NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073509

Metagenome / Metatranscriptome Family F073509

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073509
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 37 residues
Representative Sequence MLAQEAPLIDQGAVQFILFGVTVIVIFIALWITIAK
Number of Associated Samples 102
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 85.83 %
% of genes near scaffold ends (potentially truncated) 19.17 %
% of genes from short scaffolds (< 2000 bps) 70.83 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(28.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(30.833 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 43.75%    β-sheet: 0.00%    Coil/Unstructured: 56.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF02629CoA_binding 25.00
PF06971Put_DNA-bind_N 19.17
PF13442Cytochrome_CBB3 5.83
PF00034Cytochrom_C 3.33
PF05768Glrx-like 3.33
PF08281Sigma70_r4_2 2.50
PF04542Sigma70_r2 2.50
PF03824NicO 1.67
PF10099RskA 1.67
PF14224DUF4331 0.83
PF04545Sigma70_r4 0.83
PF02790COX2_TM 0.83
PF00202Aminotran_3 0.83
PF01261AP_endonuc_2 0.83
PF12270Cyt_c_ox_IV 0.83
PF08448PAS_4 0.83
PF00355Rieske 0.83
PF01887SAM_HAT_N 0.83
PF00115COX1 0.83
PF15698Phosphatase 0.83
PF01144CoA_trans 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG0695GlutaredoxinPosttranslational modification, protein turnover, chaperones [O] 3.33
COG3118Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC familyPosttranslational modification, protein turnover, chaperones [O] 3.33
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 2.50
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 2.50
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 2.50
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 2.50
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 0.83
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.83
COG1912Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming)Defense mechanisms [V] 0.83
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.83
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.67 %
UnclassifiedrootN/A18.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090015|GPICI_9098117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1357Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig540287All Organisms → cellular organisms → Bacteria1910Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0682502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1403Open in IMG/M
3300002120|C687J26616_10003051All Organisms → cellular organisms → Bacteria6995Open in IMG/M
3300002120|C687J26616_10174189All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300002149|C687J26657_10048469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300005180|Ga0066685_10998247All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005553|Ga0066695_10017487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3938Open in IMG/M
3300005558|Ga0066698_10108034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1843Open in IMG/M
3300005564|Ga0070664_100007465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8829Open in IMG/M
3300005577|Ga0068857_101324331All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300005617|Ga0068859_102243600Not Available602Open in IMG/M
3300005713|Ga0066905_100055201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2459Open in IMG/M
3300005937|Ga0081455_10002154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia23493Open in IMG/M
3300005937|Ga0081455_10008763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10472Open in IMG/M
3300005937|Ga0081455_10139940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1881Open in IMG/M
3300006049|Ga0075417_10465461Not Available632Open in IMG/M
3300006581|Ga0074048_10066308Not Available684Open in IMG/M
3300006844|Ga0075428_100087919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3390Open in IMG/M
3300006865|Ga0073934_10007952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria14415Open in IMG/M
3300006865|Ga0073934_10010389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11581Open in IMG/M
