 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F073595 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LNREGHAVSAGPVKTFRNVGDGKNATADLWTKGNLRVKRRDPWHRAN |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 94.12 % |
| % of genes near scaffold ends (potentially truncated) | 97.50 % |
| % of genes from short scaffolds (< 2000 bps) | 99.17 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (89.167 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.33% β-sheet: 0.00% Coil/Unstructured: 78.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00006 | ATP-synt_ab | 0.83 |
| PF13407 | Peripla_BP_4 | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 89.17 % |
| All Organisms | root | All Organisms | 10.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 33.33% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 20.00% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 7.50% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 5.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.33% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 3.33% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.50% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 1.67% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.67% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.67% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.83% |
| Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.83% |
| Subtropical Soil | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Subtropical Soil | 0.83% |
| Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2222084002 | Subtropical soil microbial communities from Bundaberg Australia-sugarcane farm | Environmental | Open in IMG/M |
| 3300002869 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 20 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004473 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004560 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 28 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004611 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004619 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004620 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005646 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006378 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006593 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gly_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006938 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A001 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007327 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaT_ABR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300008786 | Microbial communities from wetland soil in Czech Republic - M3_cDNA | Environmental | Open in IMG/M |
| 3300008884 | Microbial communities of wastewater sludge from Singapore - Sludge3_b2_February | Environmental | Open in IMG/M |
