Basic Information | |
---|---|
Family ID | F073553 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 44 residues |
Representative Sequence | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 70.00 % |
% of genes near scaffold ends (potentially truncated) | 20.83 % |
% of genes from short scaffolds (< 2000 bps) | 80.00 % |
Associated GOLD sequencing projects | 76 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (75.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (18.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.167 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.56% β-sheet: 0.00% Coil/Unstructured: 69.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF10263 | SprT-like | 6.67 |
PF04193 | PQ-loop | 4.17 |
PF09718 | Tape_meas_lam_C | 0.83 |
PF03851 | UvdE | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 75.00 % |
All Organisms | root | All Organisms | 25.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352005|2200032533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella aerogenes | 2559 | Open in IMG/M |
2236876003|none_p041547 | Not Available | 531 | Open in IMG/M |
2236876003|none_p055125 | Not Available | 522 | Open in IMG/M |
3300000268|M3P_10201951 | Not Available | 584 | Open in IMG/M |
3300001266|B570J13884_107663 | Not Available | 657 | Open in IMG/M |
3300001275|B570J13894_1001981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2310 | Open in IMG/M |
3300001282|B570J14230_10055947 | Not Available | 1291 | Open in IMG/M |
3300002351|B570J29582_1012354 | Not Available | 825 | Open in IMG/M |
3300002408|B570J29032_109063082 | Not Available | 582 | Open in IMG/M |
3300003277|JGI25908J49247_10038249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1312 | Open in IMG/M |
3300003277|JGI25908J49247_10134568 | Not Available | 581 | Open in IMG/M |
3300003277|JGI25908J49247_10161978 | Not Available | 519 | Open in IMG/M |
3300003388|JGI25910J50241_10074894 | Not Available | 980 | Open in IMG/M |
3300004112|Ga0065166_10486992 | Not Available | 522 | Open in IMG/M |
3300004763|Ga0007746_1064804 | Not Available | 635 | Open in IMG/M |
3300004765|Ga0007745_1016250 | Not Available | 979 | Open in IMG/M |
3300004767|Ga0007750_1070807 | Not Available | 1122 | Open in IMG/M |
3300004769|Ga0007748_10104834 | Not Available | 828 | Open in IMG/M |
3300004788|Ga0007742_10021686 | Not Available | 817 | Open in IMG/M |
3300004788|Ga0007742_10604295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300005581|Ga0049081_10015866 | All Organisms → cellular organisms → Bacteria | 2845 | Open in IMG/M |
3300005581|Ga0049081_10241990 | Not Available | 635 | Open in IMG/M |
3300005581|Ga0049081_10281015 | Not Available | 577 | Open in IMG/M |
3300005584|Ga0049082_10047534 | Not Available | 1503 | Open in IMG/M |
3300005662|Ga0078894_10172769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1950 | Open in IMG/M |
3300005662|Ga0078894_10820248 | Not Available | 812 | Open in IMG/M |
3300005662|Ga0078894_11056839 | Not Available | 695 | Open in IMG/M |
