NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073331

Metagenome / Metatranscriptome Family F073331

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073331
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 42 residues
Representative Sequence YWELFTSFYRNLIEMPADHLPHTFVEAFAAAYREALKKPTQ
Number of Associated Samples 106
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.17 %
% of genes from short scaffolds (< 2000 bps) 85.83 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.833 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(35.833 % of family members)
Environment Ontology (ENVO) Unclassified
(30.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(38.333 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.03%    β-sheet: 0.00%    Coil/Unstructured: 57.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF00497SBP_bac_3 20.00
PF01464SLT 9.17
PF01551Peptidase_M23 3.33
PF06224HTH_42 2.50
PF14437MafB19-deam 2.50
PF07715Plug 1.67
PF00801PKD 1.67
PF00563EAL 1.67
PF06532NrsF 1.67
PF00561Abhydrolase_1 0.83
PF13557Phenol_MetA_deg 0.83
PF07759DUF1615 0.83
PF08240ADH_N 0.83
PF01103Omp85 0.83
PF02518HATPase_c 0.83
PF01066CDP-OH_P_transf 0.83
PF02016Peptidase_S66 0.83
PF02798GST_N 0.83
PF07944Glyco_hydro_127 0.83
PF01035DNA_binding_1 0.83
PF08281Sigma70_r4_2 0.83
PF13426PAS_9 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 2.50
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 1.67
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 1.67
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 1.67
COG4944Uncharacterized conserved proteinFunction unknown [S] 1.67
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 1.67
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 0.83
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.83
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.83
COG1619Muramoyltetrapeptide carboxypeptidase LdcA (peptidoglycan recycling)Cell wall/membrane/envelope biogenesis [M] 0.83
COG3533Beta-L-arabinofuranosidase, GH127 familyCarbohydrate transport and metabolism [G] 0.83
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 0.83
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.83 %
UnclassifiedrootN/A4.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002853|draft_1018368All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium626Open in IMG/M
3300005186|Ga0066676_10626464All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria730Open in IMG/M
3300005437|Ga0070710_10685969All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria721Open in IMG/M
3300005557|Ga0066704_10922253All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria540Open in IMG/M
3300005578|Ga0068854_101611845All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium592Open in IMG/M
3300005618|Ga0068864_101476405All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria683Open in IMG/M
3300005764|Ga0066903_102919823All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium927Open in IMG/M
3300006796|Ga0066665_10078174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2369Open in IMG/M
3300006918|Ga0079216_10758644Not Available704Open in IMG/M
3300009092|Ga0105250_10389100Not Available616Open in IMG/M
3300009093|Ga0105240_10464114All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300009093|Ga0105240_12664561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6516Open in IMG/M
3300009545|Ga0105237_12362102All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300010046|Ga0126384_10983048All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria767Open in IMG/M