| 3300009579 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009582 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009586 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009755 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010110 | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010138 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010305 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011020 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 78 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011027 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 70 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011033 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 33 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011038 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 28 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011055 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011057 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011065 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300013041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013078 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016701 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019199 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019210 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC030_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019211 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019226 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC055_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019231 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019246 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019250 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019251 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019252 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020066 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021273 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021316 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021856 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300028450 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300034480 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DRAFT_00456290 | 2222084002 | Subtropical Soil | VVSAGPVKTFRNASDVKNTPLGLRTKGNLRVKRRDPWHE |
| Ga0006819J43187_1047682 | 3300002869 | Peatlands Soil | MERSIRGGHAATAGPVKTFREVGGVTNDAADLWMKGNLRVKRRDP |
| JGIcombinedJ51221_104644681 | 3300003505 | Forest Soil | LHRGGHGVSAGPVKTFQDVGDIKNDTAELAMKGNLRVKRRD |
| Ga0058891_15649281 | 3300004104 | Forest Soil | LHRGGHGVSAGPVKTFQDVGDIKNDTAELAMKGNLRVKRRDPWHWAN |
| Ga0068919_14194291 | 3300004473 | Peatlands Soil | LNREGHAASAGPVKTFREVGDIKNDTADLWTKGNLRVKRR |
| Ga0068940_12086691 | 3300004560 | Peatlands Soil | MERSIRGGHVATAGPVKTFQVVGGITNDAADLWMKGNLRVKRRDPWHW |
| Ga0068925_13732712 | 3300004611 | Peatlands Soil | MERSIRGGHVATAGPVKTFQVVGGITNDAADLWMKGNLRVKRRDPW |
| Ga0068953_10367781 | 3300004619 | Peatlands Soil | LNREGHGVSAGPVKTFRNVGDGKNATADLWTKGNLRVKRRDPWHRAN |
| Ga0068957_10139531 | 3300004620 | Peatlands Soil | LNREGHGVSAGPVKTFRNVVDGKNATADLWTKGNLRVKRRDPWHWANALPKAAA |
| Ga0075040_19396091 | 3300005646 | Permafrost Soil | LHRGGHAVSAGPVKTFQNVGDVTNDTADLSMKGNLRVKRRDPWHRANA |
| Ga0075498_13875821 | 3300006378 | Aqueous | LHRGGHGVSAGPVKTFRDVGDAKNGIADLWTKGDLRVKRRDPWLRANAL |
| Ga0079081_10280311 | 3300006593 | Anaerobic Digestor Sludge | ERPNREGHAASARLVKTFQRVGDVKNDTAGLWTKGNLRVKTEFN* |
| Ga0081245_14822121 | 3300006938 | Tropical Rainforest Soil | LNREGHGVSAGPVKTFRNVGDAKNGTADLWTKSNLRVKRRDPWHRANALP |
| Ga0075016_10345441 | 3300007327 | Watersheds | VASAGPVKTFQEVGDVKNDTADLWTKSNLRVKRRDPWH |
| Ga0075016_14441251 | 3300007327 | Watersheds | MERSRREGHAATAGPVKTFREVGGIKNGTADLWMKGNLRVKRRDPWHRANA |
| Ga0103639_10085481 | 3300008786 | Wetland Soil | LNREGHAVSAGPVKTFRNVGDGKNATADLWTKGNLRVKRRDPW |
