| Basic Information | |
|---|---|
| Family ID | F073509 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MLAQEAPLIDQGAVQFILFGVTVIVIFIALWITIAK |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.83 % |
| % of genes near scaffold ends (potentially truncated) | 19.17 % |
| % of genes from short scaffolds (< 2000 bps) | 70.83 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (30.833 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02629 | CoA_binding | 25.00 |
| PF06971 | Put_DNA-bind_N | 19.17 |
| PF13442 | Cytochrome_CBB3 | 5.83 |
| PF00034 | Cytochrom_C | 3.33 |
| PF05768 | Glrx-like | 3.33 |
| PF08281 | Sigma70_r4_2 | 2.50 |
| PF04542 | Sigma70_r2 | 2.50 |
| PF03824 | NicO | 1.67 |
| PF10099 | RskA | 1.67 |
| PF14224 | DUF4331 | 0.83 |
| PF04545 | Sigma70_r4 | 0.83 |
| PF02790 | COX2_TM | 0.83 |
| PF00202 | Aminotran_3 | 0.83 |
| PF01261 | AP_endonuc_2 | 0.83 |
| PF12270 | Cyt_c_ox_IV | 0.83 |
| PF08448 | PAS_4 | 0.83 |
| PF00355 | Rieske | 0.83 |
| PF01887 | SAM_HAT_N | 0.83 |
| PF00115 | COX1 | 0.83 |
| PF15698 | Phosphatase | 0.83 |
| PF01144 | CoA_trans | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0695 | Glutaredoxin | Posttranslational modification, protein turnover, chaperones [O] | 3.33 |
| COG3118 | Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family | Posttranslational modification, protein turnover, chaperones [O] | 3.33 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.50 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.50 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.50 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.50 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.83 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.83 |
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 0.83 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.83 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.67 % |
| Unclassified | root | N/A | 18.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_9098117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1357 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig540287 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0682502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1403 | Open in IMG/M |
| 3300002120|C687J26616_10003051 | All Organisms → cellular organisms → Bacteria | 6995 | Open in IMG/M |
| 3300002120|C687J26616_10174189 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300002149|C687J26657_10048469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300005180|Ga0066685_10998247 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005553|Ga0066695_10017487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3938 | Open in IMG/M |
| 3300005558|Ga0066698_10108034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1843 | Open in IMG/M |
| 3300005564|Ga0070664_100007465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8829 | Open in IMG/M |
| 3300005577|Ga0068857_101324331 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005617|Ga0068859_102243600 | Not Available | 602 | Open in IMG/M |
| 3300005713|Ga0066905_100055201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2459 | Open in IMG/M |
| 3300005937|Ga0081455_10002154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 23493 | Open in IMG/M |
| 3300005937|Ga0081455_10008763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10472 | Open in IMG/M |
| 3300005937|Ga0081455_10139940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1881 | Open in IMG/M |
| 3300006049|Ga0075417_10465461 | Not Available | 632 | Open in IMG/M |
| 3300006581|Ga0074048_10066308 | Not Available | 684 | Open in IMG/M |
| 3300006844|Ga0075428_100087919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3390 | Open in IMG/M |
| 3300006865|Ga0073934_10007952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14415 | Open in IMG/M |
| 3300006865|Ga0073934_10010389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11581 | Open in IMG/M |
| 3300009012|Ga0066710_100323452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2269 | Open in IMG/M |
| 3300009012|Ga0066710_100549411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1747 | Open in IMG/M |
| 3300009012|Ga0066710_101781396 | Not Available | 931 | Open in IMG/M |
| 3300009012|Ga0066710_104686060 | Not Available | 511 | Open in IMG/M |
| 3300009081|Ga0105098_10275333 | Not Available | 801 | Open in IMG/M |
| 3300009094|Ga0111539_11839079 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300009137|Ga0066709_103290993 | Not Available | 588 | Open in IMG/M |
| 3300009553|Ga0105249_10017690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6331 | Open in IMG/M |
| 3300009678|Ga0105252_10263719 | Not Available | 758 | Open in IMG/M |
| 3300009805|Ga0105079_1035583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300009809|Ga0105089_1067546 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009811|Ga0105084_1014109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| 3300009818|Ga0105072_1082595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300009822|Ga0105066_1139187 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009840|Ga0126313_10187030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1584 | Open in IMG/M |
| 3300010029|Ga0105074_1024732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1006 | Open in IMG/M |
| 3300010042|Ga0126314_10004156 | All Organisms → cellular organisms → Bacteria | 7519 | Open in IMG/M |
| 3300010336|Ga0134071_10426222 | Not Available | 678 | Open in IMG/M |
| 3300010362|Ga0126377_10005024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9717 | Open in IMG/M |
| 3300010373|Ga0134128_13148501 | Not Available | 507 | Open in IMG/M |
| 3300010391|Ga0136847_10805057 | All Organisms → cellular organisms → Bacteria | 25392 | Open in IMG/M |
| 3300010905|Ga0138112_1001566 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012041|Ga0137430_1221086 | Not Available | 542 | Open in IMG/M |
| 3300012204|Ga0137374_10365028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1159 | Open in IMG/M |
| 3300012204|Ga0137374_10450924 | Not Available | 1010 | Open in IMG/M |
| 3300012206|Ga0137380_11225661 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012355|Ga0137369_10287431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1226 | Open in IMG/M |
| 3300012356|Ga0137371_10093520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2338 | Open in IMG/M |
| 3300012360|Ga0137375_10659392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
| 3300012360|Ga0137375_11194780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300012896|Ga0157303_10119974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300012908|Ga0157286_10101749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
| 3300012941|Ga0162652_100011269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1114 | Open in IMG/M |
| 3300014308|Ga0075354_1102763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300014318|Ga0075351_1058708 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300014320|Ga0075342_1019995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1516 | Open in IMG/M |
| 3300014324|Ga0075352_1007692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1995 | Open in IMG/M |
| 3300014965|Ga0120193_10024079 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300015371|Ga0132258_13240655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1122 | Open in IMG/M |
| 3300015372|Ga0132256_100070416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3312 | Open in IMG/M |
| 3300017997|Ga0184610_1001148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5970 | Open in IMG/M |
| 3300017997|Ga0184610_1141479 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300017997|Ga0184610_1313850 | Not Available | 515 | Open in IMG/M |
| 3300018028|Ga0184608_10344471 | Not Available | 655 | Open in IMG/M |
| 3300018051|Ga0184620_10284958 | Not Available | 556 | Open in IMG/M |
| 3300018056|Ga0184623_10182806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300018059|Ga0184615_10341846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300018074|Ga0184640_10042288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1856 | Open in IMG/M |
| 3300018077|Ga0184633_10080129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1679 | Open in IMG/M |
| 3300018078|Ga0184612_10008096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5286 | Open in IMG/M |
| 3300018082|Ga0184639_10106719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
| 3300018431|Ga0066655_10382311 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300018476|Ga0190274_10041872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3239 | Open in IMG/M |
| 3300018476|Ga0190274_10310949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1473 | Open in IMG/M |
| 3300019458|Ga0187892_10070071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2244 | Open in IMG/M |
| 3300020005|Ga0193697_1024929 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300021078|Ga0210381_10396739 | Not Available | 509 | Open in IMG/M |
| 3300021412|Ga0193736_1004396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1678 | Open in IMG/M |
| 3300025146|Ga0209322_10031251 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
| 3300025146|Ga0209322_10072960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1616 | Open in IMG/M |
| 3300025167|Ga0209642_10491369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300025310|Ga0209172_10003457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 24056 | Open in IMG/M |
| 3300025310|Ga0209172_10019250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5014 | Open in IMG/M |
| 3300025313|Ga0209431_10489833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
| 3300025326|Ga0209342_10066875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3372 | Open in IMG/M |
| 3300025910|Ga0207684_10393915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1191 | Open in IMG/M |
| 3300025922|Ga0207646_10133869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2232 | Open in IMG/M |
| 3300025925|Ga0207650_10283178 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300026102|Ga0208914_1032188 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300026307|Ga0209469_1047008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1374 | Open in IMG/M |
| 3300026343|Ga0209159_1043908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2254 | Open in IMG/M |
| 3300026536|Ga0209058_1102512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1445 | Open in IMG/M |
| 3300027451|Ga0207599_100067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2173 | Open in IMG/M |
| 3300027561|Ga0209887_1017533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1763 | Open in IMG/M |
| 3300027647|Ga0214468_1002604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5649 | Open in IMG/M |
| 3300027657|Ga0256865_1114936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300027873|Ga0209814_10261704 | Not Available | 751 | Open in IMG/M |
| 3300027952|Ga0209889_1009304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2454 | Open in IMG/M |
| 3300027961|Ga0209853_1006682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3576 | Open in IMG/M |
| 3300028380|Ga0268265_11207338 | Not Available | 754 | Open in IMG/M |
| 3300028592|Ga0247822_11543609 | Not Available | 562 | Open in IMG/M |
| 3300028807|Ga0307305_10204359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 908 | Open in IMG/M |
| 3300028824|Ga0307310_10212857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 917 | Open in IMG/M |
| 3300028828|Ga0307312_10084926 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300028878|Ga0307278_10401968 | Not Available | 602 | Open in IMG/M |
| 3300030006|Ga0299907_10000117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 30221 | Open in IMG/M |
| 3300030006|Ga0299907_10003544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10015 | Open in IMG/M |
| 3300030006|Ga0299907_10276906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1373 | Open in IMG/M |
| 3300031421|Ga0308194_10048383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1078 | Open in IMG/M |
| 3300031949|Ga0214473_10111594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3193 | Open in IMG/M |
| 3300031949|Ga0214473_10116787 | All Organisms → cellular organisms → Bacteria | 3116 | Open in IMG/M |
| 3300031949|Ga0214473_10756265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
| 3300032013|Ga0310906_10156332 | Not Available | 1336 | Open in IMG/M |
| 3300032205|Ga0307472_102289287 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300033004|Ga0335084_10241485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1873 | Open in IMG/M |
| 3300033417|Ga0214471_10062337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3052 | Open in IMG/M |
| 3300033550|Ga0247829_11321831 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300033814|Ga0364930_0054010 | Not Available | 1366 | Open in IMG/M |
| 3300034354|Ga0364943_0159980 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 9.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.50% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 7.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 4.17% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.17% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 3.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.50% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.50% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.67% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.83% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002149 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
| 3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026102 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027451 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G09K3-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
| 3300027657 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeq | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_01886050 | 2088090015 | Soil | MLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK |
| KansclcFeb2_03309040 | 2124908045 | Soil | MLAQEAPLIDQGAVQFILFGVTVIVIFIALWITIAK |
| ICChiseqgaiiDRAFT_06825022 | 3300000033 | Soil | MLAQETRPLLDEGVVQFILFGVMMIGIFIVLWITIAK* |
| C687J26616_100030518 | 3300002120 | Soil | MLAQEAVRLLDQGSVQFIVFSVMVVITFIVLWIAIAK* |
| C687J26616_101741892 | 3300002120 | Soil | VLGQIEMPLIEQGSVQFILFGVMMLVIFIGLWITISK* |
| C687J26657_100484692 | 3300002149 | Soil | MLAQEAARLIDQGSVQFILFGVMVLVTFIVLWYTIAK* |
| Ga0066685_109982471 | 3300005180 | Soil | VLGLIAQESARPLLDQGAVQFILFGVMMIVIFIVMWLTVDK* |
| Ga0066695_100174876 | 3300005553 | Soil | MLAQEARPLLDQGVVQFILFGVMMIGIFIALWITIAK* |
| Ga0066698_101080342 | 3300005558 | Soil | MLAQEARPLLDQGVVQFILFGVMMIGIFIVLWITIAK* |
| Ga0070664_1000074653 | 3300005564 | Corn Rhizosphere | MLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK* |
| Ga0068857_1013243312 | 3300005577 | Corn Rhizosphere | VLAQESARLIDQGAVQFILFGVMLIIVFITLWFTISK* |
| Ga0068859_1022436002 | 3300005617 | Switchgrass Rhizosphere | VLAQESARLIDQGAVQFILYGVMLIIVFITLWFTISK* |
| Ga0066905_1000552014 | 3300005713 | Tropical Forest Soil | MLAQETQLIDQGAVQFILFGITVIVIFIALWITIAK* |
| Ga0081455_1000215426 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MMLAQEAPLIDQGAVQFILFGITVIVIFIALWITIAK* |
| Ga0081455_100087639 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MMLAQEAPLIDQGAVQFILFGITVIIIFIALWITIAK* |
| Ga0081455_101399402 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MMLAQEVPLIDQGAVQFILFGITVIIIFIALWITIAK* |
| Ga0075417_104654612 | 3300006049 | Populus Rhizosphere | AMMLAQEAPLIDQGAVQFILFGITVIVIFIALWITIAK* |
| Ga0074048_100663082 | 3300006581 | Soil | LAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK* |
| Ga0075428_1000879193 | 3300006844 | Populus Rhizosphere | MLAQEAVKLLDQGSVQFILFGIMTIVTFVILWITIAK* |
| Ga0073934_1000795218 | 3300006865 | Hot Spring Sediment | MLAQEAARLLDQGSVQFILFGVMVLVVFVALWFTIAK* |
| Ga0073934_100103892 | 3300006865 | Hot Spring Sediment | MLAQEAARLIDQGSVQFILFGIMVVVVFIALWFTIAK* |
| Ga0066710_1003234523 | 3300009012 | Grasslands Soil | VLGLIAQESTRPLLDQGAVQFILFGVMMIVIFIVMWLTVDK |
| Ga0066710_1005494112 | 3300009012 | Grasslands Soil | MIALETPLIDQGVVQFVLFGVMVLVILFALWITIAK |
| Ga0066710_1017813962 | 3300009012 | Grasslands Soil | MLAMVAAHLIDSGSVQFILFGVVVIAIFVALLITIAK |
| Ga0066710_1046860602 | 3300009012 | Grasslands Soil | MFATIASETGPLLDQGIVQFILFGVMMIAIFVVLWITIAK |
| Ga0105098_102753332 | 3300009081 | Freshwater Sediment | MLAQETRPLLDEGAVQFILFGVMMIGIFIVLWITIAK* |
| Ga0111539_118390792 | 3300009094 | Populus Rhizosphere | MMLAQEAPLIDQGAVQFILFGVTVIIIFIALWITIAK* |
| Ga0066709_1032909932 | 3300009137 | Grasslands Soil | VAGVLGLIAQESTRPLLDQGAVQFILFGVMMIVIFIVMWLTVDK* |
| Ga0105249_100176904 | 3300009553 | Switchgrass Rhizosphere | MLAQEAPLIEQGAVQFILFGLTVIVIFIALWITIAK* |
| Ga0105252_102637192 | 3300009678 | Soil | MLAQEAVRLLDQGSVQFIVFTVMIVITFIALWISIAK* |
| Ga0105079_10355831 | 3300009805 | Groundwater Sand | MLAQEAAPLIEQGAVQFILFGVTVIVIFIALWITIAK* |
| Ga0105089_10675462 | 3300009809 | Groundwater Sand | MLAQETRPLLDEGVVQFILFGVMMIVIFIALWITIAK* |
| Ga0105084_10141091 | 3300009811 | Groundwater Sand | MLAQEAPLIDQGAVQFILFGVTVIVIFIALWITIAK* |
| Ga0105072_10825952 | 3300009818 | Groundwater Sand | MLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIA |
| Ga0105066_11391872 | 3300009822 | Groundwater Sand | MLAQEAPLIEQGAVQFILFGVTVIVTFIALWITIAK* |
| Ga0126313_101870303 | 3300009840 | Serpentine Soil | MLAQEVPLIEQGAVQFILFGVTVIVIFIALWITIAK* |
| Ga0105074_10247323 | 3300010029 | Groundwater Sand | MLAQEAPLIERGAVQFILFGVTVIVIFIALWITIAK* |
| Ga0126314_100041564 | 3300010042 | Serpentine Soil | MLAAEGVRLMDVGVVQFILFGVMVLAIFITLWLTIAR* |
| Ga0134071_104262221 | 3300010336 | Grasslands Soil | ETMLAQEARPLLDQGVVQFILFGVMMIGIFIVLWITIAK* |
| Ga0126377_100050246 | 3300010362 | Tropical Forest Soil | MMLAQETTPLIDQGAVQFILFGITVIVIFIALWITIAK* |
| Ga0134128_131485011 | 3300010373 | Terrestrial Soil | QESARLIDQGAVQFILFGVMLIIVFITLWFTISK* |
| Ga0136847_1080505719 | 3300010391 | Freshwater Sediment | VLGLKLLDQGSVQFILFGVMVIVTYITLKFTSAK* |
| Ga0138112_10015662 | 3300010905 | Grasslands Soil | MIGIGIPLMDQGVVQFVMFGVMVLVILFALWITIAK* |
| Ga0137430_12210862 | 3300012041 | Soil | LAQEAVRLLDQGSVQFIVFTVMIVITFIALWISIAK* |
| Ga0137374_103650283 | 3300012204 | Vadose Zone Soil | MLAQETRPLLDEGVVQFILFGVMMIGIFIALWITIAK* |
| Ga0137374_104509242 | 3300012204 | Vadose Zone Soil | MLAQETRPLLDQGVVQFILFGVMMIGIFIVLWITIAK* |
| Ga0137380_112256612 | 3300012206 | Vadose Zone Soil | MFATIASETGPLLDQGIVQFILFGVMMIAIFVVLWITIA |
| Ga0137369_102874313 | 3300012355 | Vadose Zone Soil | MLAQEAPLIEQGGVQFILFGVTVIVIFIALWITIAK* |
| Ga0137371_100935204 | 3300012356 | Vadose Zone Soil | MFAAIASETGPLLDQGIVQFILFGVMMIAIFVVLWITIAK* |
| Ga0137375_106593922 | 3300012360 | Vadose Zone Soil | MLAQEAPLMEQGAVQFILFGVTVIVIFIALWITIAK* |
| Ga0137375_111947802 | 3300012360 | Vadose Zone Soil | MLAQEARLLDQGGVQFVIFGIMVLVIFIALWFTIAK* |
| Ga0157303_101199742 | 3300012896 | Soil | MLAQEAPLIEQGAVQFILFGITVIVIFIALWITIAK* |
| Ga0157286_101017492 | 3300012908 | Soil | MLAQEGQLIDQGAVQFILFGITVIVIFIALWFTIAK* |
| Ga0162652_1000112692 | 3300012941 | Soil | MLAQEAPLIEQGAVQFILFGVTVIVIFISLWITIAK* |
| Ga0075354_11027632 | 3300014308 | Natural And Restored Wetlands | MLAQEATRLLDQGSVQFIAFGVMVIVAFIALWIAI |
| Ga0075351_10587082 | 3300014318 | Natural And Restored Wetlands | MLAQEAVRLLDQGAVQFIVFGVTLVITFIALWIAIAK* |
| Ga0075342_10199952 | 3300014320 | Natural And Restored Wetlands | MMIAQESVRLLDQGSVQFIVFGVMVVITFIALWIAIAK* |
| Ga0075352_10076924 | 3300014324 | Natural And Restored Wetlands | MLAQEATRLLDQGSVQFIAFGVMVIVAFIALWIAIAR* |
| Ga0120193_100240792 | 3300014965 | Terrestrial | MLAQEGAPLIDQGAVQFILFGIMVLVTFIVLWITIAK* |
| Ga0132258_132406553 | 3300015371 | Arabidopsis Rhizosphere | MMLAQEAPLIDQGAVQFILFGATVIVIFIALWITIAK* |
| Ga0132256_1000704165 | 3300015372 | Arabidopsis Rhizosphere | MMLAQEAPLIDQGAVQFILFGVTVIVIFIALWITIAK* |
| Ga0184610_10011486 | 3300017997 | Groundwater Sediment | MLAQEARPLLDEGVVQFILFGVMMLVIFIALWITIAK |
| Ga0184610_11414792 | 3300017997 | Groundwater Sediment | MLAQETRPLLDEGVVQFILFGVMMIGIFIVLWITIAK |
| Ga0184610_13138501 | 3300017997 | Groundwater Sediment | MLAQEAAKLLDQGSVQFILFSIVVIVTFIVLWLTIAK |
| Ga0184608_103444711 | 3300018028 | Groundwater Sediment | LGGTMLAQAAPLIEQGAVQFILFGVTVIVIFIALWITIAK |
| Ga0184620_102849582 | 3300018051 | Groundwater Sediment | VRTRLGGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK |
| Ga0184623_101828062 | 3300018056 | Groundwater Sediment | MLAQEAAKLLDQGSVQFILFSIVLIVTFIVLWLTIAK |
| Ga0184615_103418462 | 3300018059 | Groundwater Sediment | MLAQEAVRLLDQGSVQFIVFTVMIVITFIALWISIAK |
| Ga0184640_100422882 | 3300018074 | Groundwater Sediment | MLAQEARPLLDEGVVQFILFGVMMIVIFIALWITIAK |
| Ga0184633_100801294 | 3300018077 | Groundwater Sediment | MLAQETRPLLDEGVVQFILFGVMMLVIFIALWITIAK |
| Ga0184612_1000809610 | 3300018078 | Groundwater Sediment | GGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK |
| Ga0184639_101067194 | 3300018082 | Groundwater Sediment | MLAQEAPLIQQGAVQFILFGVTVIVIFIALWITIAK |
| Ga0066655_103823112 | 3300018431 | Grasslands Soil | MLAQEARPLLDQGGVQFILFGVMMIGLFIVLWITIAK |
| Ga0190274_100418725 | 3300018476 | Soil | MLAQEVPLIEQGAVQFILFGVTVIVIFIALWITIAK |
| Ga0190274_103109493 | 3300018476 | Soil | MLAQETRPLLDEGAVQFILFGVMMIGIFIVLWITIAK |
| Ga0187892_100700714 | 3300019458 | Bio-Ooze | MLAQEAAKLLDQGSVQFILFSIVIIVTFIVLWFTIAK |
| Ga0193697_10249293 | 3300020005 | Soil | MVRTRLGGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK |
| Ga0210381_103967392 | 3300021078 | Groundwater Sediment | RLGGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK |
| Ga0193736_10043961 | 3300021412 | Soil | MLAQEAAPLIEQGAVQFILFGVTVIVIFIALWFTISK |
| Ga0209322_100312515 | 3300025146 | Soil | MLAQEAVRLLDQGSVQFIVFSVMVVITFIVLWIAIAK |
| Ga0209322_100729602 | 3300025146 | Soil | VLGQIEMPLIEQGSVQFILFGVMMLVIFIGLWITISK |
| Ga0209642_104913692 | 3300025167 | Soil | MLAQEAVRLLDQGSVQFIVFSVMVVITFIALWIAIAK |
| Ga0209172_1000345729 | 3300025310 | Hot Spring Sediment | MLAQEAARLLDQGSVQFILFGVMVLVVFVALWFTIAK |
| Ga0209172_100192502 | 3300025310 | Hot Spring Sediment | MLAQEAARLIDQGSVQFILFGIMVVVVFIALWFTIAK |
| Ga0209431_104898332 | 3300025313 | Soil | MLAQEAVRLLDQGSVQFIVFGVMVVVTFIALWIAIAK |
| Ga0209342_100668754 | 3300025326 | Soil | VIGAENVPLLEQGAVQFILFAVMVIVVFILMKITIAK |
| Ga0207684_103939152 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAQEAPLIEQGAVQFILFGVTVIVIFIVLWITIAK |
| Ga0207646_101338694 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAAEARLIDQGAVQFILFGVMVIAIFVALWVTIAK |
| Ga0207650_102831783 | 3300025925 | Switchgrass Rhizosphere | MLAQEAPLIEQGAVQFILFGLTVIVIFIALWITIAK |
| Ga0208914_10321882 | 3300026102 | Natural And Restored Wetlands | MLAQEATRLLDQGSVQFIAFGVMVIVAFIALWIAIAR |
| Ga0209469_10470082 | 3300026307 | Soil | MLAQEARPLLDQGVVQFILFGVMMIGIFIALWITIAK |
| Ga0209159_10439085 | 3300026343 | Soil | GGGTMLAQEARPLLDQGVVQFILFGVMMIGIFIVLWITIAK |
| Ga0209058_11025121 | 3300026536 | Soil | MLAQEARPLLDQGVVQFILFGVMMIGIFIVLWITIAK |
| Ga0207599_1000674 | 3300027451 | Soil | MLAQEAPLIEQGAVHFILFGVTVIVIFIALWITIAK |
| Ga0209887_10175331 | 3300027561 | Groundwater Sand | MLAQEAPLIEQGAVQFILFGVTVIVTFIALWITIAK |
| Ga0214468_10026045 | 3300027647 | Soil | MLAQEAAPLMEQGSVQFILFGVMVLVIFVVMWITIAK |
| Ga0256865_11149361 | 3300027657 | Soil | MLAQEAAPLMEQGSVQFILFGVMVLVIFVVMWITI |
| Ga0209814_102617041 | 3300027873 | Populus Rhizosphere | MMLAQEAPLIDQGAVQFILFGITVIVIFIALWITIAK |
| Ga0209889_10093042 | 3300027952 | Groundwater Sand | MLAQETRPLLDQGVVQFILFGVMMIGIFIVLWITIAK |
| Ga0209853_10066826 | 3300027961 | Groundwater Sand | MLAQETRPLLDEGVVQFILFGVMMIVIFIALWITIAK |
| Ga0268265_112073381 | 3300028380 | Switchgrass Rhizosphere | TRLGGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK |
| Ga0247822_115436092 | 3300028592 | Soil | MLAQEAPLFEQGAVQFSLFGVTVIVIFIALWITIAK |
| Ga0307305_102043592 | 3300028807 | Soil | MLAQEARPLLDQGVVQFILFGVMMIVIFIVLWITIAK |
| Ga0307310_102128572 | 3300028824 | Soil | MVRTRLGGPMLAQEAAPLIEQGAVQFILFGVTVIVIFIALWITIAK |
| Ga0307312_100849263 | 3300028828 | Soil | MLAQQVQPLLDQGVVQFILFGVMMIVIFIVLWITIAK |
| Ga0307278_104019682 | 3300028878 | Soil | VIGIEQPLLDQGIVQFILFGIMVIVVFVVMWITIAK |
| Ga0299907_100001178 | 3300030006 | Soil | MLAQEGAPLIDQGAVQFILFGIMVLVTFIVLWITIAK |
| Ga0299907_1000354410 | 3300030006 | Soil | MLGQESVPLIDQGAVQFILLGVLIIVVFIALWFTIAK |
| Ga0299907_102769062 | 3300030006 | Soil | MLAQEAVKLLDQGSVQFILFGIMTIVTFLILWITIAK |
| Ga0308194_100483832 | 3300031421 | Soil | MLAAETRLLDQGAVQFILFGVMVIGIFITLWFTIAK |
| Ga0214473_101115944 | 3300031949 | Soil | MLAQEAVRLLDQGSVQFIVFGVMVVITFIALWIAIAK |
| Ga0214473_101167873 | 3300031949 | Soil | MLAQEAARLLDQGSVQFIVFSVTMVITFIALWIAIAK |
| Ga0214473_107562652 | 3300031949 | Soil | MLAQEAVRLLDQGSVQFIVFSVMVVITFIALWISIAK |
| Ga0310906_101563321 | 3300032013 | Soil | VVRTRLGGTMLAQEAPLIEQGAVQFILFGVTVIVIFIALWITIAK |
| Ga0307472_1022892872 | 3300032205 | Hardwood Forest Soil | MMLAQEAPLIDQGAVQFILFGITVIIIFIALWITIAK |
| Ga0335084_102414852 | 3300033004 | Soil | MLAQEARLIDQGAVQFVIFGIMVLVIFIALWFTIAK |
| Ga0214471_100623376 | 3300033417 | Soil | AQEAAPLMEQGSVQFILFGVMVLVIFVVMWITIAK |
| Ga0247829_113218312 | 3300033550 | Soil | MLAQEAPLFEQGAVQFILFGVTVIVIFIALWITIAK |
| Ga0364930_0054010_221_334 | 3300033814 | Sediment | MLAQQVQPLLDQGVVQFILFGVMMLVIFIALWITIAK |
| Ga0364943_0159980_255_365 | 3300034354 | Sediment | MLAQEAPLIEQGAVQFILFGVTVIVIFIALWITMAK |
| ⦗Top⦘ |