300025127|Ga0209348_1221648 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300025131|Ga0209128_1033816 | All Organisms → Viruses → Predicted Viral | 2041 | Open in IMG/M |
| 3300025138|Ga0209634_1033032 | All Organisms → Viruses → Predicted Viral | 2716 | Open in IMG/M |
| 3300025151|Ga0209645_1034576 | All Organisms → Viruses → Predicted Viral | 1842 | Open in IMG/M |
| 3300025751|Ga0208150_1099126 | Not Available | 953 | Open in IMG/M |
| 3300025769|Ga0208767_1029900 | All Organisms → Viruses → Predicted Viral | 2834 | Open in IMG/M |
| 3300025803|Ga0208425_1079911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
| 3300025803|Ga0208425_1114812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300025818|Ga0208542_1112107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
| 3300025828|Ga0208547_1193816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300025890|Ga0209631_10225659 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300026447|Ga0247607_1043628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 778 | Open in IMG/M |
| 3300028196|Ga0257114_1255313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300028335|Ga0247566_1015461 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
| 3300029302|Ga0135227_1043411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300029318|Ga0185543_1036422 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300032277|Ga0316202_10098597 | Not Available | 1354 | Open in IMG/M |
| 3300034374|Ga0348335_001570 | All Organisms → cellular organisms → Bacteria | 16681 | Open in IMG/M |
| 3300034374|Ga0348335_031931 | All Organisms → Viruses → Predicted Viral | 2300 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 23.53% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.17% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 18.49% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.56% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.88% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.04% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.36% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.52% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.52% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.68% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.84% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.84% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.84% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.84% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.84% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.84% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.84% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.84% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.84% |
| Volcanic Co2 Seep | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep | 0.84% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006571 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007144 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', waterEBic1 | Environmental | Open in IMG/M |