3300010046|Ga0126384_11596108All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300010048|Ga0126373_11158307All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300010322|Ga0134084_10131452All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria827Open in IMG/M
3300010371|Ga0134125_12946339Not Available517Open in IMG/M
3300010373|Ga0134128_10350037All Organisms → cellular organisms → Bacteria1651Open in IMG/M
3300010373|Ga0134128_11263264Not Available814Open in IMG/M
3300010373|Ga0134128_13069312All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300010375|Ga0105239_10170214All Organisms → cellular organisms → Bacteria → Proteobacteria2435Open in IMG/M
3300010375|Ga0105239_10516434All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1359Open in IMG/M
3300010396|Ga0134126_10009127All Organisms → cellular organisms → Bacteria → Proteobacteria12497Open in IMG/M
3300010396|Ga0134126_10848979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1030Open in IMG/M
3300010403|Ga0134123_10772923All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300012285|Ga0137370_10027737All Organisms → cellular organisms → Bacteria → Proteobacteria2912Open in IMG/M
3300012359|Ga0137385_11338493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6579Open in IMG/M
3300012927|Ga0137416_11908467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6544Open in IMG/M
3300012927|Ga0137416_12231448Not Available503Open in IMG/M
3300012929|Ga0137404_11683946All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas → Solimonas marina589Open in IMG/M
3300013100|Ga0157373_10972028All Organisms → cellular organisms → Bacteria → Proteobacteria633Open in IMG/M
3300013306|Ga0163162_11567919All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300013308|Ga0157375_10107458All Organisms → cellular organisms → Bacteria → Proteobacteria2884Open in IMG/M
3300015264|Ga0137403_10075484All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter piechaudii3415Open in IMG/M
3300015264|Ga0137403_10483224All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1111Open in IMG/M
3300016341|Ga0182035_11460735All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium615Open in IMG/M
3300017936|Ga0187821_10121965All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria971Open in IMG/M
3300017961|Ga0187778_10169758All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1382Open in IMG/M
3300017966|Ga0187776_10062659All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2139Open in IMG/M
3300018062|Ga0187784_11381971All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium558Open in IMG/M
3300020582|Ga0210395_10020599All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4853Open in IMG/M
3300021151|Ga0179584_1284313All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria611Open in IMG/M
3300021171|Ga0210405_10299715All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1270Open in IMG/M
3300021171|Ga0210405_10308092All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1251Open in IMG/M
3300021402|Ga0210385_10284807All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1222Open in IMG/M
3300021402|Ga0210385_11221260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6577Open in IMG/M
3300021405|Ga0210387_10154876All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1963Open in IMG/M
3300021406|Ga0210386_11566858All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria547Open in IMG/M
3300021420|Ga0210394_10672116All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria908Open in IMG/M
3300021476|Ga0187846_10224232All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300025862|Ga0209483_1172612All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300025900|Ga0207710_10167611All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300025903|Ga0207680_10283135All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300025905|Ga0207685_10313888All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria780Open in IMG/M