3300009012|Ga0066710_100323452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2269Open in IMG/M
3300009012|Ga0066710_100549411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1747Open in IMG/M
3300009012|Ga0066710_101781396Not Available931Open in IMG/M
3300009012|Ga0066710_104686060Not Available511Open in IMG/M
3300009081|Ga0105098_10275333Not Available801Open in IMG/M
3300009094|Ga0111539_11839079All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300009137|Ga0066709_103290993Not Available588Open in IMG/M
3300009553|Ga0105249_10017690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6331Open in IMG/M
3300009678|Ga0105252_10263719Not Available758Open in IMG/M
3300009805|Ga0105079_1035583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300009809|Ga0105089_1067546All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300009811|Ga0105084_1014109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1266Open in IMG/M
3300009818|Ga0105072_1082595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300009822|Ga0105066_1139187All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300009840|Ga0126313_10187030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1584Open in IMG/M
3300010029|Ga0105074_1024732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1006Open in IMG/M
3300010042|Ga0126314_10004156All Organisms → cellular organisms → Bacteria7519Open in IMG/M
3300010336|Ga0134071_10426222Not Available678Open in IMG/M
3300010362|Ga0126377_10005024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9717Open in IMG/M
3300010373|Ga0134128_13148501Not Available507Open in IMG/M
3300010391|Ga0136847_10805057All Organisms → cellular organisms → Bacteria25392Open in IMG/M
3300010905|Ga0138112_1001566All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300012041|Ga0137430_1221086Not Available542Open in IMG/M
3300012204|Ga0137374_10365028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1159Open in IMG/M
3300012204|Ga0137374_10450924Not Available1010Open in IMG/M
3300012206|Ga0137380_11225661All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300012355|Ga0137369_10287431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1226Open in IMG/M
3300012356|Ga0137371_10093520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2338Open in IMG/M
3300012360|Ga0137375_10659392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria861Open in IMG/M
3300012360|Ga0137375_11194780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300012896|Ga0157303_10119974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300012908|Ga0157286_10101749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria845Open in IMG/M
3300012941|Ga0162652_100011269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1114Open in IMG/M
3300014308|Ga0075354_1102763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300014318|Ga0075351_1058708All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300014320|Ga0075342_1019995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1516Open in IMG/M
3300014324|Ga0075352_1007692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1995Open in IMG/M
3300014965|Ga0120193_10024079All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300015371|Ga0132258_13240655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1122Open in IMG/M
3300015372|Ga0132256_100070416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3312Open in IMG/M
3300017997|Ga0184610_1001148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5970Open in IMG/M
3300017997|Ga0184610_1141479All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300017997|Ga0184610_1313850Not Available515Open in IMG/M
3300018028|Ga0184608_10344471Not Available655Open in IMG/M
3300018051|Ga0184620_10284958Not Available556Open in IMG/M
3300018056|Ga0184623_10182806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria966Open in IMG/M
3300018059|Ga0184615_10341846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300018074|Ga0184640_10042288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1856Open in IMG/M
3300018077|Ga0184633_10080129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1679Open in IMG/M