| 3300007215 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 DCM_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007340 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 c16 DCM_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007596 | Marine microbial communities from the Southern Atlantic ocean - KN S19 DCM_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009739 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_194_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012963 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016732 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016733 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016735 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016739 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016741 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016743 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016762 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019262 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019280 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019281 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019282 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
| 3300020299 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX555923-ERR599016) | Environmental | Open in IMG/M |
| 3300020371 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555978-ERR598991) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020432 | Marine microbial communities from Tara Oceans - TARA_B100002052 (ERX556103-ERR599100) | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026447 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028335 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029302 | Marine harbor viral communities from the Indian Ocean - SRB3 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100092711 | 3300000115 | Marine | MGAITTPDPIYASDINNFQGELFKVGGQRTPFLSAM |
| DelMOSpr2010_100193701 | 3300000116 | Marine | MAAITLTGNAIYSQNINNFSGELFRVGGQRTPFLSATGGLN |
| DelMOSpr2010_101706921 | 3300000116 | Marine | MGAISLTNNSIYSQKINNFSGELFRVGGQRTPFLSATGGLNGG |
| DelMOSpr2010_101752681 | 3300000116 | Marine | MGAITTPDPIYTSDINNFQGELFRVGGQRTPFLSAMGGLSGGGK |
| DelMOWin2010_100897124 | 3300000117 | Marine | MGAIATPDPIYASDINNFQGELFKVGGQRTPFLSAMGGL |
| DelMOWin2010_101178143 | 3300000117 | Marine | MAAITLTGNAIYSQNINNFSGELFRVGGQRTPFLSATG |
| BBAY94_101636041 | 3300000949 | Macroalgal Surface | MAEITLTGDAIYSQNINNFSGELFRVGGQRTPFLSATGGLNG |
| JGI24006J15134_100056821 | 3300001450 | Marine | MGAITTPDPIYASDINNFQGELFKVGGQRTPFLSAMGGLT |
| JGI24006J15134_100192394 | 3300001450 | Marine | MGAISLTNSSIYAQNINNFTGELFKVGGQRTPFLSAVGGLNGGTAI |
| Ga0073579_12350511 | 3300005239 | Marine | MGAITTPDPIYASDINNFQGELFKVGGQRTPFLSAMGGLTGGGKVI |
| Ga0066849_100075435 | 3300005430 | Marine | MASISLTNSAIYSQKINNFTGELFRVGGQRTPFLSAIGGLNGG |
| Ga0075474_102151502 | 3300006025 | Aqueous | MGPITTPDPIYASDINNFQGELFKVGGQRTPFLSAM |
| Ga0075514_19455842 | 3300006403 | Aqueous | MAAISLTGNAIYSQNINNFSGELFRVGGQRTPFLSATG |
| Ga0075505_10044003 | 3300006571 | Aqueous | MAGITLTGNAIYSQNINNFSGELFRVGGQRTPFLSATG |
| Ga0098037_12217122 | 3300006737 | Marine | MANISLTNSTIYAQNINNFAGELFKVGGQRTPLLSSVGGLNGGKV |
| Ga0070749_100365424 | 3300006802 | Aqueous | MAGITLTNNAIYSQKINNFSGELFRVGGQRTPFLSATGGLNG |
| Ga0070748_11825263 | 3300006920 | Aqueous | MGPITTPDPIYASDINNFQGELFKVGGQRTPFLSAMG |