3300025905|Ga0207685_10703240All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria550Open in IMG/M
3300025913|Ga0207695_10640630All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300025917|Ga0207660_10018911All Organisms → cellular organisms → Bacteria4600Open in IMG/M
3300025921|Ga0207652_10302598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61443Open in IMG/M
3300025924|Ga0207694_10716679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6844Open in IMG/M
3300026343|Ga0209159_1168899All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria804Open in IMG/M
3300026496|Ga0257157_1099157All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria510Open in IMG/M
3300026547|Ga0209156_10128243All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1239Open in IMG/M
3300026760|Ga0207630_108729All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria503Open in IMG/M
3300027014|Ga0207815_1038339All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria580Open in IMG/M
3300027171|Ga0207947_1008833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6682Open in IMG/M
3300027297|Ga0208241_1077689All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria532Open in IMG/M
3300027562|Ga0209735_1147428All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium511Open in IMG/M
3300027655|Ga0209388_1163192All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria627Open in IMG/M
3300027894|Ga0209068_10628667All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria626Open in IMG/M
3300028380|Ga0268265_10051921All Organisms → cellular organisms → Bacteria3098Open in IMG/M
3300028877|Ga0302235_10189982All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300029944|Ga0311352_10771003All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300031057|Ga0170834_111267318All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria554Open in IMG/M
3300031122|Ga0170822_10070919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6570Open in IMG/M
3300031507|Ga0307509_10539958All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300031543|Ga0318516_10724495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6564Open in IMG/M
3300031549|Ga0318571_10034718All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1426Open in IMG/M
3300031549|Ga0318571_10473258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6500Open in IMG/M
3300031561|Ga0318528_10584441All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300031564|Ga0318573_10271592All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria905Open in IMG/M
3300031668|Ga0318542_10255215All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria892Open in IMG/M
3300031680|Ga0318574_10092525All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1665Open in IMG/M
3300031719|Ga0306917_10231687All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1409Open in IMG/M
3300031724|Ga0318500_10011620All Organisms → cellular organisms → Bacteria → Proteobacteria3106Open in IMG/M
3300031724|Ga0318500_10172325All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1027Open in IMG/M
3300031747|Ga0318502_10831990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6560Open in IMG/M
3300031751|Ga0318494_10861847All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031768|Ga0318509_10021543All Organisms → cellular organisms → Bacteria → Proteobacteria3024Open in IMG/M
3300031770|Ga0318521_10052867All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2103Open in IMG/M