| Ga0103746_100491271 | 3300008884 | Wastewater Sludge | LHREGHGDSAGPVKTFRNVGDAKNGTADLWTKGDLRDKRRDPWLWANALSK |
| Ga0115599_10692491 | 3300009579 | Wetland | VKTFRNAGDVKNGTAGLRTKSNLRVKRRDPWHRANV |
| Ga0115600_10500871 | 3300009581 | Wetland | LHREGHAVWAGPVKTFRNVGDVKNGTADLWTKGNLRDKRRDPWHRAN |
| Ga0115601_11178481 | 3300009582 | Wetland | VVSAGLVKTFRNVGDGKNATADLLGKGNLRVKRRDPWHRANAPPRAVAD |
| Ga0115591_10021052 | 3300009586 | Wetland | LHREGHAVWAGPVKTFRNVGDVKNGTADLWTKGNLRDKRRD |
| Ga0115591_10103941 | 3300009586 | Wetland | VVSAGLVKTFRNVGDGKNATADLLGKGNLRVKRRDPWHRAN |
| Ga0115592_11769731 | 3300009755 | Wetland | VASAGPVKTFREVGGVKNDTADLWTKGNLRVKRRDPWH |
| Ga0127500_10449821 | 3300010103 | Grasslands Soil | VVSAEPVKTFRNVSDVKNDTAGLRTKSNLRVKRRDPWHRAN |
| Ga0126316_10763821 | 3300010110 | Soil | VVSAEPVKTFQNVSDAKNGTAGLRTKSNLRVKRRDPWHRANVPIK |
| Ga0115595_10297611 | 3300010138 | Wetland | VVSAGPVKTFRNASDVKNGTAGLRTKGNLREKRRDPWH |
| Ga0129320_1333081 | 3300010305 | Aqueous | LNREGHAASAGPVKTFQKVGDVKNDTADLWTKGNLRVKRR |
| Ga0126349_11333091 | 3300010861 | Boreal Forest Soil | LNREGHGVSAGPVKTFQEVGDAKNGSADLWTKGNLRVKRRDPWHWANALPK |
| Ga0138602_1070942 | 3300011020 | Peatlands Soil | MERSIRGGHAATAGPVKTFREVGGVTNDAADLWMKGNLRVK |
| Ga0138580_1258811 | 3300011027 | Peatlands Soil | LNREGHAASAGPVKTFREVGDIKNDTADLWTKGNLRVK |
| Ga0138552_1100641 | 3300011033 | Peatlands Soil | LNREGHAASAGPVKTFREVGDIKNDTADLWTKGNLRVKRRDPWHRANARPK |
| Ga0138547_1021561 | 3300011038 | Peatlands Soil | VATAGPVKTFQVVGGITNDAADLWMKGNLRVKRRDPWHW |
| Ga0138550_1039762 | 3300011055 | Peatlands Soil | MERSIRGGHAATAGPVKTFQVVGGITNDAADLWMKGNLRVKRRDPWHWA |
| Ga0138544_10074001 | 3300011057 | Peatlands Soil | LNREGHGVSAGPVKTFRNVGDGKNATADLWTKGNLRVKRRDPWH |
| Ga0138544_10838471 | 3300011057 | Peatlands Soil | LIREGHGVSAGAVKTFRSVGDAKNGTADLWTKGNLRVK |
| Ga0138525_10823491 | 3300011064 | Peatlands Soil | VVSAGPVKTFQNVGDVTNDTADLSMKGNLRVKRRDPWHRANAQ |
| Ga0138533_10146411 | 3300011065 | Peatlands Soil | VATAGPVKTFQVVGGITNDAADLWMKGNLRVKRRDPWHWANA |
| Ga0138555_10296472 | 3300011075 | Peatlands Soil | MERSIRGGHAATAGPVKTFREVGGVTNDAADLWMKGNLRVKRR |
| Ga0138574_10960531 | 3300011076 | Peatlands Soil | LIREGHGVSAGPVKTFRSVGDAKNGTADLWTKGNLRVKRRDPWHR |
| Ga0138568_10315461 | 3300011080 | Peatlands Soil | MERSIRGGHAATAGPVKTFREVGGVTNDAADLWMKGNLRVKMRDPWHRANAPLKAA |
| Ga0138562_11157801 | 3300011084 | Peatlands Soil | MERSIRGGHAATAGPVKTFREVGGVTNDAADLWMKGNLRVKRRDPWHWANA |
| Ga0138562_11396031 | 3300011084 | Peatlands Soil | LIREGHGVSTGPVKTFRSVGDAKNGTADLWTKGNLRVK |
| Ga0138564_11911491 | 3300011086 | Peatlands Soil | LNREGHGVSAGPVKTFRNVGDGKNATADLWTKGNLRVKRRDP |
| Ga0127502_106018961 | 3300011333 | Soil | VKTFRNASDVKNITGGLRTKGNLRVQIRDAWHEANALSKAVADVV |
| Ga0151652_121153791 | 3300011340 | Wetland | LNREGHAVSAGPVKTFRNVGDSKNATADLWTKGNLRVKRRDPWHRANAL |
| Ga0151652_121227741 | 3300011340 | Wetland | LHRGGHEVWAGPVKTFRNVGDVKNDTADLWMKGNLRVKRRDPWHRANA |
| Ga0150985_1187722161 | 3300012212 | Avena Fatua Rhizosphere | SREGHEVQARPVKTFRSVGDIEKETADLQRKSNLRVKRRDPENESKA* |
| Ga0154017_187101 | 3300013041 | Corn, Switchgrass And Miscanthus Rhizosphere | VVRARSVKTFRNVGDVKNTTAGLRTKSNLREKRRDPWHRANVPT |
| Ga0153914_10144051 | 3300013078 | Freshwater Wetlands | LHREGHVVSAGLVKTFRNVGDSKNATADLLGKGNLRVKRR |
| Ga0153914_12828021 | 3300013078 | Freshwater Wetlands | LNREGHAASAGPVKTFQKVGDVKNDTADLWTKGNLRVK |