| Ga0098036_10261811 | 3300006929 | Marine | MANISLTNSTIDAQNINNFAGELFKVGGQRTPLLSSVGGLNGGK |
| Ga0101670_10830312 | 3300007144 | Volcanic Co2 Seep | MAAITLTGDTLYSQKINNFAGELFRVGGQRTPFLSAT |
| Ga0079272_11215471 | 3300007215 | Marine | MADISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAVGGLNG |
| Ga0079272_12113352 | 3300007215 | Marine | MANISLTGDTLYSQKINNFSGELFRVGGQRTPFLSAT |
| Ga0075463_102933682 | 3300007236 | Aqueous | MGAISLTNSSIYAQKINNFSGELFKVGGQRTPFLSATGG |
| Ga0079241_13409092 | 3300007340 | Marine | MASISLTNSTIYSQNINNFTGELFRVGGQRTPFLSAIGGLN |
| Ga0099849_10817111 | 3300007539 | Aqueous | MASISLTGNTIYSQNINNFSGELFRVGGQRTPFLSATGG |
| Ga0099849_11683622 | 3300007539 | Aqueous | MANISLTNNTIYAQNINNFTGELFKVGGQRTPLLSSVGGLNGGKVL |
| Ga0102802_11040652 | 3300007596 | Marine | MAAITLTGDTLYSQKINNFTGELFRVGGQRTPFLSAT |
| Ga0115566_100799674 | 3300009071 | Pelagic Marine | MGAISLTNNSIYSQKINNFSGELFRVGGQRTPFLSATGGLNG |
| Ga0114932_105103961 | 3300009481 | Deep Subsurface | MADISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAV |
| Ga0115104_106949871 | 3300009677 | Marine | MGAISLTNSSIYAHNINNFTGELFKVGGQRTPFLSATGGLNG |
| Ga0115105_105910472 | 3300009679 | Marine | MASISLTNSTIYSQNINNFTGELFRVGGQRTPFLSAIGGLNG |
| Ga0115105_112809652 | 3300009679 | Marine | MADISLTNSTIYAQNINNLTGELFKVGGQRTPLLSSVG |
| Ga0123362_10836641 | 3300009739 | Marine | MAAISLTGNTIYSQNVNNFTGELFRVGGQRTPFLSAT |
| Ga0115012_107643111 | 3300009790 | Marine | MAAITLTGDTLYSQKINNFSGELFRVGGQRTPFLS |
| Ga0098049_12584152 | 3300010149 | Marine | MAAITLTGDTLYSQKINNFTGELFRVGGQRTPFLSATGGLNGG |
| Ga0129348_12256032 | 3300010296 | Freshwater To Marine Saline Gradient | MANISGLSGSVPIYSQQINNFSGELFRVGGQRTPFLSATGGLNG |
| Ga0136656_11164681 | 3300010318 | Freshwater To Marine Saline Gradient | MANISLTNNTIYAQNINNFTGELFKVGGQRTPLLSSVGGLNGGKV |
| Ga0129344_10342671 | 3300012520 | Aqueous | MAAITTPDPIYSQDINNFQGELFRVGGQRTPFLSAMG |
| Ga0129344_12613582 | 3300012520 | Aqueous | MANISLTNSTIYAQNINNFTGELFKVGGQRTPLLSAV |
| Ga0129353_13076541 | 3300012525 | Aqueous | MANISLTNSTIYAQNINNFTGELFKVGGQRTPLLSAVGGL |
| Ga0129352_101082592 | 3300012528 | Aqueous | MAGISLTGNTIYSQNVNNFSGELFRVGGQRTPFLSATGGLNG |
| Ga0160423_101412681 | 3300012920 | Surface Seawater | MADISLTNSTIYAQNINNFTGELFKVGGQRTPLLSAV |
| Ga0160423_106818311 | 3300012920 | Surface Seawater | MANISLTNSTIYAQNINNFTGELFKVGGQRTPLLSAVGG |
| Ga0129340_12412802 | 3300012963 | Aqueous | MANISLTNNTIYAQNINNFTGELFKVGGQRTPLLSSVGGLNGGK |
| Ga0182057_14541762 | 3300016732 | Salt Marsh | MAEITLTGNAIYSQNINNFSGELFRVGGQRTPFLSA |
| Ga0182042_11109682 | 3300016733 | Salt Marsh | MADISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAVGGLNGGKVL |
| Ga0182074_12102701 | 3300016735 | Salt Marsh | MGAITTPDPIYSQDINNFQGELFRVGGQRTPFLSAI |
| Ga0182076_15706011 | 3300016739 | Salt Marsh | MAEITTPNPIYSQDINNFQGELFRVGGQRTPFLSAI |
| Ga0182079_12497681 | 3300016741 | Salt Marsh | MANISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAVGGLN |
| Ga0182079_14585991 | 3300016741 | Salt Marsh | MAAISLTNNTIYSQNINNFQGELFRVGGQRTPMVSA |
| Ga0182083_16505831 | 3300016743 | Salt Marsh | MAGISLTGNTIYSQNINNFSGELFRVGGQRTPFLSA |
| Ga0182078_109500331 | 3300016747 | Salt Marsh | MPQIQSGSLTNSTIYSQVINNFSGELFKVGGQRTPFL |