3300031777|Ga0318543_10495593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6547Open in IMG/M
3300031778|Ga0318498_10009645All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3843Open in IMG/M
3300031782|Ga0318552_10471925All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria640Open in IMG/M
3300031799|Ga0318565_10343463All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria724Open in IMG/M
3300031805|Ga0318497_10614580All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria609Open in IMG/M
3300031819|Ga0318568_10719882All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria620Open in IMG/M
3300031859|Ga0318527_10130533All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1046Open in IMG/M
3300031860|Ga0318495_10387692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6616Open in IMG/M
3300031894|Ga0318522_10237407All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria691Open in IMG/M
3300031896|Ga0318551_10607475All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria631Open in IMG/M
3300031897|Ga0318520_10023096All Organisms → cellular organisms → Bacteria → Proteobacteria3000Open in IMG/M
3300031941|Ga0310912_11408393All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031946|Ga0310910_10089897All Organisms → cellular organisms → Bacteria → Proteobacteria2259Open in IMG/M
3300031959|Ga0318530_10448788All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium535Open in IMG/M
3300031962|Ga0307479_10197306All Organisms → cellular organisms → Bacteria → Proteobacteria1982Open in IMG/M
3300031996|Ga0308176_12493477All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300032009|Ga0318563_10579342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6605Open in IMG/M
3300032041|Ga0318549_10021944All Organisms → cellular organisms → Bacteria → Proteobacteria2428Open in IMG/M
3300032041|Ga0318549_10070652All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1481Open in IMG/M
3300032042|Ga0318545_10025951All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1894Open in IMG/M
3300032043|Ga0318556_10692094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6530Open in IMG/M
3300032059|Ga0318533_10191379All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1462Open in IMG/M
3300032065|Ga0318513_10378557All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300032770|Ga0335085_11669181All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria657Open in IMG/M
3300032783|Ga0335079_11305945All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria724Open in IMG/M
3300032892|Ga0335081_12730579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium TMPK1503Open in IMG/M
3300032898|Ga0335072_10653035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1042Open in IMG/M
3300032954|Ga0335083_10800017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6756Open in IMG/M
3300033134|Ga0335073_12032803All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300033475|Ga0310811_11250794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6601Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.83%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.50%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.50%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.50%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.50%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.67%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.67%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.83%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.83%