3300018078|Ga0184612_10008096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5286Open in IMG/M
3300018082|Ga0184639_10106719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1481Open in IMG/M
3300018431|Ga0066655_10382311All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300018476|Ga0190274_10041872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3239Open in IMG/M
3300018476|Ga0190274_10310949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1473Open in IMG/M
3300019458|Ga0187892_10070071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2244Open in IMG/M
3300020005|Ga0193697_1024929All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300021078|Ga0210381_10396739Not Available509Open in IMG/M
3300021412|Ga0193736_1004396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1678Open in IMG/M
3300025146|Ga0209322_10031251All Organisms → cellular organisms → Bacteria2634Open in IMG/M
3300025146|Ga0209322_10072960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1616Open in IMG/M
3300025167|Ga0209642_10491369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300025310|Ga0209172_10003457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria24056Open in IMG/M
3300025310|Ga0209172_10019250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5014Open in IMG/M
3300025313|Ga0209431_10489833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria937Open in IMG/M
3300025326|Ga0209342_10066875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3372Open in IMG/M
3300025910|Ga0207684_10393915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1191Open in IMG/M
3300025922|Ga0207646_10133869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2232Open in IMG/M
3300025925|Ga0207650_10283178All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300026102|Ga0208914_1032188All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300026307|Ga0209469_1047008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1374Open in IMG/M
3300026343|Ga0209159_1043908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2254Open in IMG/M
3300026536|Ga0209058_1102512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1445Open in IMG/M
3300027451|Ga0207599_100067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2173Open in IMG/M
3300027561|Ga0209887_1017533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1763Open in IMG/M
3300027647|Ga0214468_1002604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5649Open in IMG/M
3300027657|Ga0256865_1114936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300027873|Ga0209814_10261704Not Available751Open in IMG/M
3300027952|Ga0209889_1009304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2454Open in IMG/M
3300027961|Ga0209853_1006682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3576Open in IMG/M
3300028380|Ga0268265_11207338Not Available754Open in IMG/M
3300028592|Ga0247822_11543609Not Available562Open in IMG/M
3300028807|Ga0307305_10204359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium908Open in IMG/M
3300028824|Ga0307310_10212857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria917Open in IMG/M
3300028828|Ga0307312_10084926All Organisms → cellular organisms → Bacteria1941Open in IMG/M
3300028878|Ga0307278_10401968Not Available602Open in IMG/M
3300030006|Ga0299907_10000117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria30221Open in IMG/M
3300030006|Ga0299907_10003544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10015Open in IMG/M
3300030006|Ga0299907_10276906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1373Open in IMG/M
3300031421|Ga0308194_10048383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1078Open in IMG/M
3300031949|Ga0214473_10111594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3193Open in IMG/M
3300031949|Ga0214473_10116787All Organisms → cellular organisms → Bacteria3116Open in IMG/M
3300031949|Ga0214473_10756265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1053Open in IMG/M
3300032013|Ga0310906_10156332Not Available1336Open in IMG/M
3300032205|Ga0307472_102289287All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300033004|Ga0335084_10241485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1873Open in IMG/M