3300005941|Ga0070743_10133294 | Not Available | 828 | Open in IMG/M |
3300005941|Ga0070743_10175445 | Not Available | 707 | Open in IMG/M |
3300006037|Ga0075465_10016724 | Not Available | 1417 | Open in IMG/M |
3300006484|Ga0070744_10029391 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
3300006484|Ga0070744_10040425 | Not Available | 1373 | Open in IMG/M |
3300006484|Ga0070744_10073343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
3300006484|Ga0070744_10163369 | Not Available | 637 | Open in IMG/M |
3300007553|Ga0102819_1073163 | Not Available | 579 | Open in IMG/M |
3300007555|Ga0102817_1092243 | Not Available | 664 | Open in IMG/M |
3300007555|Ga0102817_1134181 | Not Available | 551 | Open in IMG/M |
3300007559|Ga0102828_1033895 | Not Available | 1153 | Open in IMG/M |
3300007630|Ga0102903_1048296 | Not Available | 1193 | Open in IMG/M |
3300007681|Ga0102824_1113504 | Not Available | 712 | Open in IMG/M |
3300007692|Ga0102823_1194882 | Not Available | 541 | Open in IMG/M |
3300007718|Ga0102852_1058088 | Not Available | 738 | Open in IMG/M |
3300007972|Ga0105745_1168377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300007973|Ga0105746_1123271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
3300007992|Ga0105748_10398390 | Not Available | 594 | Open in IMG/M |
3300008021|Ga0102922_1039923 | Not Available | 1449 | Open in IMG/M |
3300008113|Ga0114346_1047962 | Not Available | 3333 | Open in IMG/M |
3300008119|Ga0114354_1060516 | Not Available | 1594 | Open in IMG/M |
3300008122|Ga0114359_1077267 | Not Available | 1182 | Open in IMG/M |
3300008950|Ga0102891_1039428 | Not Available | 1479 | Open in IMG/M |
3300008996|Ga0102831_1325331 | Not Available | 508 | Open in IMG/M |
3300008999|Ga0102816_1245744 | Not Available | 563 | Open in IMG/M |
3300009026|Ga0102829_1013726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2257 | Open in IMG/M |
3300009026|Ga0102829_1093807 | Not Available | 932 | Open in IMG/M |
3300009163|Ga0114970_10073933 | Not Available | 2150 | Open in IMG/M |
3300009164|Ga0114975_10068221 | Not Available | 2076 | Open in IMG/M |
3300009182|Ga0114959_10028781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3412 | Open in IMG/M |
3300009182|Ga0114959_10032101 | Not Available | 3185 | Open in IMG/M |
3300009182|Ga0114959_10205479 | Not Available | 1018 | Open in IMG/M |
3300009183|Ga0114974_10513292 | Not Available | 671 | Open in IMG/M |
3300009419|Ga0114982_1256657 | Not Available | 545 | Open in IMG/M |
3300009684|Ga0114958_10413296 | Not Available | 652 | Open in IMG/M |
3300011010|Ga0139557_1079623 | Not Available | 545 | Open in IMG/M |
3300011268|Ga0151620_1040656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella aerogenes | 1555 | Open in IMG/M |
3300012345|Ga0157139_1001874 | Not Available | 1014 | Open in IMG/M |
3300012348|Ga0157140_10000127 | Not Available | 10070 | Open in IMG/M |
3300012352|Ga0157138_1083810 | Not Available | 501 | Open in IMG/M |
3300012933|Ga0157211_1000006 | Not Available | 102069 | Open in IMG/M |