| Ga0181509_13866641 | 3300016701 | Peatland | LIREGHGVSAGPVKTFRNVGDAKNGTADLWTKGNLRVKRRDP |
| Ga0181500_10229721 | 3300016728 | Peatland | VATAGPVKTFQDVGGVTNDTADLWTKGNLRVKRRDPWHR |
| Ga0181505_107208251 | 3300016750 | Peatland | GHGVSAEPVKTFRNVGDAKNGTADLWTKGNLRVKRRVRVQVPSG |
| Ga0187789_11557271 | 3300019199 | Peatland | VVSAGPVKTFRRAGDVKNGTAGLRTKSNLRVKRRDPW |
| Ga0187789_11648971 | 3300019199 | Peatland | VVSAGPVKTFRNASDVKNGTAGLRTKGNLRVKRRD |
| Ga0187789_11812721 | 3300019199 | Peatland | MERSHRGGHAVSAGPVKTFQDVGGIKNGTAELWTKGNLRVKR |
| Ga0187789_11938122 | 3300019199 | Peatland | VVSAGPVKTFRVIGDTKNGTADLWMKGNLRVKRRDPWHSANARPK |
| Ga0187789_12618111 | 3300019199 | Peatland | VRQSERPHREGHAASAGPVKTFQTVGDVTNDTADLWTKGNLRVKRRDPW |
| Ga0179938_10678561 | 3300019210 | Anaerobic Digestor Sludge | GQSEPLDREGHVVSAGPVKTFREVGDVKNNNADLWTKGDLRR |
| Ga0187799_12084871 | 3300019211 | Peatland | VVSAGPVKTFPNVGDAKNGTADLWMKGNLRVKRRDP |
| Ga0179934_12133201 | 3300019226 | Anaerobic Digestor Sludge | SNREGHEASAGPVKTFREVGDVKNDTADLWTKAARLTV |
| Ga0179935_10497151 | 3300019231 | Anaerobic Digestor Sludge | REGHEASAGPVKTFREVGDVKNDTADLWTKGNLRVKKR |
| Ga0180114_11102111 | 3300019232 | Groundwater Sediment | LIRKGYAVSAGPVKTFQNASDVKNGTAGLRTKSNLRVKRRDPW |
| Ga0187793_11068891 | 3300019241 | Peatland | LNREGHGVSAGPVKTFRDVGDIKNGTADLWTKGNLRDKRRDPW |
| Ga0187791_10695811 | 3300019245 | Peatland | VVSAGPVKTFRNVGDGKNATADLWTKGNLRVKRRDPWHRAN |
| Ga0187791_13838062 | 3300019245 | Peatland | VISAGSVKTFQSAGDVKNDTAGLRTKGNLRVKRRDPWRRANAR |
| Ga0172287_11399831 | 3300019246 | Wetland | LHREGHVVSAGLVKTFRNVGDSKNATADLLGKGNLRVKRRDPWHRANAPPRAV |
| Ga0180117_11972211 | 3300019248 | Groundwater Sediment | LHREGHAASAGPVKTFREVGDIKNDTAELWTKSNLRVKRRDPWHRANALSKAA |
| Ga0187790_11507281 | 3300019250 | Peatland | VVSAGPVKTFRNAGDVKNGTAGLRTKGNLRVKRRDP |
| Ga0187790_14106431 | 3300019250 | Peatland | VISAGSVKTSQSAGDVKNDTAGLRTKGNLRVKRRDP |
| Ga0187795_10241911 | 3300019251 | Peatland | VVSAGPVKTFRKVGDATNGTADLWTKGNLRVKRRDPWHRANA |
| Ga0187795_10979901 | 3300019251 | Peatland | VSSAGPVKTFQKVGGVKNDTADLRAKSNLRVQRRDPW |
| Ga0187795_11837552 | 3300019251 | Peatland | VVSAGPVKTFRKVGDAKNGTADLWTKGNLRVKRRDPWHRANA |
| Ga0187795_11894081 | 3300019251 | Peatland | LIREGHEVQARPVITFRSDGDATNGTAGLRTKSNLRVKRRDPWHRANAPSK |
| Ga0187795_14476122 | 3300019251 | Peatland | MERLLRGGHAATAGPVKTFREIGGIKNDTAELWMKGNLRVKRRDPWHRANALLRV |
| Ga0172286_10366831 | 3300019252 | Wetland | VSVRTGEDAVWAGPVKTFRSVGDVKNDTADLWTKGNLRVKR |
| Ga0181506_12850891 | 3300019260 | Peatland | MERLNRGGHATTAGSVKTFRGVGGVTNDIADLWTKGNL |
| Ga0184647_11129791 | 3300019263 | Groundwater Sediment | LNREGHGVQARPVKTFRNVGDVKNSTAGLRTKSNLRVKRRDPWHRANVPLKAGADPE |
| Ga0187796_10181692 | 3300019264 | Peatland | MERSIRGGHAATAGPVKTFRVVGGVTNDAADLWMKGSLRVKRRDPWH |
| Ga0187796_11302702 | 3300019264 | Peatland | LNREGHAVSAGPVKTFRNVGDAKNGTADLWTKGNLRVKRRD |
| Ga0187796_11358082 | 3300019264 | Peatland | VVSAGPVKTFRSVGDAKNGTAELRTKGNLREKRRDPWRRVN |
| Ga0187796_11380721 | 3300019264 | Peatland | VVSAGPVKTFRSVGDAKNGTADLRTKGNLRVKRRDPWRRVN |
| Ga0187796_12365881 | 3300019264 | Peatland | MTRQSERSDREGHAVSAGPVKTSPNVGDAKNGTAALWMKGNLRVKR |
| Ga0187796_14396241 | 3300019264 | Peatland | MERTHRGGHAASAGPVKTFQDVGGIKNDTAELWTKGNLRVKR |
| Ga0187796_14874381 | 3300019264 | Peatland | VVSAGPVKTFRNVGDGKNATADLWTKGNLRDKRRDPWHR |
| Ga0187796_16196221 | 3300019264 | Peatland | VVSAGPVKTFRNVGDAKNGTADLWTKGNLRVKRRDPWHRVNA |