3300033417|Ga0214471_10062337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3052Open in IMG/M
3300033550|Ga0247829_11321831All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300033814|Ga0364930_0054010Not Available1366Open in IMG/M
3300034354|Ga0364943_0159980All Organisms → cellular organisms → Bacteria815Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment9.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.50%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand7.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil4.17%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands4.17%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment3.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.50%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.50%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.67%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.67%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.83%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.83%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.83%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002120Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2EnvironmentalOpen in IMG/M
3300002149Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009805Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10EnvironmentalOpen in IMG/M
3300009809Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010905Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300014308Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1EnvironmentalOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021412Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1EnvironmentalOpen in IMG/M
3300025146Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026102Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027451Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G09K3-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027561Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027647Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeqEnvironmentalOpen in IMG/M
3300027657Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeqEnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027952Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICI_018860502088090015SoilMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK
KansclcFeb2_033090402124908045SoilMLAQEAPLIDQGAVQFILFGVTVIVIFIALWITIAK
ICChiseqgaiiDRAFT_068250223300000033SoilMLAQETRPLLDEGVVQFILFGVMMIGIFIVLWITIAK*
C687J26616_1000305183300002120SoilMLAQEAVRLLDQGSVQFIVFSVMVVITFIVLWIAIAK*
C687J26616_1017418923300002120SoilVLGQIEMPLIEQGSVQFILFGVMMLVIFIGLWITISK*
C687J26657_1004846923300002149SoilMLAQEAARLIDQGSVQFILFGVMVLVTFIVLWYTIAK*
Ga0066685_1099824713300005180SoilVLGLIAQESARPLLDQGAVQFILFGVMMIVIFIVMWLTVDK*
Ga0066695_1001748763300005553SoilMLAQEARPLLDQGVVQFILFGVMMIGIFIALWITIAK*
Ga0066698_1010803423300005558SoilMLAQEARPLLDQGVVQFILFGVMMIGIFIVLWITIAK*
Ga0070664_10000746533300005564Corn RhizosphereMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK*
Ga0068857_10132433123300005577Corn RhizosphereVLAQESARLIDQGAVQFILFGVMLIIVFITLWFTISK*
Ga0068859_10224360023300005617Switchgrass RhizosphereVLAQESARLIDQGAVQFILYGVMLIIVFITLWFTISK*
Ga0066905_10005520143300005713Tropical Forest SoilMLAQETQLIDQGAVQFILFGITVIVIFIALWITIAK*
Ga0081455_10002154263300005937Tabebuia Heterophylla RhizosphereMMLAQEAPLIDQGAVQFILFGITVIVIFIALWITIAK*
Ga0081455_1000876393300005937Tabebuia Heterophylla RhizosphereMMLAQEAPLIDQGAVQFILFGITVIIIFIALWITIAK*
Ga0081455_1013994023300005937Tabebuia Heterophylla RhizosphereMMLAQEVPLIDQGAVQFILFGITVIIIFIALWITIAK*
Ga0075417_1046546123300006049Populus RhizosphereAMMLAQEAPLIDQGAVQFILFGITVIVIFIALWITIAK*
Ga0074048_1006630823300006581SoilLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK*
Ga0075428_10008791933300006844Populus RhizosphereMLAQEAVKLLDQGSVQFILFGIMTIVTFVILWITIAK*
Ga0073934_10007952183300006865Hot Spring SedimentMLAQEAARLLDQGSVQFILFGVMVLVVFVALWFTIAK*
Ga0073934_1001038923300006865Hot Spring SedimentMLAQEAARLIDQGSVQFILFGIMVVVVFIALWFTIAK*
Ga0066710_10032345233300009012Grasslands SoilVLGLIAQESTRPLLDQGAVQFILFGVMMIVIFIVMWLTVDK
Ga0066710_10054941123300009012Grasslands SoilMIALETPLIDQGVVQFVLFGVMVLVILFALWITIAK
Ga0066710_10178139623300009012Grasslands SoilMLAMVAAHLIDSGSVQFILFGVVVIAIFVALLITIAK
Ga0066710_10468606023300009012Grasslands SoilMFATIASETGPLLDQGIVQFILFGVMMIAIFVVLWITIAK
Ga0105098_1027533323300009081Freshwater SedimentMLAQETRPLLDEGAVQFILFGVMMIGIFIVLWITIAK*
Ga0111539_1183907923300009094Populus RhizosphereMMLAQEAPLIDQGAVQFILFGVTVIIIFIALWITIAK*
Ga0066709_10329099323300009137Grasslands SoilVAGVLGLIAQESTRPLLDQGAVQFILFGVMMIVIFIVMWLTVDK*
Ga0105249_1001769043300009553Switchgrass RhizosphereMLAQEAPLIEQGAVQFILFGLTVIVIFIALWITIAK*
Ga0105252_1026371923300009678SoilMLAQEAVRLLDQGSVQFIVFTVMIVITFIALWISIAK*
Ga0105079_103558313300009805Groundwater SandMLAQEAAPLIEQGAVQFILFGVTVIVIFIALWITIAK*
Ga0105089_106754623300009809Groundwater SandMLAQETRPLLDEGVVQFILFGVMMIVIFIALWITIAK*
Ga0105084_101410913300009811Groundwater SandMLAQEAPLIDQGAVQFILFGVTVIVIFIALWITIAK*
Ga0105072_108259523300009818Groundwater SandMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIA
Ga0105066_113918723300009822Groundwater SandMLAQEAPLIEQGAVQFILFGVTVIVTFIALWITIAK*
Ga0126313_1018703033300009840Serpentine SoilMLAQEVPLIEQGAVQFILFGVTVIVIFIALWITIAK*
Ga0105074_102473233300010029Groundwater SandMLAQEAPLIERGAVQFILFGVTVIVIFIALWITIAK*
Ga0126314_1000415643300010042Serpentine SoilMLAAEGVRLMDVGVVQFILFGVMVLAIFITLWLTIAR*
Ga0134071_1042622213300010336Grasslands SoilETMLAQEARPLLDQGVVQFILFGVMMIGIFIVLWITIAK*
Ga0126377_1000502463300010362Tropical Forest SoilMMLAQETTPLIDQGAVQFILFGITVIVIFIALWITIAK*
Ga0134128_1314850113300010373Terrestrial SoilQESARLIDQGAVQFILFGVMLIIVFITLWFTISK*
Ga0136847_10805057193300010391Freshwater SedimentVLGLKLLDQGSVQFILFGVMVIVTYITLKFTSAK*
Ga0138112_100156623300010905Grasslands SoilMIGIGIPLMDQGVVQFVMFGVMVLVILFALWITIAK*
Ga0137430_122108623300012041SoilLAQEAVRLLDQGSVQFIVFTVMIVITFIALWISIAK*
Ga0137374_1036502833300012204Vadose Zone SoilMLAQETRPLLDEGVVQFILFGVMMIGIFIALWITIAK*
Ga0137374_1045092423300012204Vadose Zone SoilMLAQETRPLLDQGVVQFILFGVMMIGIFIVLWITIAK*
Ga0137380_1122566123300012206Vadose Zone SoilMFATIASETGPLLDQGIVQFILFGVMMIAIFVVLWITIA
Ga0137369_1028743133300012355Vadose Zone SoilMLAQEAPLIEQGGVQFILFGVTVIVIFIALWITIAK*
Ga0137371_1009352043300012356Vadose Zone SoilMFAAIASETGPLLDQGIVQFILFGVMMIAIFVVLWITIAK*
Ga0137375_1065939223300012360Vadose Zone SoilMLAQEAPLMEQGAVQFILFGVTVIVIFIALWITIAK*
Ga0137375_1119478023300012360Vadose Zone SoilMLAQEARLLDQGGVQFVIFGIMVLVIFIALWFTIAK*
Ga0157303_1011997423300012896SoilMLAQEAPLIEQGAVQFILFGITVIVIFIALWITIAK*
Ga0157286_1010174923300012908SoilMLAQEGQLIDQGAVQFILFGITVIVIFIALWFTIAK*
Ga0162652_10001126923300012941SoilMLAQEAPLIEQGAVQFILFGVTVIVIFISLWITIAK*
Ga0075354_110276323300014308Natural And Restored WetlandsMLAQEATRLLDQGSVQFIAFGVMVIVAFIALWIAI
Ga0075351_105870823300014318Natural And Restored WetlandsMLAQEAVRLLDQGAVQFIVFGVTLVITFIALWIAIAK*
Ga0075342_101999523300014320Natural And Restored WetlandsMMIAQESVRLLDQGSVQFIVFGVMVVITFIALWIAIAK*
Ga0075352_100769243300014324Natural And Restored WetlandsMLAQEATRLLDQGSVQFIAFGVMVIVAFIALWIAIAR*
Ga0120193_1002407923300014965TerrestrialMLAQEGAPLIDQGAVQFILFGIMVLVTFIVLWITIAK*
Ga0132258_1324065533300015371Arabidopsis RhizosphereMMLAQEAPLIDQGAVQFILFGATVIVIFIALWITIAK*
Ga0132256_10007041653300015372Arabidopsis RhizosphereMMLAQEAPLIDQGAVQFILFGVTVIVIFIALWITIAK*
Ga0184610_100114863300017997Groundwater SedimentMLAQEARPLLDEGVVQFILFGVMMLVIFIALWITIAK
Ga0184610_114147923300017997Groundwater SedimentMLAQETRPLLDEGVVQFILFGVMMIGIFIVLWITIAK
Ga0184610_131385013300017997Groundwater SedimentMLAQEAAKLLDQGSVQFILFSIVVIVTFIVLWLTIAK
Ga0184608_1034447113300018028Groundwater SedimentLGGTMLAQAAPLIEQGAVQFILFGVTVIVIFIALWITIAK
Ga0184620_1028495823300018051Groundwater SedimentVRTRLGGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK
Ga0184623_1018280623300018056Groundwater SedimentMLAQEAAKLLDQGSVQFILFSIVLIVTFIVLWLTIAK
Ga0184615_1034184623300018059Groundwater SedimentMLAQEAVRLLDQGSVQFIVFTVMIVITFIALWISIAK
Ga0184640_1004228823300018074Groundwater SedimentMLAQEARPLLDEGVVQFILFGVMMIVIFIALWITIAK
Ga0184633_1008012943300018077Groundwater SedimentMLAQETRPLLDEGVVQFILFGVMMLVIFIALWITIAK
Ga0184612_10008096103300018078Groundwater SedimentGGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK
Ga0184639_1010671943300018082Groundwater SedimentMLAQEAPLIQQGAVQFILFGVTVIVIFIALWITIAK
Ga0066655_1038231123300018431Grasslands SoilMLAQEARPLLDQGGVQFILFGVMMIGLFIVLWITIAK
Ga0190274_1004187253300018476SoilMLAQEVPLIEQGAVQFILFGVTVIVIFIALWITIAK
Ga0190274_1031094933300018476SoilMLAQETRPLLDEGAVQFILFGVMMIGIFIVLWITIAK
Ga0187892_1007007143300019458Bio-OozeMLAQEAAKLLDQGSVQFILFSIVIIVTFIVLWFTIAK
Ga0193697_102492933300020005SoilMVRTRLGGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK
Ga0210381_1039673923300021078Groundwater SedimentRLGGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK
Ga0193736_100439613300021412SoilMLAQEAAPLIEQGAVQFILFGVTVIVIFIALWFTISK
Ga0209322_1003125153300025146SoilMLAQEAVRLLDQGSVQFIVFSVMVVITFIVLWIAIAK
Ga0209322_1007296023300025146SoilVLGQIEMPLIEQGSVQFILFGVMMLVIFIGLWITISK
Ga0209642_1049136923300025167SoilMLAQEAVRLLDQGSVQFIVFSVMVVITFIALWIAIAK
Ga0209172_10003457293300025310Hot Spring SedimentMLAQEAARLLDQGSVQFILFGVMVLVVFVALWFTIAK
Ga0209172_1001925023300025310Hot Spring SedimentMLAQEAARLIDQGSVQFILFGIMVVVVFIALWFTIAK
Ga0209431_1048983323300025313SoilMLAQEAVRLLDQGSVQFIVFGVMVVVTFIALWIAIAK
Ga0209342_1006687543300025326SoilVIGAENVPLLEQGAVQFILFAVMVIVVFILMKITIAK
Ga0207684_1039391523300025910Corn, Switchgrass And Miscanthus RhizosphereMLAQEAPLIEQGAVQFILFGVTVIVIFIVLWITIAK
Ga0207646_1013386943300025922Corn, Switchgrass And Miscanthus RhizosphereMLAAEARLIDQGAVQFILFGVMVIAIFVALWVTIAK
Ga0207650_1028317833300025925Switchgrass RhizosphereMLAQEAPLIEQGAVQFILFGLTVIVIFIALWITIAK
Ga0208914_103218823300026102Natural And Restored WetlandsMLAQEATRLLDQGSVQFIAFGVMVIVAFIALWIAIAR
Ga0209469_104700823300026307SoilMLAQEARPLLDQGVVQFILFGVMMIGIFIALWITIAK
Ga0209159_104390853300026343SoilGGGTMLAQEARPLLDQGVVQFILFGVMMIGIFIVLWITIAK
Ga0209058_110251213300026536SoilMLAQEARPLLDQGVVQFILFGVMMIGIFIVLWITIAK
Ga0207599_10006743300027451SoilMLAQEAPLIEQGAVHFILFGVTVIVIFIALWITIAK
Ga0209887_101753313300027561Groundwater SandMLAQEAPLIEQGAVQFILFGVTVIVTFIALWITIAK
Ga0214468_100260453300027647SoilMLAQEAAPLMEQGSVQFILFGVMVLVIFVVMWITIAK
Ga0256865_111493613300027657SoilMLAQEAAPLMEQGSVQFILFGVMVLVIFVVMWITI
Ga0209814_1026170413300027873Populus RhizosphereMMLAQEAPLIDQGAVQFILFGITVIVIFIALWITIAK
Ga0209889_100930423300027952Groundwater SandMLAQETRPLLDQGVVQFILFGVMMIGIFIVLWITIAK
Ga0209853_100668263300027961Groundwater SandMLAQETRPLLDEGVVQFILFGVMMIVIFIALWITIAK
Ga0268265_1120733813300028380Switchgrass RhizosphereTRLGGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK
Ga0247822_1154360923300028592SoilMLAQEAPLFEQGAVQFSLFGVTVIVIFIALWITIAK
Ga0307305_1020435923300028807SoilMLAQEARPLLDQGVVQFILFGVMMIVIFIVLWITIAK
Ga0307310_1021285723300028824SoilMVRTRLGGPMLAQEAAPLIEQGAVQFILFGVTVIVIFIALWITIAK
Ga0307312_1008492633300028828SoilMLAQQVQPLLDQGVVQFILFGVMMIVIFIVLWITIAK
Ga0307278_1040196823300028878SoilVIGIEQPLLDQGIVQFILFGIMVIVVFVVMWITIAK
Ga0299907_1000011783300030006SoilMLAQEGAPLIDQGAVQFILFGIMVLVTFIVLWITIAK
Ga0299907_10003544103300030006SoilMLGQESVPLIDQGAVQFILLGVLIIVVFIALWFTIAK
Ga0299907_1027690623300030006SoilMLAQEAVKLLDQGSVQFILFGIMTIVTFLILWITIAK
Ga0308194_1004838323300031421SoilMLAAETRLLDQGAVQFILFGVMVIGIFITLWFTIAK
Ga0214473_1011159443300031949SoilMLAQEAVRLLDQGSVQFIVFGVMVVITFIALWIAIAK
Ga0214473_1011678733300031949SoilMLAQEAARLLDQGSVQFIVFSVTMVITFIALWIAIAK
Ga0214473_1075626523300031949SoilMLAQEAVRLLDQGSVQFIVFSVMVVITFIALWISIAK
Ga0310906_1015633213300032013SoilVVRTRLGGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK
Ga0307472_10228928723300032205Hardwood Forest SoilMMLAQEAPLIDQGAVQFILFGITVIIIFIALWITIAK
Ga0335084_1024148523300033004SoilMLAQEARLIDQGAVQFVIFGIMVLVIFIALWFTIAK
Ga0214471_1006233763300033417SoilAQEAAPLMEQGSVQFILFGVMVLVIFVVMWITIAK
Ga0247829_1132183123300033550SoilMLAQEAPLFEQGAVQFILFGVTVIVIFIALWITIAK
Ga0364930_0054010_221_3343300033814SedimentMLAQQVQPLLDQGVVQFILFGVMMLVIFIALWITIAK
Ga0364943_0159980_255_3653300034354SedimentMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITMAK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.