3300013295|Ga0170791_13173134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300019201|Ga0180032_1071791 | Not Available | 914 | Open in IMG/M |
3300019784|Ga0181359_1272690 | Not Available | 501 | Open in IMG/M |
3300020141|Ga0211732_1289802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1870 | Open in IMG/M |
3300020159|Ga0211734_10495619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
3300020160|Ga0211733_10801234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella aerogenes | 1594 | Open in IMG/M |
3300020160|Ga0211733_10801560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300020161|Ga0211726_10468036 | Not Available | 661 | Open in IMG/M |
3300020562|Ga0208597_1012538 | Not Available | 2157 | Open in IMG/M |
3300020562|Ga0208597_1030578 | Not Available | 1139 | Open in IMG/M |
3300020572|Ga0207909_1009678 | Not Available | 1948 | Open in IMG/M |
3300020572|Ga0207909_1019771 | Not Available | 1222 | Open in IMG/M |
3300021961|Ga0222714_10079124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2149 | Open in IMG/M |
3300021961|Ga0222714_10406069 | Not Available | 718 | Open in IMG/M |
3300021963|Ga0222712_10099750 | Not Available | 2035 | Open in IMG/M |
3300021963|Ga0222712_10548719 | Not Available | 675 | Open in IMG/M |
3300022407|Ga0181351_1048305 | Not Available | 1783 | Open in IMG/M |
3300022746|Ga0228701_1010646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3513 | Open in IMG/M |
3300023184|Ga0214919_10017330 | Not Available | 8327 | Open in IMG/M |
3300024343|Ga0244777_10149114 | Not Available | 1510 | Open in IMG/M |
3300024343|Ga0244777_10421125 | Not Available | 829 | Open in IMG/M |
3300024346|Ga0244775_10000963 | Not Available | 34725 | Open in IMG/M |
3300024346|Ga0244775_10205303 | Not Available | 1652 | Open in IMG/M |
3300024346|Ga0244775_10309462 | Not Available | 1308 | Open in IMG/M |
3300024346|Ga0244775_10332167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
3300024346|Ga0244775_11029865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300025451|Ga0208426_1002179 | Not Available | 2744 | Open in IMG/M |
3300025896|Ga0208916_10409744 | Not Available | 591 | Open in IMG/M |
3300027193|Ga0208800_1013964 | Not Available | 1037 | Open in IMG/M |
3300027193|Ga0208800_1038682 | Not Available | 644 | Open in IMG/M |
3300027193|Ga0208800_1047170 | Not Available | 585 | Open in IMG/M |
3300027193|Ga0208800_1054196 | Not Available | 545 | Open in IMG/M |
3300027261|Ga0208933_1010957 | Not Available | 1452 | Open in IMG/M |
3300027586|Ga0208966_1064655 | Not Available | 1029 | Open in IMG/M |
3300027608|Ga0208974_1001615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8803 | Open in IMG/M |
3300027631|Ga0208133_1160130 | Not Available | 518 | Open in IMG/M |
3300027708|Ga0209188_1021211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3316 | Open in IMG/M |
3300027708|Ga0209188_1041472 | Not Available | 2106 | Open in IMG/M |
3300027708|Ga0209188_1051388 | Not Available | 1830 | Open in IMG/M |