| Ga0182084_11204221 | 3300016762 | Salt Marsh | MASISLTNSTIYAQNINNFTGELFKVGGQRTPFTSAVGGISGGG |
| Ga0182082_14409521 | 3300016771 | Salt Marsh | MADISLTNNTIYAQNINNFTGELFKVGGQRTPFTSA |
| Ga0180120_100266234 | 3300017697 | Freshwater To Marine Saline Gradient | MGAIATPDPIYASDINNFQGELFKVGGQRTPFLSAM |
| Ga0181428_10726491 | 3300017738 | Seawater | MAAITLTGDTLYSQKINNFSGELFRVGGQRTPFLSATGGLNGGKV |
| Ga0181427_11357761 | 3300017745 | Seawater | MGAISTPDPIYASDINNFQGELFKVGGQRTPFLSAMGGL |
| Ga0181414_10690581 | 3300017759 | Seawater | MAGISLTNDAIYSQKINNFSGELFRVGGQRTPFLS |
| Ga0181408_10943282 | 3300017760 | Seawater | MADISLTNSTIYAQNINNFTGELFKVGGQRTPLLSAVGGLNGGK |
| Ga0181385_11801722 | 3300017764 | Seawater | MGAISLTNSSIYAQNINNFTGELFKVGGQRTPLLSA |
| Ga0181425_11280542 | 3300017771 | Seawater | MGAISLTNSSIYAQNINNFTGELFKVGGQRTPFLSAVGGLNGGTA |
| Ga0181430_11708692 | 3300017772 | Seawater | MGAISLTNSSIYAQTINNFSGELFKVGGQRTPFLSAVGGL |
| Ga0181565_107520512 | 3300017818 | Salt Marsh | MADISFTNNTIYAQNINNFTGELFKVGGQRTPLLSAVGGLNGGK |
| Ga0181584_103957182 | 3300017949 | Salt Marsh | MASISLTNNAIYSQNINNFSGELFRVGGQRTPFLS |
| Ga0181583_106562902 | 3300017952 | Salt Marsh | MAEISLTGNAIYSQNINNFSGELFRVGGQRTPFLSATGGLNGG |
| Ga0181580_106202022 | 3300017956 | Salt Marsh | MANISLTNSTIYAQNINNFTGELFKVGGQRTPLLSAVGGLNGGKV |
| Ga0181589_107472941 | 3300017964 | Salt Marsh | MAEISLTGNAIYSQNINNFSGELFRVGGQRTPFLSATG |
| Ga0181590_109549352 | 3300017967 | Salt Marsh | MAAISLTNNTIYAQNINNFTGELFKVGGQRTPLLS |
| Ga0181587_107984272 | 3300017968 | Salt Marsh | MAAISLTGNAIYSQNINNFSGELFRVGGQRTPFLSATGGLNG |
| Ga0181567_106578942 | 3300018418 | Salt Marsh | MPQIQSGSLTNDTIYSQVINNFSGELFKVGGQRTPFLSAVGGL |
| Ga0181568_1000282711 | 3300018428 | Salt Marsh | MAEITLTGNAIYSQNINNFSGELFRVGGQRTPFLSATG |
| Ga0182066_10905732 | 3300019262 | Salt Marsh | MAEITLTGNAIYSQNINNFSGELFRVGGQRTPFLSATGGLNG |
| Ga0182068_11572042 | 3300019280 | Salt Marsh | MASISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAVGGLNG |
| Ga0182068_16043722 | 3300019280 | Salt Marsh | MAEITLTGNAIYSQNINNFSGELFRVGGQRTPFLSATGGL |
| Ga0182077_10709711 | 3300019281 | Salt Marsh | MAAISLTNNTIYAQNINNFTGELFKVGGQRTPLLSSVGGLNG |
| Ga0182075_10543522 | 3300019282 | Salt Marsh | MASISLTNSTIYAQNINNFTGELFKVGGQRTPFTSAVGGISGGGKVIQ |
| Ga0182058_15504242 | 3300019283 | Salt Marsh | MADISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAVG |
| Ga0182058_17505491 | 3300019283 | Salt Marsh | MADISLTNNTLYAQNINNFAGELFKVGGQRTPLLSAVGGLNG |
| Ga0194022_10105921 | 3300019937 | Freshwater | MANISLTNNTLYAQNINNFTGELFKVGGQRTPFTS |
| Ga0211615_10298381 | 3300020299 | Marine | MASISLTNSTIYSQNINNFTGELFRVGGQRTPFLSAIGG |
| Ga0211500_10427783 | 3300020371 | Marine | MANISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAVGG |
| Ga0211472_100119581 | 3300020409 | Marine | MAEISLTNNTLYAQNINNFAGELFKVGGQRTPLLSAVGGLNGGKSI |
| Ga0211644_100589181 | 3300020416 | Marine | MGAISLTNNTIYAQNINNFTGELFKVGGQRTPLLTA |
| Ga0211556_102054301 | 3300020432 | Marine | MADISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAVGGLNGGK |
| Ga0213859_104618281 | 3300021364 | Seawater | MADISLTNNTIYAQNINNFTGELFKVGGQRTPLLSSVGGLNG |
| Ga0213864_105681551 | 3300021379 | Seawater | MADISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAVGGL |
| Ga0222716_105850812 | 3300021959 | Estuarine Water | MADISLTNSTIYAQQINNFTGELFKVGGQRTPLLSAVGGL |
| Ga0222715_107055221 | 3300021960 | Estuarine Water | MADISLTNSTIYAQNINNFTGELFKVGGQRTPLLSAVGGLNGGKTL |
| Ga0222714_105895942 | 3300021961 | Estuarine Water | MGPITTPNPIYASDINNFQGELFKVGGQRTPFLSAMGGLTGGGK |
| Ga0212024_10849502 | 3300022065 | Aqueous | MAAISLTNSTIYAQNINNFAGELFKVGGQRTPLLSAA |
| Ga0212021_11262731 | 3300022068 | Aqueous | MANISLTNSTIYAQNINNFTGELFKVGGQRTPLLS |
| Ga0196893_10272902 | 3300022159 | Aqueous | MGPITTPDPIYASDINNFQGELFKVGGQRTPFLSAMGGLTGGGKVIQST |
| Ga0255773_102156991 | 3300022925 | Salt Marsh | MASISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAVGGLNGGKVL |
| Ga0255751_100295405 | 3300023116 | Salt Marsh | MAEISLTGNAIYSQNINNFSGELFRVGGQRTPFLSATGGLNG |
| (restricted) Ga0233412_100438501 | 3300023210 | Seawater | MGAITTPDPIYASDINNFQGELFKVGGQRTPFLSAMGGL |
| Ga0208667_10369262 | 3300025070 | Marine | MAGISLTGNTIYSQNINNFSGELFRVGGQRTPFLSATGGLNG |
| Ga0207896_10540802 | 3300025071 | Marine | MAAITLTNNSIYSQKINNFSGELFRVGGQRTPFLSATGGLNGG |
| Ga0208666_10881361 | 3300025102 | Marine | MANISLTNSTIYAQNINNFAGELFKVGGQRTPLLSSVGGLNGG |
| Ga0208793_11469041 | 3300025108 | Marine | MADISLTNNTIYAQNINNFTGELFKVGGQRTPLLS |
| Ga0209535_10257184 | 3300025120 | Marine | MGAISLTNSSIYAQKINNFSGELFKVGGQRTPFLSAV |
| Ga0209535_11756931 | 3300025120 | Marine | MGAISLTNSSIYAQNINNFTGELFKVGGQRTPFLS |
| Ga0209348_12216482 | 3300025127 | Marine | MGPITTPDPIYASDINNFQGELFKVGGQRTPFLSAMGGLTG |
| Ga0209128_10338163 | 3300025131 | Marine | MAAISLTNSTIYAQNINNFAGELFKVGGQRTPFLSAV |
| Ga0209634_10330321 | 3300025138 | Marine | MGAISLTNSSIYAQTINNFSGELFKVGGQRTPFLSAVGG |
| Ga0209645_10345761 | 3300025151 | Marine | MAAITLTGDTLYSQKINNFTGELFRVGGQRTPFLS |
| Ga0208150_10991261 | 3300025751 | Aqueous | MGPITTPDPIYASDINNFQGELFKVGGQRTPFLSA |
| Ga0208767_10299001 | 3300025769 | Aqueous | MASISLTGNAIYSQNINNFSGELFRVGGQRTPFLSATGG |
| Ga0208425_10799111 | 3300025803 | Aqueous | MASISLTGNAIYSQNINNFSGELFRVGGQRTPFLSATG |
| Ga0208425_11148122 | 3300025803 | Aqueous | MAAITLTGNAIYSQNINNFSGELFRVGGQRTPFLSATGG |
| Ga0208542_11121071 | 3300025818 | Aqueous | MAAITLTGNAIYSQNINNFSGELFRVGGQRTPFLSATGGLNGG |
| Ga0208547_11938162 | 3300025828 | Aqueous | MAGITLTNDAIYSQKINNFSGELFRVGGQRTPFLSATGGLNGG |
| Ga0209631_102256591 | 3300025890 | Pelagic Marine | MGPITTPDPIYASDINNFQGELFKVGGQRTPFLSAMGGLT |
| Ga0247607_10436283 | 3300026447 | Seawater | MAGISLTNDAIYSQKINNFSGELFRVGGQRTPFLSA |
| Ga0257114_12553132 | 3300028196 | Marine | MAAITLTGDTLYSQKINNFSGELFRVGGQRTPFLSATG |
| Ga0247566_10154612 | 3300028335 | Seawater | MAAITLTGDTLYSQKINNFSGELFRVGGQRTPFLSATGG |
| Ga0135227_10434111 | 3300029302 | Marine Harbor | MASISLTNNTIYAQNINNFTGELFKVGGQRTPLLSAVGGLPIVTGK |
| Ga0185543_10364221 | 3300029318 | Marine | MADISLGGAGSDTIYAQHINNFTGELFKVGGQRTPLLTAVGG |
| Ga0316202_100985971 | 3300032277 | Microbial Mat | MGAIATPDPIYASDINNFQGELFKVGGQRTPFLSA |
| Ga0348335_001570_16548_16679 | 3300034374 | Aqueous | MGAITTPDPIYASDINNFQGELFKVGGQRTPFLSAMGGLTGGGK |
| Ga0348335_031931_2167_2298 | 3300034374 | Aqueous | MGPITTPDPIYASDINNFQGELFKVGGQRTPFLSAMGGLTGGGK |
| ⦗Top⦘ |