Hydrocarbon Resource EnvironmentsEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.83%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.83%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002853PDIso9.ppmwps2EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021151Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026760Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-B (SPAdes)EnvironmentalOpen in IMG/M
3300027014Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027171Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
draft_101836833300002853Hydrocarbon Resource EnvironmentsDKAQYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYREAMKKSPG*
Ga0066676_1062646413300005186SoilSADKSQYWDLFTTFYRNLIEMPAEHLPHTFVEAFAAAYREALKKPAS*
Ga0070710_1068596913300005437Corn, Switchgrass And Miscanthus RhizosphereELFTTFYRNLIEMPADHLPHTFVEAFATAYREALKKQPPETT*
Ga0066704_1092225333300005557SoilRSADKAQYWDLFTTFYRNLIEMPADHLPHTFVEAFAAAYRECLKKPSP*
Ga0068854_10161184513300005578Corn RhizosphereFYRNLIEMPADHLPHTFVEAFAAAYREALRKPHAPE*
Ga0068864_10147640513300005618Switchgrass RhizosphereYWELYGEFYRNLVEKPAELLPHTFVEAFSLAYREFLRRPRD*
Ga0066903_10291982323300005764Tropical Forest SoilQYWDLFTTFYRNLIEMPEDHLPHTFVEAFATAYRECLKKTD*
Ga0066665_1007817453300006796SoilLFATFYRNLIEMPADHLPHTFVEAFAAAYRESSKKPPS*
Ga0079216_1075864413300006918Agricultural SoilKAQAWELYADFYRNLVEKPAEHLPHTFVEAFSIAYREFVKKKPG*
Ga0105250_1038910023300009092Switchgrass RhizosphereQYWELYQEFYRSLIEMPVDHLPHTFVEAFGRAYRGAMKKPAS*
Ga0105240_1046411413300009093Corn RhizosphereLFTTFYRNLIEMPEDHLPHTFVEAFAAAYKEYVKKPLP*
Ga0105240_1266456123300009093Corn RhizosphereSADKEQYWEMFTTFYRNLIEMPADHLPHTFVEAFAAAYREYLRKAAEKT*
Ga0105237_1236210223300009545Corn RhizosphereFYRNLIEMPEDHLPHTFVEAFAAAYKEYVKKPLP*
Ga0126384_1098304813300010046Tropical Forest SoilWELFTTFYRNLIEMPADHLPHTFVEAFAAAYREALKKKPDS*
Ga0126384_1159610813300010046Tropical Forest SoilWELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ*
Ga0126373_1115830713300010048Tropical Forest SoilTTFYRNLIEMPADHLPHTFVEAYAAAYREAVKKK*
Ga0134084_1013145213300010322Grasslands SoilRSADKAQYWDLFTSFYRNLIEMPAEHLPHTFVEAFAAAYREALKKPPA*
Ga0134125_1294633923300010371Terrestrial SoilRGKARSADKAQYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYCEAVKKK*
Ga0134128_1035003713300010373Terrestrial SoilYWELFTTFYRNLIEMPADHLPHTFVEAFATAYREAVKKKP*
Ga0134128_1126326423300010373Terrestrial SoilVKHWELYGEFYKNLVEKPAELLPHTFVEAFSLAYREFMQKPKD*
Ga0134128_1306931223300010373Terrestrial SoilWELFTTFYRNLIEMPADHLPHTFVEAFATAYREAVKKKP*
Ga0105239_1017021433300010375Corn RhizosphereWELFTTFYRNLIEMPEDHLPHTFVEAFAAAYKEYVKKPLP*
Ga0105239_1051643423300010375Corn RhizosphereWELFITFYRNLIEMPADHLPHTFVEAFAASYRESIRKAAEKN*
Ga0134126_1000912713300010396Terrestrial SoilADKAQYWELFTTFYRNLIEMPADHLPHTFVEAFAATYREAVKKK*
Ga0134126_1084897913300010396Terrestrial SoilRSADKAQYWDLFTTFYRNLIEMPADHLPHTFVEAFATAYREFFKQNPPQR*
Ga0134123_1077292313300010403Terrestrial SoilAWELYADFYLNLVEKPAEHMPHTFVEAFSLAYREYLKKKPG*
Ga0137370_1002773713300012285Vadose Zone SoilAQYWELFATFYRNLIEMPADHLPHTFVEAFAAAYRESSKKPPS*
Ga0137385_1133849313300012359Vadose Zone SoilYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYKEYVKKPLP*
Ga0137416_1190846713300012927Vadose Zone SoilADKAQYWDLFTTFYRNLIEMPADHLPHTFVEAFAAAYKEYVKKPLP*
Ga0137416_1223144813300012927Vadose Zone SoilQYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYKEYVKKPLP*
Ga0137404_1168394623300012929Vadose Zone SoilRSADKAQYWDLFTTFYRNLIEMPADHLPHTFVEAFAAAYKEYVKKVP*
Ga0157373_1097202823300013100Corn RhizosphereGKAKADKSQYWDLFTTFYRNLIEMPEDHLPHTFVEAFATAYRDFLKKTQP*
Ga0163162_1156791923300013306Switchgrass RhizosphereTTFYRNLIEMPADHLPHTFVEAFAAAYREYVKKPLP*
Ga0157375_1010745853300013308Miscanthus RhizosphereADTAQYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYREALRKPHAPE*
Ga0137403_1007548413300015264Vadose Zone SoilFYRNLIEMPADHLPHTFVEAFAAAYKEYVKKPLP*
Ga0137403_1048322413300015264Vadose Zone SoilDLFTSFYRNLIEMPADHLPHTFVEAFAAAYRDFLKKPSP*
Ga0182035_1146073513300016341SoilLFATFSRNLIEMPADHLPHLFVGAFAAAYREALNK
Ga0187821_1012196513300017936Freshwater SedimentAQYWELFTTFYRNLIEMPADHLPHTFVEAFSAAYREALKKKPES
Ga0187778_1016975833300017961Tropical PeatlandTFYRNLLDARADTLPQTFVEAFATAYREALKKSTEKPPE
Ga0187776_1006265913300017966Tropical PeatlandQYWELFITFYRNLIEMPADHLPHTFVEAFGAAYREAMKKPES
Ga0187784_1138197113300018062Tropical PeatlandRSADKAQYWELFTTFYRNLIEMPADHLPHTFVEAFASAYREALKKPPST
Ga0210395_1002059973300020582SoilTADKAQYWELFTTFYRNLIEMPADHLPHTFVEAFAAMYREVLRKPVT
Ga0179584_128431333300021151Vadose Zone SoilARSADKAQYWDLFTSFYRNLIEMPAEHLPHTFVEAFAAAYREVLKKPAS
Ga0210405_1029971533300021171SoilYRNLIEMPADHLPHTFVEALATAYREALKKQSSETT
Ga0210405_1030809213300021171SoilWELFTTFYRNLIEMPADHLPHTFVEAFAAAYREVLRKPPVA
Ga0210385_1028480733300021402SoilRVADKSQYWALFTTFYRNLIEMPADHLPHTFVEAFAAAYREALKKPES
Ga0210385_1122126013300021402SoilDLFTTFYRNLIEMPADHLPHTFVEAFAAAYREYLKKAAEKP
Ga0210387_1015487613300021405SoilTDKAQYWELFTTFYRNLIEMPADHLPHTFVEAFGAAYREALKKPPA
Ga0210386_1156685813300021406SoilDKAQYWELFTTFYRNLIEMPADHLPHTFVEAFAAMYREVLRKPVT
Ga0210394_1067211613300021420SoilGKARAADKSQYWEMFTTFYRNLIEMPADHLPHTFVEAFAAAYREALKKPAA
Ga0187846_1022423223300021476BiofilmSADKAQYWELFANFYRNLIEMPADHLPHTFVEAFSSAYREALKKTES
Ga0209483_117261233300025862Arctic Peat SoilYAEFYRGLIEMPADHMPHTFVEAFANAYKEALKKPAP
Ga0207710_1016761113300025900Switchgrass RhizosphereRRGNTKPADRAQYWELYQEFYRSLIEMPVDHLPHTFVEAFAKAYREMAKKP
Ga0207680_1028313533300025903Switchgrass RhizosphereELFTTFYRNLIEMPEDHLPHTFVEAFAAAYKEYVKKPLP
Ga0207685_1031388833300025905Corn, Switchgrass And Miscanthus RhizosphereQYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYREALRKPHVPE
Ga0207685_1070324013300025905Corn, Switchgrass And Miscanthus RhizosphereYWELYTTFYRNLIEMPADHLPHTFVEAFAATYREALKKKPEP
Ga0207695_1064063023300025913Corn RhizosphereYWELFTTFYRNLIEMPADHLPHTFVEAFATAYREAVKKKP
Ga0207660_1001891133300025917Corn RhizosphereKSADKAQYWELFTTFYRNLIEMPADHLPHTFIEAFATAYRDFFKQTPPQR
Ga0207652_1030259823300025921Corn RhizosphereADKEQYWEMFTTFYRNLIEMPADHLPHTFVEAFAAAYREYLKKAAEKT
Ga0207694_1071667913300025924Corn RhizosphereMFTTFYRNLIEMPADHLPHTFVEAFAAAYREYLKKAAEKT
Ga0209159_116889933300026343SoilTFYRNLIEMPADHLPHTFVEAFAAAYRESSKKLPS
Ga0257157_109915713300026496SoilKARSADKAQYWDLFTTFYRNLIEMPAEHLPHTFVEAFAAAYREASKKPAS
Ga0209156_1012824333300026547SoilARSADKAQYWDLFTTFYRNLIEMPAEHLPHTFVEAFAAAYREALKKPAA
Ga0207630_10872913300026760SoilSADKAQYWELYTTFYRNLIEMPADHLPHTFVEAFAATYREALKKKPEP
Ga0207815_103833913300027014Tropical Forest SoilKAQYWELFISFYRNLIEMPADHLPHTFVEAFGAAYREALKTPEKPES
Ga0207947_100883313300027171Forest SoilTFYRNLIEMPADHLPHTFVEAFAAAYREYLKKAAEKP
Ga0208241_107768933300027297Forest SoilKAQYWELFVNFYRNLIEMPADHLPHTFVEAFSSAYREAMKKPES
Ga0209735_114742813300027562Forest SoilARSADKAQYWDLFTTFYRNLIEMPAEHLPHTFVEAFAAAYREASKKPAS
Ga0209388_116319233300027655Vadose Zone SoilKAQYWDLFTTFYRNLIEMPAEHLPHTFVEAFAAAYREASKKPT
Ga0209068_1062866713300027894WatershedsFTTFYRNLIEMPADHLPHTFVEAFAAAYREGLKKPEV
Ga0268265_1005192113300028380Switchgrass RhizosphereLSGGKAQYWELYGEFYRNLVEKPAELLPHTFVEAFSLAYREFLRKPRE
Ga0302235_1018998223300028877PalsaGYWDLYAEFYRSLIEMPADHLPHTHVEAFAKAYKDALKKPRP
Ga0311352_1077100313300029944PalsaAEFYRSLIEMPADHLPHTYVEAFAKAYKDALKKPAP
Ga0170834_11126731813300031057Forest SoilTFYRNLIEMPADHLPHTFVEAFATAYREAPKKQSSETT
Ga0170822_1007091923300031122Forest SoilELFTTFYRNLIEMPADHLPHTFVEAYAAAYREYLKKAAEKP
Ga0307509_1053995833300031507EctomycorrhizaYGDFYRNLVEKPAEHMPHTFVEAFSIAYREFIKKKPG
Ga0318516_1072449513300031543SoilELFTSFYRNLIEMPADHLPHTFVEAFAAAYREALKKPTQ
Ga0318571_1003471833300031549SoilKAQYWELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ
Ga0318571_1047325813300031549SoilYWELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT
Ga0318528_1058444123300031561SoilWELFTTFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ
Ga0318573_1027159213300031564SoilPARSADKAQYWELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT
Ga0318542_1025521533300031668SoilAQYWELFTTFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ
Ga0318574_1009252533300031680SoilQYWELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT
Ga0306917_1023168733300031719SoilADKAQYWELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ
Ga0318500_1001162053300031724SoilYWELFTTFYRNLIEMPADHLPHTFVEAFATAYREALKKQEHS
Ga0318500_1017232513300031724SoilAQYWDLFTAFYRNLIEMPADHLPHTFVEAFAAAYRDALKKPTQ
Ga0318502_1083199013300031747SoilKARSADKAQYWELFTTFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ
Ga0318494_1086184723300031751SoilYWDLFTRFYRNLIEMPADHLPHTFVEAFAAAYRDALKKPPQ
Ga0318509_1002154313300031768SoilADKSQYWELFTTFYRNLIEMPADHLPHTFVEAFATAYREALKKQEHS
Ga0318521_1005286713300031770SoilKAQYWELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT
Ga0318543_1049559333300031777SoilTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT
Ga0318498_1000964543300031778SoilLFTSFYRNLIEMPADHLPHTFVEAFAAAYREALKKPTQ
Ga0318552_1047192533300031782SoilFYRNLIEMPADHLPHTFVEAFATAYREALKKQPPETT
Ga0318565_1034346313300031799SoilDKGQYWELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ
Ga0318497_1061458013300031805SoilYWELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ
Ga0318568_1071988213300031819SoilYWELFITFYRNLIEMPADHLPATFVEAFAAAYREALKKPAS
Ga0318527_1013053313300031859SoilELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ
Ga0318495_1038769223300031860SoilYWELFTSFYRNLIEMPADHLPHTFVEAFAAAYREALKKPTQ
Ga0318522_1023740733300031894SoilYWDLFTAFYRNLIEMPADHLPHTFVEAFAAAYRDALKKPTQ
Ga0318551_1060747533300031896SoilSADKAQYWELFITFYRNLIEMPADHLPATFVEAFAAAYREALKKPAS
Ga0318520_1002309653300031897SoilSQYWELFTTFYRNLIEMPADHLPHTFVEAFATAYREALKKQEHS
Ga0310912_1140839313300031941SoilTTFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ
Ga0310910_1008989713300031946SoilDKAQYWDLFTAFYRNLIEMPADHLPHTFVEAFAAAYRDALKKPTQ
Ga0318530_1044878813300031959SoilRNLIEMPADHLPHTFVEAFATAYREALKKQPPETT
Ga0307479_1019730613300031962Hardwood Forest SoilYWELFVSFYRNLIEMPADHLPHTFVEAFSSAYREATKKTES
Ga0308176_1249347723300031996SoilLYADFYRNLVEKPAEHMPHTFVEAFSLAYREYLKKKPG
Ga0318563_1057934213300032009SoilADKAQYWELFTSFYRNLIEMPADHLPHTFVEAFAAAYREALKKPTQ
Ga0318549_1002194443300032041SoilWELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT
Ga0318549_1007065233300032041SoilDKAQYWELFTTFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ
Ga0318545_1002595133300032042SoilRGKARSADKAQYWELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT
Ga0318556_1069209423300032043SoilKARSADKAQYWELFTSFYRNLVEMPTDHLPHTFVEAFAAAYREALKKPTQ
Ga0318533_1019137913300032059SoilGKARSADKAQYWDLFTAFYRNLIEMPADHLPHTFVEAFAAAYRDALKKPTQ
Ga0318513_1037855713300032065SoilTFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ
Ga0335085_1166918113300032770SoilDKAQYWELFVNFYRNLIEMPADHLPHTFVEAFSAAYREAMKKQES
Ga0335079_1130594533300032783SoilELFVSFYRNLIEMPADHLPHTFIEAFGAAYREALKKPE
Ga0335081_1273057913300032892SoilEFYRNLTEMPQDHLPHTFVEAFATAYKKALQAQAPSNP
Ga0335072_1065303513300032898SoilWELFTTFYRNLIEMPADHLPHTFVEAFAAAYREAQKKPPAA
Ga0335083_1080001713300032954SoilFYRNLIEMPADHLPHTFVEAFASAYREYIRKAAEKS
Ga0335073_1203280313300033134SoilQYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYREALKKK
Ga0310811_1125079413300033475SoilYWEMFTTFYRNLIEMPADHLPHTFVEAFAAAYREHLKKAAEKT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.