3300027732|Ga0209442_1253598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300027764|Ga0209134_10280356 | Not Available | 568 | Open in IMG/M |
3300027785|Ga0209246_10192365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300027785|Ga0209246_10218726 | Not Available | 742 | Open in IMG/M |
3300027798|Ga0209353_10221023 | Not Available | 823 | Open in IMG/M |
3300027798|Ga0209353_10444096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300027969|Ga0209191_1045730 | Not Available | 2024 | Open in IMG/M |
3300031952|Ga0315294_10386204 | Not Available | 1315 | Open in IMG/M |
3300032092|Ga0315905_11090940 | Not Available | 662 | Open in IMG/M |
3300034022|Ga0335005_0033874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3510 | Open in IMG/M |
3300034066|Ga0335019_0478603 | Not Available | 747 | Open in IMG/M |
3300034107|Ga0335037_0004666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7226 | Open in IMG/M |
3300034357|Ga0335064_0275386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1072 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.33% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 18.33% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 10.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.17% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.50% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.17% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.33% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.33% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.50% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.50% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.50% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 1.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.83% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.83% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.83% |
Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.83% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.83% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.83% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.83% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
2236876003 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p8-ETM-15m | Environmental | Open in IMG/M |
3300000268 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 | Environmental | Open in IMG/M |
3300001266 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion | Environmental | Open in IMG/M |
3300001275 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002351 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004765 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004767 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004788 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012345 | Freshwater microbial communities from Burnt River, Ontario, Canada - S22 | Environmental | Open in IMG/M |
3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012933 | Freshwater microbial communities from Tributary to Mariposa, Ontario, Canada - S7 | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022746 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027261 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2200241796 | 2199352005 | Freshwater | MTEQEFYAQIQEDYYNEFAGAELSEIFICTNDHDEFFEFDDVPF |
none_0415471 | 2236876003 | Marine Estuarine | MTEQEFYAQIQEDYYREFAGSELSQIFIVTDAHDEFF |
none_0551251 | 2236876003 | Marine Estuarine | MTEQEFYAQIQEDYYREFAGSELSQIFIVTDAHDEFFEFDDVPF |
M3P_102019512 | 3300000268 | Lotic | MTEHEFYAQIQEDYFREFAGVELSEVFVVTNVHDEFFEFDDVPF* |
B570J13884_1076632 | 3300001266 | Freshwater | KGTEMTEHEFYAQIQEDYFREFAGAELSEVFVCTNTHDEFFEFDDVPF* |
B570J13894_10019813 | 3300001275 | Freshwater | MTEQEFYAQIQEDYYNEFAGAELSEIFICTNDHDEFFEFDDVPF* |
B570J14230_100559472 | 3300001282 | Freshwater | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNTHDEFFEFDDVPF* |
B570J29582_10123542 | 3300002351 | Freshwater | IIIHTDKKGTEMTEHEFYAQIQEDYFREFAGAELSEVFVCTNTHDEFFEFDDVPF* |
B570J29032_1090630821 | 3300002408 | Freshwater | EHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPY* |
JGI25908J49247_100382492 | 3300003277 | Freshwater Lake | MTDHEFYRQIQEDYFREFAGTELSEIFVDTNDHDEFFEFDDVPF* |
JGI25908J49247_101345681 | 3300003277 | Freshwater Lake | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPY* |
JGI25908J49247_101619781 | 3300003277 | Freshwater Lake | MTDHEFYAQIQEDYFKEFVDAELSQIFVCINYHNEFFEFDDVPY* |
JGI25910J50241_100748941 | 3300003388 | Freshwater Lake | MTEHEFYAQIQEDYFREFAGAELSEVFVCTDTHDEFFEFDDVPF* |
Ga0065166_104869921 | 3300004112 | Freshwater Lake | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDV |
Ga0007746_10648041 | 3300004763 | Freshwater Lake | HEFYAQIQEDYFKEFVDAELSQIFVCINYHNEFFEFDDVPY* |
Ga0007745_10162501 | 3300004765 | Freshwater Lake | KDPDMTDHEFYRQIQEDYFREFAGTELSEIFVDTNDHDEFFEFDDVPF* |
Ga0007750_10708072 | 3300004767 | Freshwater Lake | SEMTEHEFYAQIQEDYFREFAGAELSEVFVCTDTHDEFFEFDDVPF* |
Ga0007748_101048341 | 3300004769 | Freshwater Lake | PDMTDHEFYRQIQEDYFREFAGTELSEIFVDTNDHDEFFEFDDVPF* |
Ga0007742_100216862 | 3300004788 | Freshwater Lake | TDHEFYRQIQEDYFREFAGTELSEIFVDTNDHDEFFEFDDVPF* |
Ga0007742_106042951 | 3300004788 | Freshwater Lake | EFYRQIQEDWYNEFAGAELSEIFVCTNIHAENYEFDDVPF* |
Ga0049081_100158664 | 3300005581 | Freshwater Lentic | MTEQEFYAQIQEDYFREFAGAELSEIFICTNDHDEFFEFDDVPF* |
Ga0049081_102419902 | 3300005581 | Freshwater Lentic | MTDHEFYAQIQEDYFQEFVDAELSQIFVCVNYHDEFFEFDDVPF* |
Ga0049081_102810152 | 3300005581 | Freshwater Lentic | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF* |
Ga0049082_100475343 | 3300005584 | Freshwater Lentic | MTEHEFYAQIQEDYFREFAGVELSEVFVDTNTHPEFFEFDDVPF* |
Ga0078894_101727692 | 3300005662 | Freshwater Lake | MTDHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF* |
Ga0078894_108202482 | 3300005662 | Freshwater Lake | MTEQEFYAQIQEDYYQEFAGSELSQIFIVTDVHDEFFEFDDVPF* |
Ga0078894_110568391 | 3300005662 | Freshwater Lake | MTEQEFYAQIQEDYYREFAGTELSEIFICTNDHDEFFEFDDVPF* |
Ga0070743_101332941 | 3300005941 | Estuarine | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFKFDDVPF* |
Ga0070743_101754452 | 3300005941 | Estuarine | TEHEFYAQIQEDYFNEFAGSELSEIFIVTNVHDEFFEFDDVPF* |
Ga0075465_100167243 | 3300006037 | Aqueous | MADKEFYAQLQYEWFYEFKEQELSEIRSATDVHIEFFEFDDVPF* |
Ga0070744_100293914 | 3300006484 | Estuarine | MTEQEFYAQIQEDYFQEFVGAELSQIFVCVNYHNEFFEFDDVPY* |
Ga0070744_100404253 | 3300006484 | Estuarine | MTEQEFYAQIQEDYYQEFAGSELSEIFIVTNVHDEFFEFDDVPF* |
Ga0070744_100733433 | 3300006484 | Estuarine | MTETEFYRQIQEDWYHEFAGAELSEIFVCTNAHDEIFEFDDVPF* |
Ga0070744_101633692 | 3300006484 | Estuarine | MTEHEFYAQIQEDYFREFAGAELSEIFVDTNTHPEFFEFDDVPF* |
Ga0102819_10731631 | 3300007553 | Estuarine | EHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFKFDDVPF* |
Ga0102817_10922431 | 3300007555 | Estuarine | MTEHEFYAQIQEDYFREFAGVELSEVFVDTNTHPEFFEFDDVPY* |
Ga0102817_11341812 | 3300007555 | Estuarine | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNDHPEFFEFDDVPY* |
Ga0102828_10338951 | 3300007559 | Estuarine | LFYEIKKGSEMTEQEFYAQIQEDYYQEFAGSELSEIFIVTNVHDEFFEFDDVPF* |
Ga0102903_10482962 | 3300007630 | Estuarine | EFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF* |
Ga0102824_11135042 | 3300007681 | Estuarine | KGTEMTDHEFYRQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF* |
Ga0102823_11948822 | 3300007692 | Estuarine | MIEHEFYAQIQEDYFNEFAGSELSEIFIVTNVHDEFFEFDDVPF* |
Ga0102852_10580882 | 3300007718 | Estuarine | MTEHEFYAQNQEDYFREFAGVELSEVFVDTNTHPEFFEFDDVPY* |
Ga0105745_11683771 | 3300007972 | Estuary Water | YAQIQEDYYREFAGTELSEIFVCTNTHDEFFEFDDVPF* |
Ga0105746_11232712 | 3300007973 | Estuary Water | MTEQEFYAQIQEDYFREFAGSELSEIFIVTDVHDEFFEFDDVPF* |
Ga0105748_103983902 | 3300007992 | Estuary Water | MTEHEFYAQIQEDYYREFAGTELSEIFVCTNTHDEFFEFDDVPF* |
Ga0102922_10399231 | 3300008021 | Estuarine | MTDHEFYAQIQEDYFREFAGAELLEVFVCTNDHDEFFEFDDVPF* |
Ga0114346_10479622 | 3300008113 | Freshwater, Plankton | MTEQEFYAQIQEDYFREFAGAELSEVFVCTDTHDEFFEFDDVPF* |
Ga0114354_10605161 | 3300008119 | Freshwater, Plankton | MTEQEFYAQIQEDYYREFAGTELSEIFIVTDVHDEFFEFDDVPF* |
Ga0114359_10772671 | 3300008122 | Freshwater, Plankton | IQEDYFREFAGAELSEVFVCTDTHDEFFEFDDVPF* |
Ga0102891_10394281 | 3300008950 | Estuarine | MTEHEFYAQIQEDYFNEFAGSELSEIFIVTNVHDEFFEFDDVPF* |
Ga0102831_13253312 | 3300008996 | Estuarine | DRKGSEMTEHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFKFDDVPF* |
Ga0102816_12457442 | 3300008999 | Estuarine | LFYEIKKGSEMTEQEFYAQIQEDYFQEFVGAELSQIFVCVNYHNEFFEFDDVPY* |
Ga0102829_10137266 | 3300009026 | Estuarine | MTEHEFYAQIQEDYFREFAGSELSEIFIVTNVHDEFFEFDDVPF* |
Ga0102829_10938072 | 3300009026 | Estuarine | MTEQEFYAQIQEDYFREFAGTELSEIFICTDIHDEFFEFDDVPF* |
Ga0114970_100739331 | 3300009163 | Freshwater Lake | MTDSEFYRQIQEDWFHEFAGAELSDIFVCTNTHIEFFDLEDVPY* |
Ga0114975_100682211 | 3300009164 | Freshwater Lake | MTDNEFYAQIQEDWFHEFAGAELSDIFVCTNPHIEFFDLEDVPF* |
Ga0114959_100287811 | 3300009182 | Freshwater Lake | MTDSEFFAQIQEDWFHEFAGAKLSDIFVCTDAHIENFEFDDVPL* |
Ga0114959_100321012 | 3300009182 | Freshwater Lake | MTDSEFFRQIQEDWFHEFAGAELSDIFVCTDTHIENFEFDDVPL* |
Ga0114959_102054791 | 3300009182 | Freshwater Lake | MTDHEFYAQIQEDWFQEFAGAELSEIFIVTDVHPEFFEFDDVPF* |
Ga0114974_105132922 | 3300009183 | Freshwater Lake | LFYQIKKGSEMTEQEFYAQIQEDYYQEFAGSELSEIFIVTDVHDEFFEFDDVPF* |
Ga0114982_12566572 | 3300009419 | Deep Subsurface | YAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF* |
Ga0114958_104132962 | 3300009684 | Freshwater Lake | MTDSEFFRQIQEDWFHEFAGAELSDIFVCTNVHIENFEFDDVPL* |
Ga0139557_10796231 | 3300011010 | Freshwater | MTEQEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF* |
Ga0151620_10406562 | 3300011268 | Freshwater | MTEQEFYAQIQEDYFREFAGTELSEVFVCINTHDEFFEFDDVPF* |
Ga0157139_10018742 | 3300012345 | Freshwater | MTEHEFYAQIQEDYFREFAGTELSEVFVCTNDHDEFFEFDDVPF* |
Ga0157140_1000012717 | 3300012348 | Freshwater | MTDSEFFTQIQDDWFHEFAGAERHEIFVCTHTHEENFEFDDVPF* |
Ga0157138_10838101 | 3300012352 | Freshwater | MTDTEFFAQIQDDWFREFAGAELSEIFVGSDTHPEIFEFDDVPF* |
Ga0157211_100000671 | 3300012933 | Freshwater | MTDNEFFAQIQDDWFHEFVGAQRHEIFVCTNPQVENFEFDDIPF* |
Ga0170791_131731341 | 3300013295 | Freshwater | EMTDHEFYAQIQEDWFQEFAGAELSEIFIVTDVHPEFFEFDDVPF* |
Ga0180032_10717911 | 3300019201 | Estuarine | EMTDHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF |
Ga0181359_12726901 | 3300019784 | Freshwater Lake | EFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPY |
Ga0211732_12898022 | 3300020141 | Freshwater | MTEHEFYAQIQEDYFREFAGAELSEVFVVTDVHDEFFEFDDVPF |
Ga0211734_104956191 | 3300020159 | Freshwater | MTEHEFYAQIQEDYFQEFAGSELSEIFIVTDVHDEFFEFDDVPF |
Ga0211733_108012342 | 3300020160 | Freshwater | MTEHEFYAQIQEDYFREFAGVELSEVFVVTDVHDEFFEFDDVPF |
Ga0211733_108015602 | 3300020160 | Freshwater | MTEHEFYAQIQEDYFREFAGSELSQIFIVTDVHDEFFEFDDVPF |
Ga0211726_104680361 | 3300020161 | Freshwater | MTEHEFYAQIQEDYLREFAGSELSQIFIVTDVHDEFFEFDDVPF |
Ga0208597_10125381 | 3300020562 | Freshwater | IHTDKKGTEMTEHEFYAQIQEDYFREFAGAELSEVFVCTNTHDEFFEFDDVPF |
Ga0208597_10305781 | 3300020562 | Freshwater | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPY |
Ga0207909_10096781 | 3300020572 | Freshwater | MTEHEFYAQIQEDYYREFAGTELSEIFVCTNTHDEFFEFDDVPF |
Ga0207909_10197712 | 3300020572 | Freshwater | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNTHDEFFEFDDVPF |
Ga0222714_100791242 | 3300021961 | Estuarine Water | MTEQEFYAQIQEDYFREFAGTELSEVFVCINTHDEFFEFDDVPF |
Ga0222714_104060691 | 3300021961 | Estuarine Water | MTEQEFYAQIQEDYYQEFAGSELSQIFIVTDVHDEFFEFDDVPF |
Ga0222712_100997502 | 3300021963 | Estuarine Water | MTEQEFYAQIQEDWFQEFAGAELSEIFVDTSTHPEFFEFDDIPF |
Ga0222712_105487192 | 3300021963 | Estuarine Water | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF |
Ga0181351_10483051 | 3300022407 | Freshwater Lake | MTEHEFYAQIQEDYFREFAGAELSEVFVCTDTHDEFFEFDDVPF |
Ga0228701_10106464 | 3300022746 | Freshwater | MTDSEFFQQIQEDWFNEFACDERDKIFIATIVQDENFEFDDVPL |
Ga0214919_100173303 | 3300023184 | Freshwater | MTEHEFYAQIQEDYYTEFAGAELSEIFVDTNTHPEFFEFDDIPF |
Ga0244777_101491142 | 3300024343 | Estuarine | MTDHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF |
Ga0244777_104211251 | 3300024343 | Estuarine | MTEHEFYAQIQEDYFREFAGVELSEVFVDTNTHPEFFEFDDVPY |
Ga0244775_100009632 | 3300024346 | Estuarine | MTEQEFYAQIQEDYFQEFVGAELSQIFVCVNYHNEFFEFDDVPY |
Ga0244775_102053033 | 3300024346 | Estuarine | MTEHEFYAQIQEDYFNEFAGSELSEIFIVTNVHDEFFEFDDVPF |
Ga0244775_103094622 | 3300024346 | Estuarine | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNDHPEFFEFDDVPY |
Ga0244775_103321673 | 3300024346 | Estuarine | MTEHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFKFDDVPF |
Ga0244775_110298652 | 3300024346 | Estuarine | MTETEFYRQIQEDWYHEFAGAELSEIFVCTNAHDEIFEFDDVPF |
Ga0208426_10021794 | 3300025451 | Aqueous | MADKEFYAQLQYEWFYEFKEQELSEIRSATDVHIEFFEFDDVPF |
Ga0208916_104097442 | 3300025896 | Aqueous | MTDNEFFRQIQEDWYNEFAGAELKDIFVGTDTHREIFEFDDVPF |
Ga0208800_10139641 | 3300027193 | Estuarine | MTEQEFYAQIQEDYYQEFAGSELSEIFIVTNVHDEFFEFDDVPF |
Ga0208800_10386821 | 3300027193 | Estuarine | MTDHEFYRQIQEDYFREFAGTELSEIFVDTNDHDEFFEFDDVPF |
Ga0208800_10471701 | 3300027193 | Estuarine | KGTEMTDHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF |
Ga0208800_10541961 | 3300027193 | Estuarine | MTEQEFYAQIQEDYFREFAGTELSEIFICTDIHDEFFEFDDVPF |
Ga0208933_10109571 | 3300027261 | Estuarine | KKGTEMTDHEFYAQIQEDYFREFAGAELSEVFVCTNDHDEFFEFDDVPF |
Ga0208966_10646551 | 3300027586 | Freshwater Lentic | MTEHEFYAQIQEDYFREFAGVELSEVFVDTNTHPEFFEFDDVPF |
Ga0208974_10016159 | 3300027608 | Freshwater Lentic | MTDHEFYAQIQEDYFQEFVDAELSQIFVCVNYHDEFFEFDDVPY |
Ga0208133_11601302 | 3300027631 | Estuarine | MTEHEFYAQIQEDYFREFAGAELSEIFVDTNTHPEFFEFDDVPF |
Ga0209188_10212111 | 3300027708 | Freshwater Lake | MTEHEFYAQIQEDYYQEFAGSELSEIFVLVNHHDEFFEFDDVPF |
Ga0209188_10414721 | 3300027708 | Freshwater Lake | MTDSEFFRQIQEDWFHEFAGAELSDIFVCTDTHIENFEFDDVPL |
Ga0209188_10513885 | 3300027708 | Freshwater Lake | MTDSEFFAQIQEDWFHEFAGAKLSDIFVCTDAHIENFEFDDVPL |
Ga0209442_12535982 | 3300027732 | Freshwater Lake | MMTDTEFYRQIQEDWYNEFAGAELKDIFVATSAHREIFEFDDVPF |
Ga0209134_102803561 | 3300027764 | Freshwater Lake | MTEQEFYAQIQEDYYREFAGTELSEIFICTNDHDEFFEFDDVPF |
Ga0209246_101923651 | 3300027785 | Freshwater Lake | MTDTEFFRQIQEDWYNEFAGAELKDIFVATSAHREIFEFDDVPF |
Ga0209246_102187262 | 3300027785 | Freshwater Lake | MMTDTEFYRQIQEDWYHEFAGAELSEIFVCTNAHAENFEFDDVPF |
Ga0209353_102210231 | 3300027798 | Freshwater Lake | MTDHEFYAQIQEDYYTEFVDAELSQIFVCVNYHDEFFEFDDVPH |
Ga0209353_104440961 | 3300027798 | Freshwater Lake | EFYRQIQEDWYHEFAGAELSEIFVCTNAHDEIFEFDDVPF |
Ga0209191_10457303 | 3300027969 | Freshwater Lake | MTDNEFYAQIQEDWFHEFAGAELSDIFVCTNPHIEFFDLEDVPF |
Ga0315294_103862041 | 3300031952 | Sediment | MTDSEFYAQIQDDWFHEFAGAELSDIFVCTNPHIEFFDLEDVPF |
Ga0315905_110909401 | 3300032092 | Freshwater | MTEHEFYAQIQEDYFREFAGTELSEIFVDTNDHDEFFEFDDVPF |
Ga0335005_0033874_175_309 | 3300034022 | Freshwater | MTDTEFYRQIQEDWYHEFAGAELSQIFVCTDAHDEIFEFDDVPF |
Ga0335019_0478603_197_331 | 3300034066 | Freshwater | MTEQEFYAQIQEDYLREFAGSELSQIFIVTDVHDEFFEFDDVPF |
Ga0335037_0004666_5239_5373 | 3300034107 | Freshwater | MTEQEFYAQIQEDYFREFAGTELSEIFICTNTHDEFFEFDDVPF |
Ga0335064_0275386_163_297 | 3300034357 | Freshwater | MTDTEFYRQIQEDWYHEFAGAELSEIFVCTNAHDEIFEFDDVPF |
⦗Top⦘ |