| Ga0187792_11092391 | 3300019265 | Peatland | LHREGHAASAGPVKTFRNVGDVTNDTADLWTKGNLRVKR |
| Ga0187792_11718241 | 3300019265 | Peatland | LHREGHAVSAGPVKTFRNVGDATNGTADLWTKGNLRVKRRDPWHRANAL |
| Ga0187792_13910791 | 3300019265 | Peatland | VVSAGPVKTFRNVGDAKNGTAGLWTKGNLRVKRRD |
| Ga0187792_14724781 | 3300019265 | Peatland | VVSTEPVKTFRNAGDVKNGTAGLRTKGNLRVKRRDPWHMANVPP |
| Ga0187794_10327801 | 3300019273 | Peatland | VVSAGPVKTFRSVGDAKNGTAELRTKGNLREKRRDPWRRVNARP |
| Ga0187794_11001511 | 3300019273 | Peatland | LNREGHGVSAGPVKTFRNVGDGKNATADLWTKGNLRVKRRDPWHRA |
| Ga0187794_11153741 | 3300019273 | Peatland | VVSAGPVKTFRNVGDAKNGTADLWTKGNLRVKRRDP |
| Ga0187794_11658392 | 3300019273 | Peatland | VATAGPVKTFQDVGGITNDAADLWMKGNLRVKRRDPWHRANA |
| Ga0187794_15845901 | 3300019273 | Peatland | MERSRRGGHAATAGPVKTFREVGGIKNNAADLWIKGNLRVKRR |
| Ga0187798_12990881 | 3300019275 | Peatland | LNREGHVVSAGPVKTFRNAGDVTNGTAGLWTKGNLRVKRRDPWHRAN |
| Ga0187798_13004831 | 3300019275 | Peatland | LNREGHVVSAGPVKTFRNVGDVTNDTADLWTKGNLRVK |
| Ga0187800_10055631 | 3300019278 | Peatland | VVSAGPVKTFRSVGDTKNGTAELWTKGNLREKRRDP |
| Ga0187800_10580221 | 3300019278 | Peatland | MERSARGGHAATAGPVKTSRVVGGMASHAADLWTKGNLRVKRRDPWHRANALSQ |
| Ga0187800_14568551 | 3300019278 | Peatland | MERALREGHVATAGPVKTFRGVGGITNDAADLWMKGNLRVKRRDPWHWANALSRA |
| Ga0187797_11976401 | 3300019284 | Peatland | LNREGHVVSAGPVKTFRNAGDVTNGTAGLWTKGNLRVKRRDPWHRANARPK |
| Ga0187797_14715911 | 3300019284 | Peatland | VVSAGPVKTFRSVGDIKNDTAGLRTKGNLREKRRDPLRRVN |
| Ga0180108_10605151 | 3300020066 | Groundwater Sediment | VKIFRKAGDVKNGTAGLRTKSNLRVKRRDPWHRANVPLKA |
| Ga0197907_102360401 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSAGPVKTFRNAGDVKNDTAGLRTKGNLRVKRRDPWHRANVPTQS |
| Ga0206353_114771821 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSAGPVKTFRKAGDVKNDTAGLRTKGNLRVKRRDPWHRANVPTTS |
| Ga0210340_11257491 | 3300021273 | Estuarine | LNREGHGVSAGPVKTFQKVGDAKNGSADLWTKGNLRVKRRDPWHRA |
| Ga0210351_13148211 | 3300021316 | Estuarine | MHREGHGVSAGSVKTFRNVGDVKNGTADLWTKGDLRVKRRDPWFR |
| Ga0213854_13128801 | 3300021855 | Watersheds | LNREGHAVSAGPVKTFRNVGDGKNATADLWTKGNLRVKRRDPWHRAN |
| Ga0213850_11001521 | 3300021856 | Watersheds | LDREGHEAWAGLVKTFRSAGDVTNGTAGLWTKGNLRVKRRDPWPRANALP |
| Ga0213851_13071851 | 3300021860 | Watersheds | LNREGHGVSAGPVKTFRNVGDAKNGTADLWTKGNLRVKRRDPWHRANALPKAA |
| Ga0213851_18478861 | 3300021860 | Watersheds | LDREGHGVSAGPVKTFRNVGDGKNATADLWTKGNLRVKR |
| Ga0213934_10659742 | 3300022156 | Freshwater | VVSAGPVKTFRKVGDVKNDTADLSMKGNLRVKRRDP |
| Ga0079039_11430792 | 3300022185 | Freshwater Wetlands | VVSAGPVKTFRNAGDVKNGTAGLRTKSNLRVKRRDPW |
| Ga0242673_10081741 | 3300022716 | Soil | ERTHREGHAVSAGPVKTFRIAGDIKNDTAGLRTKGNLRV |
| Ga0189898_10365612 | 3300028450 | Peatlands Soil | MERSIRGGHAATAGPVKTFREVGGVTNDAADLWMKGNLRVKRRDPWH |
| Ga0189898_10388691 | 3300028450 | Peatlands Soil | LNREGHAVSAGPVKTFRNVGDGKNATADLWTKGNLRVKRR |
| Ga0311301_126146521 | 3300032160 | Peatlands Soil | LNRGGHGVSAGPVKTFRNVGDGKNATADLWTKGNLRVKRRDPWHRA |
| Ga0314789_028412_409_537 | 3300034480 | Soil | MVSAGPVKTFRNASDVKNNTAGLRTKGNLRVKRRDPWHEANAP |
| Ga0314792_256956_376_510 | 3300034667 | Soil | MVSAEPVKTFRNASDVKNGTAGLRTKSNLRVKRRDPWHRANVPIK |
| Ga0314794_144743_1_138 | 3300034669 | Soil | MVSAEPVKTFRNVSDVKNDTAGLRTKSNLRVKRRDPWHRANVPIKS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |