| Basic Information | |
|---|---|
| Family ID | F073331 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 42 residues |
| Representative Sequence | YWELFTSFYRNLIEMPADHLPHTFVEAFAAAYREALKKPTQ |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 85.83 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.833 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.833 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (38.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.03% β-sheet: 0.00% Coil/Unstructured: 57.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00497 | SBP_bac_3 | 20.00 |
| PF01464 | SLT | 9.17 |
| PF01551 | Peptidase_M23 | 3.33 |
| PF06224 | HTH_42 | 2.50 |
| PF14437 | MafB19-deam | 2.50 |
| PF07715 | Plug | 1.67 |
| PF00801 | PKD | 1.67 |
| PF00563 | EAL | 1.67 |
| PF06532 | NrsF | 1.67 |
| PF00561 | Abhydrolase_1 | 0.83 |
| PF13557 | Phenol_MetA_deg | 0.83 |
| PF07759 | DUF1615 | 0.83 |
| PF08240 | ADH_N | 0.83 |
| PF01103 | Omp85 | 0.83 |
| PF02518 | HATPase_c | 0.83 |
| PF01066 | CDP-OH_P_transf | 0.83 |
| PF02016 | Peptidase_S66 | 0.83 |
| PF02798 | GST_N | 0.83 |
| PF07944 | Glyco_hydro_127 | 0.83 |
| PF01035 | DNA_binding_1 | 0.83 |
| PF08281 | Sigma70_r4_2 | 0.83 |
| PF13426 | PAS_9 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 2.50 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 1.67 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 1.67 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 1.67 |
| COG4944 | Uncharacterized conserved protein | Function unknown [S] | 1.67 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 1.67 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.83 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.83 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.83 |
| COG1619 | Muramoyltetrapeptide carboxypeptidase LdcA (peptidoglycan recycling) | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG3533 | Beta-L-arabinofuranosidase, GH127 family | Carbohydrate transport and metabolism [G] | 0.83 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.83 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.83 % |
| Unclassified | root | N/A | 4.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002853|draft_1018368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300005186|Ga0066676_10626464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 730 | Open in IMG/M |
| 3300005437|Ga0070710_10685969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 721 | Open in IMG/M |
| 3300005557|Ga0066704_10922253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 540 | Open in IMG/M |
| 3300005578|Ga0068854_101611845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300005618|Ga0068864_101476405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 683 | Open in IMG/M |
| 3300005764|Ga0066903_102919823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 927 | Open in IMG/M |
| 3300006796|Ga0066665_10078174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2369 | Open in IMG/M |
| 3300006918|Ga0079216_10758644 | Not Available | 704 | Open in IMG/M |
| 3300009092|Ga0105250_10389100 | Not Available | 616 | Open in IMG/M |
| 3300009093|Ga0105240_10464114 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300009093|Ga0105240_12664561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 516 | Open in IMG/M |
| 3300009545|Ga0105237_12362102 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010046|Ga0126384_10983048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 767 | Open in IMG/M |
| 3300010046|Ga0126384_11596108 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300010048|Ga0126373_11158307 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300010322|Ga0134084_10131452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 827 | Open in IMG/M |
| 3300010371|Ga0134125_12946339 | Not Available | 517 | Open in IMG/M |
| 3300010373|Ga0134128_10350037 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300010373|Ga0134128_11263264 | Not Available | 814 | Open in IMG/M |
| 3300010373|Ga0134128_13069312 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010375|Ga0105239_10170214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2435 | Open in IMG/M |
| 3300010375|Ga0105239_10516434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1359 | Open in IMG/M |
| 3300010396|Ga0134126_10009127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12497 | Open in IMG/M |
| 3300010396|Ga0134126_10848979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1030 | Open in IMG/M |
| 3300010403|Ga0134123_10772923 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300012285|Ga0137370_10027737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2912 | Open in IMG/M |
| 3300012359|Ga0137385_11338493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 579 | Open in IMG/M |
| 3300012927|Ga0137416_11908467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 544 | Open in IMG/M |
| 3300012927|Ga0137416_12231448 | Not Available | 503 | Open in IMG/M |
| 3300012929|Ga0137404_11683946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas → Solimonas marina | 589 | Open in IMG/M |
| 3300013100|Ga0157373_10972028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300013306|Ga0163162_11567919 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300013308|Ga0157375_10107458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2884 | Open in IMG/M |
| 3300015264|Ga0137403_10075484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter piechaudii | 3415 | Open in IMG/M |
| 3300015264|Ga0137403_10483224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1111 | Open in IMG/M |
| 3300016341|Ga0182035_11460735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300017936|Ga0187821_10121965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 971 | Open in IMG/M |
| 3300017961|Ga0187778_10169758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1382 | Open in IMG/M |
| 3300017966|Ga0187776_10062659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2139 | Open in IMG/M |
| 3300018062|Ga0187784_11381971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300020582|Ga0210395_10020599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4853 | Open in IMG/M |
| 3300021151|Ga0179584_1284313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 611 | Open in IMG/M |
| 3300021171|Ga0210405_10299715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1270 | Open in IMG/M |
| 3300021171|Ga0210405_10308092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1251 | Open in IMG/M |
| 3300021402|Ga0210385_10284807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1222 | Open in IMG/M |
| 3300021402|Ga0210385_11221260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 577 | Open in IMG/M |
| 3300021405|Ga0210387_10154876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1963 | Open in IMG/M |
| 3300021406|Ga0210386_11566858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 547 | Open in IMG/M |
| 3300021420|Ga0210394_10672116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 908 | Open in IMG/M |
| 3300021476|Ga0187846_10224232 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300025862|Ga0209483_1172612 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300025900|Ga0207710_10167611 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300025903|Ga0207680_10283135 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300025905|Ga0207685_10313888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 780 | Open in IMG/M |
| 3300025905|Ga0207685_10703240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 550 | Open in IMG/M |
| 3300025913|Ga0207695_10640630 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300025917|Ga0207660_10018911 | All Organisms → cellular organisms → Bacteria | 4600 | Open in IMG/M |
| 3300025921|Ga0207652_10302598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1443 | Open in IMG/M |
| 3300025924|Ga0207694_10716679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 844 | Open in IMG/M |
| 3300026343|Ga0209159_1168899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 804 | Open in IMG/M |
| 3300026496|Ga0257157_1099157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 510 | Open in IMG/M |
| 3300026547|Ga0209156_10128243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1239 | Open in IMG/M |
| 3300026760|Ga0207630_108729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 503 | Open in IMG/M |
| 3300027014|Ga0207815_1038339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 580 | Open in IMG/M |
| 3300027171|Ga0207947_1008833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 682 | Open in IMG/M |
| 3300027297|Ga0208241_1077689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 532 | Open in IMG/M |
| 3300027562|Ga0209735_1147428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300027655|Ga0209388_1163192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 627 | Open in IMG/M |
| 3300027894|Ga0209068_10628667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 626 | Open in IMG/M |
| 3300028380|Ga0268265_10051921 | All Organisms → cellular organisms → Bacteria | 3098 | Open in IMG/M |
| 3300028877|Ga0302235_10189982 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300029944|Ga0311352_10771003 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300031057|Ga0170834_111267318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 554 | Open in IMG/M |
| 3300031122|Ga0170822_10070919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 570 | Open in IMG/M |
| 3300031507|Ga0307509_10539958 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300031543|Ga0318516_10724495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 564 | Open in IMG/M |
| 3300031549|Ga0318571_10034718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1426 | Open in IMG/M |
| 3300031549|Ga0318571_10473258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 500 | Open in IMG/M |
| 3300031561|Ga0318528_10584441 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031564|Ga0318573_10271592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 905 | Open in IMG/M |
| 3300031668|Ga0318542_10255215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 892 | Open in IMG/M |
| 3300031680|Ga0318574_10092525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1665 | Open in IMG/M |
| 3300031719|Ga0306917_10231687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1409 | Open in IMG/M |
| 3300031724|Ga0318500_10011620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3106 | Open in IMG/M |
| 3300031724|Ga0318500_10172325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1027 | Open in IMG/M |
| 3300031747|Ga0318502_10831990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 560 | Open in IMG/M |
| 3300031751|Ga0318494_10861847 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031768|Ga0318509_10021543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3024 | Open in IMG/M |
| 3300031770|Ga0318521_10052867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2103 | Open in IMG/M |
| 3300031777|Ga0318543_10495593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 547 | Open in IMG/M |
| 3300031778|Ga0318498_10009645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3843 | Open in IMG/M |
| 3300031782|Ga0318552_10471925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 640 | Open in IMG/M |
| 3300031799|Ga0318565_10343463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 724 | Open in IMG/M |
| 3300031805|Ga0318497_10614580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 609 | Open in IMG/M |
| 3300031819|Ga0318568_10719882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 620 | Open in IMG/M |
| 3300031859|Ga0318527_10130533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1046 | Open in IMG/M |
| 3300031860|Ga0318495_10387692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 616 | Open in IMG/M |
| 3300031894|Ga0318522_10237407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 691 | Open in IMG/M |
| 3300031896|Ga0318551_10607475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 631 | Open in IMG/M |
| 3300031897|Ga0318520_10023096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3000 | Open in IMG/M |
| 3300031941|Ga0310912_11408393 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031946|Ga0310910_10089897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2259 | Open in IMG/M |
| 3300031959|Ga0318530_10448788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300031962|Ga0307479_10197306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1982 | Open in IMG/M |
| 3300031996|Ga0308176_12493477 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300032009|Ga0318563_10579342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 605 | Open in IMG/M |
| 3300032041|Ga0318549_10021944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2428 | Open in IMG/M |
| 3300032041|Ga0318549_10070652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1481 | Open in IMG/M |
| 3300032042|Ga0318545_10025951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1894 | Open in IMG/M |
| 3300032043|Ga0318556_10692094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 530 | Open in IMG/M |
| 3300032059|Ga0318533_10191379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1462 | Open in IMG/M |
| 3300032065|Ga0318513_10378557 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300032770|Ga0335085_11669181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 657 | Open in IMG/M |
| 3300032783|Ga0335079_11305945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 724 | Open in IMG/M |
| 3300032892|Ga0335081_12730579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium TMPK1 | 503 | Open in IMG/M |
| 3300032898|Ga0335072_10653035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1042 | Open in IMG/M |
| 3300032954|Ga0335083_10800017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 756 | Open in IMG/M |
| 3300033134|Ga0335073_12032803 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300033475|Ga0310811_11250794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 601 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Hydrocarbon Resource Environments | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002853 | PDIso9.ppmwps2 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026760 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-B (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027171 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| draft_10183683 | 3300002853 | Hydrocarbon Resource Environments | DKAQYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYREAMKKSPG* |
| Ga0066676_106264641 | 3300005186 | Soil | SADKSQYWDLFTTFYRNLIEMPAEHLPHTFVEAFAAAYREALKKPAS* |
| Ga0070710_106859691 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ELFTTFYRNLIEMPADHLPHTFVEAFATAYREALKKQPPETT* |
| Ga0066704_109222533 | 3300005557 | Soil | RSADKAQYWDLFTTFYRNLIEMPADHLPHTFVEAFAAAYRECLKKPSP* |
| Ga0068854_1016118451 | 3300005578 | Corn Rhizosphere | FYRNLIEMPADHLPHTFVEAFAAAYREALRKPHAPE* |
| Ga0068864_1014764051 | 3300005618 | Switchgrass Rhizosphere | YWELYGEFYRNLVEKPAELLPHTFVEAFSLAYREFLRRPRD* |
| Ga0066903_1029198232 | 3300005764 | Tropical Forest Soil | QYWDLFTTFYRNLIEMPEDHLPHTFVEAFATAYRECLKKTD* |
| Ga0066665_100781745 | 3300006796 | Soil | LFATFYRNLIEMPADHLPHTFVEAFAAAYRESSKKPPS* |
| Ga0079216_107586441 | 3300006918 | Agricultural Soil | KAQAWELYADFYRNLVEKPAEHLPHTFVEAFSIAYREFVKKKPG* |
| Ga0105250_103891002 | 3300009092 | Switchgrass Rhizosphere | QYWELYQEFYRSLIEMPVDHLPHTFVEAFGRAYRGAMKKPAS* |
| Ga0105240_104641141 | 3300009093 | Corn Rhizosphere | LFTTFYRNLIEMPEDHLPHTFVEAFAAAYKEYVKKPLP* |
| Ga0105240_126645612 | 3300009093 | Corn Rhizosphere | SADKEQYWEMFTTFYRNLIEMPADHLPHTFVEAFAAAYREYLRKAAEKT* |
| Ga0105237_123621022 | 3300009545 | Corn Rhizosphere | FYRNLIEMPEDHLPHTFVEAFAAAYKEYVKKPLP* |
| Ga0126384_109830481 | 3300010046 | Tropical Forest Soil | WELFTTFYRNLIEMPADHLPHTFVEAFAAAYREALKKKPDS* |
| Ga0126384_115961081 | 3300010046 | Tropical Forest Soil | WELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ* |
| Ga0126373_111583071 | 3300010048 | Tropical Forest Soil | TTFYRNLIEMPADHLPHTFVEAYAAAYREAVKKK* |
| Ga0134084_101314521 | 3300010322 | Grasslands Soil | RSADKAQYWDLFTSFYRNLIEMPAEHLPHTFVEAFAAAYREALKKPPA* |
| Ga0134125_129463392 | 3300010371 | Terrestrial Soil | RGKARSADKAQYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYCEAVKKK* |
| Ga0134128_103500371 | 3300010373 | Terrestrial Soil | YWELFTTFYRNLIEMPADHLPHTFVEAFATAYREAVKKKP* |
| Ga0134128_112632642 | 3300010373 | Terrestrial Soil | VKHWELYGEFYKNLVEKPAELLPHTFVEAFSLAYREFMQKPKD* |
| Ga0134128_130693122 | 3300010373 | Terrestrial Soil | WELFTTFYRNLIEMPADHLPHTFVEAFATAYREAVKKKP* |
| Ga0105239_101702143 | 3300010375 | Corn Rhizosphere | WELFTTFYRNLIEMPEDHLPHTFVEAFAAAYKEYVKKPLP* |
| Ga0105239_105164342 | 3300010375 | Corn Rhizosphere | WELFITFYRNLIEMPADHLPHTFVEAFAASYRESIRKAAEKN* |
| Ga0134126_100091271 | 3300010396 | Terrestrial Soil | ADKAQYWELFTTFYRNLIEMPADHLPHTFVEAFAATYREAVKKK* |
| Ga0134126_108489791 | 3300010396 | Terrestrial Soil | RSADKAQYWDLFTTFYRNLIEMPADHLPHTFVEAFATAYREFFKQNPPQR* |
| Ga0134123_107729231 | 3300010403 | Terrestrial Soil | AWELYADFYLNLVEKPAEHMPHTFVEAFSLAYREYLKKKPG* |
| Ga0137370_100277371 | 3300012285 | Vadose Zone Soil | AQYWELFATFYRNLIEMPADHLPHTFVEAFAAAYRESSKKPPS* |
| Ga0137385_113384931 | 3300012359 | Vadose Zone Soil | YWELFTTFYRNLIEMPADHLPHTFVEAFAAAYKEYVKKPLP* |
| Ga0137416_119084671 | 3300012927 | Vadose Zone Soil | ADKAQYWDLFTTFYRNLIEMPADHLPHTFVEAFAAAYKEYVKKPLP* |
| Ga0137416_122314481 | 3300012927 | Vadose Zone Soil | QYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYKEYVKKPLP* |
| Ga0137404_116839462 | 3300012929 | Vadose Zone Soil | RSADKAQYWDLFTTFYRNLIEMPADHLPHTFVEAFAAAYKEYVKKVP* |
| Ga0157373_109720282 | 3300013100 | Corn Rhizosphere | GKAKADKSQYWDLFTTFYRNLIEMPEDHLPHTFVEAFATAYRDFLKKTQP* |
| Ga0163162_115679192 | 3300013306 | Switchgrass Rhizosphere | TTFYRNLIEMPADHLPHTFVEAFAAAYREYVKKPLP* |
| Ga0157375_101074585 | 3300013308 | Miscanthus Rhizosphere | ADTAQYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYREALRKPHAPE* |
| Ga0137403_100754841 | 3300015264 | Vadose Zone Soil | FYRNLIEMPADHLPHTFVEAFAAAYKEYVKKPLP* |
| Ga0137403_104832241 | 3300015264 | Vadose Zone Soil | DLFTSFYRNLIEMPADHLPHTFVEAFAAAYRDFLKKPSP* |
| Ga0182035_114607351 | 3300016341 | Soil | LFATFSRNLIEMPADHLPHLFVGAFAAAYREALNK |
| Ga0187821_101219651 | 3300017936 | Freshwater Sediment | AQYWELFTTFYRNLIEMPADHLPHTFVEAFSAAYREALKKKPES |
| Ga0187778_101697583 | 3300017961 | Tropical Peatland | TFYRNLLDARADTLPQTFVEAFATAYREALKKSTEKPPE |
| Ga0187776_100626591 | 3300017966 | Tropical Peatland | QYWELFITFYRNLIEMPADHLPHTFVEAFGAAYREAMKKPES |
| Ga0187784_113819711 | 3300018062 | Tropical Peatland | RSADKAQYWELFTTFYRNLIEMPADHLPHTFVEAFASAYREALKKPPST |
| Ga0210395_100205997 | 3300020582 | Soil | TADKAQYWELFTTFYRNLIEMPADHLPHTFVEAFAAMYREVLRKPVT |
| Ga0179584_12843133 | 3300021151 | Vadose Zone Soil | ARSADKAQYWDLFTSFYRNLIEMPAEHLPHTFVEAFAAAYREVLKKPAS |
| Ga0210405_102997153 | 3300021171 | Soil | YRNLIEMPADHLPHTFVEALATAYREALKKQSSETT |
| Ga0210405_103080921 | 3300021171 | Soil | WELFTTFYRNLIEMPADHLPHTFVEAFAAAYREVLRKPPVA |
| Ga0210385_102848073 | 3300021402 | Soil | RVADKSQYWALFTTFYRNLIEMPADHLPHTFVEAFAAAYREALKKPES |
| Ga0210385_112212601 | 3300021402 | Soil | DLFTTFYRNLIEMPADHLPHTFVEAFAAAYREYLKKAAEKP |
| Ga0210387_101548761 | 3300021405 | Soil | TDKAQYWELFTTFYRNLIEMPADHLPHTFVEAFGAAYREALKKPPA |
| Ga0210386_115668581 | 3300021406 | Soil | DKAQYWELFTTFYRNLIEMPADHLPHTFVEAFAAMYREVLRKPVT |
| Ga0210394_106721161 | 3300021420 | Soil | GKARAADKSQYWEMFTTFYRNLIEMPADHLPHTFVEAFAAAYREALKKPAA |
| Ga0187846_102242322 | 3300021476 | Biofilm | SADKAQYWELFANFYRNLIEMPADHLPHTFVEAFSSAYREALKKTES |
| Ga0209483_11726123 | 3300025862 | Arctic Peat Soil | YAEFYRGLIEMPADHMPHTFVEAFANAYKEALKKPAP |
| Ga0207710_101676111 | 3300025900 | Switchgrass Rhizosphere | RRGNTKPADRAQYWELYQEFYRSLIEMPVDHLPHTFVEAFAKAYREMAKKP |
| Ga0207680_102831353 | 3300025903 | Switchgrass Rhizosphere | ELFTTFYRNLIEMPEDHLPHTFVEAFAAAYKEYVKKPLP |
| Ga0207685_103138883 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | QYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYREALRKPHVPE |
| Ga0207685_107032401 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | YWELYTTFYRNLIEMPADHLPHTFVEAFAATYREALKKKPEP |
| Ga0207695_106406302 | 3300025913 | Corn Rhizosphere | YWELFTTFYRNLIEMPADHLPHTFVEAFATAYREAVKKKP |
| Ga0207660_100189113 | 3300025917 | Corn Rhizosphere | KSADKAQYWELFTTFYRNLIEMPADHLPHTFIEAFATAYRDFFKQTPPQR |
| Ga0207652_103025982 | 3300025921 | Corn Rhizosphere | ADKEQYWEMFTTFYRNLIEMPADHLPHTFVEAFAAAYREYLKKAAEKT |
| Ga0207694_107166791 | 3300025924 | Corn Rhizosphere | MFTTFYRNLIEMPADHLPHTFVEAFAAAYREYLKKAAEKT |
| Ga0209159_11688993 | 3300026343 | Soil | TFYRNLIEMPADHLPHTFVEAFAAAYRESSKKLPS |
| Ga0257157_10991571 | 3300026496 | Soil | KARSADKAQYWDLFTTFYRNLIEMPAEHLPHTFVEAFAAAYREASKKPAS |
| Ga0209156_101282433 | 3300026547 | Soil | ARSADKAQYWDLFTTFYRNLIEMPAEHLPHTFVEAFAAAYREALKKPAA |
| Ga0207630_1087291 | 3300026760 | Soil | SADKAQYWELYTTFYRNLIEMPADHLPHTFVEAFAATYREALKKKPEP |
| Ga0207815_10383391 | 3300027014 | Tropical Forest Soil | KAQYWELFISFYRNLIEMPADHLPHTFVEAFGAAYREALKTPEKPES |
| Ga0207947_10088331 | 3300027171 | Forest Soil | TFYRNLIEMPADHLPHTFVEAFAAAYREYLKKAAEKP |
| Ga0208241_10776893 | 3300027297 | Forest Soil | KAQYWELFVNFYRNLIEMPADHLPHTFVEAFSSAYREAMKKPES |
| Ga0209735_11474281 | 3300027562 | Forest Soil | ARSADKAQYWDLFTTFYRNLIEMPAEHLPHTFVEAFAAAYREASKKPAS |
| Ga0209388_11631923 | 3300027655 | Vadose Zone Soil | KAQYWDLFTTFYRNLIEMPAEHLPHTFVEAFAAAYREASKKPT |
| Ga0209068_106286671 | 3300027894 | Watersheds | FTTFYRNLIEMPADHLPHTFVEAFAAAYREGLKKPEV |
| Ga0268265_100519211 | 3300028380 | Switchgrass Rhizosphere | LSGGKAQYWELYGEFYRNLVEKPAELLPHTFVEAFSLAYREFLRKPRE |
| Ga0302235_101899822 | 3300028877 | Palsa | GYWDLYAEFYRSLIEMPADHLPHTHVEAFAKAYKDALKKPRP |
| Ga0311352_107710031 | 3300029944 | Palsa | AEFYRSLIEMPADHLPHTYVEAFAKAYKDALKKPAP |
| Ga0170834_1112673181 | 3300031057 | Forest Soil | TFYRNLIEMPADHLPHTFVEAFATAYREAPKKQSSETT |
| Ga0170822_100709192 | 3300031122 | Forest Soil | ELFTTFYRNLIEMPADHLPHTFVEAYAAAYREYLKKAAEKP |
| Ga0307509_105399583 | 3300031507 | Ectomycorrhiza | YGDFYRNLVEKPAEHMPHTFVEAFSIAYREFIKKKPG |
| Ga0318516_107244951 | 3300031543 | Soil | ELFTSFYRNLIEMPADHLPHTFVEAFAAAYREALKKPTQ |
| Ga0318571_100347183 | 3300031549 | Soil | KAQYWELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ |
| Ga0318571_104732581 | 3300031549 | Soil | YWELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT |
| Ga0318528_105844412 | 3300031561 | Soil | WELFTTFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ |
| Ga0318573_102715921 | 3300031564 | Soil | PARSADKAQYWELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT |
| Ga0318542_102552153 | 3300031668 | Soil | AQYWELFTTFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ |
| Ga0318574_100925253 | 3300031680 | Soil | QYWELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT |
| Ga0306917_102316873 | 3300031719 | Soil | ADKAQYWELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ |
| Ga0318500_100116205 | 3300031724 | Soil | YWELFTTFYRNLIEMPADHLPHTFVEAFATAYREALKKQEHS |
| Ga0318500_101723251 | 3300031724 | Soil | AQYWDLFTAFYRNLIEMPADHLPHTFVEAFAAAYRDALKKPTQ |
| Ga0318502_108319901 | 3300031747 | Soil | KARSADKAQYWELFTTFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ |
| Ga0318494_108618472 | 3300031751 | Soil | YWDLFTRFYRNLIEMPADHLPHTFVEAFAAAYRDALKKPPQ |
| Ga0318509_100215431 | 3300031768 | Soil | ADKSQYWELFTTFYRNLIEMPADHLPHTFVEAFATAYREALKKQEHS |
| Ga0318521_100528671 | 3300031770 | Soil | KAQYWELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT |
| Ga0318543_104955933 | 3300031777 | Soil | TTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT |
| Ga0318498_100096454 | 3300031778 | Soil | LFTSFYRNLIEMPADHLPHTFVEAFAAAYREALKKPTQ |
| Ga0318552_104719253 | 3300031782 | Soil | FYRNLIEMPADHLPHTFVEAFATAYREALKKQPPETT |
| Ga0318565_103434631 | 3300031799 | Soil | DKGQYWELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ |
| Ga0318497_106145801 | 3300031805 | Soil | YWELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ |
| Ga0318568_107198821 | 3300031819 | Soil | YWELFITFYRNLIEMPADHLPATFVEAFAAAYREALKKPAS |
| Ga0318527_101305331 | 3300031859 | Soil | ELFTSFYRNLIEMPTDHLPHTFVEAFAAAYREALKKPTQ |
| Ga0318495_103876922 | 3300031860 | Soil | YWELFTSFYRNLIEMPADHLPHTFVEAFAAAYREALKKPTQ |
| Ga0318522_102374073 | 3300031894 | Soil | YWDLFTAFYRNLIEMPADHLPHTFVEAFAAAYRDALKKPTQ |
| Ga0318551_106074753 | 3300031896 | Soil | SADKAQYWELFITFYRNLIEMPADHLPATFVEAFAAAYREALKKPAS |
| Ga0318520_100230965 | 3300031897 | Soil | SQYWELFTTFYRNLIEMPADHLPHTFVEAFATAYREALKKQEHS |
| Ga0310912_114083931 | 3300031941 | Soil | TTFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ |
| Ga0310910_100898971 | 3300031946 | Soil | DKAQYWDLFTAFYRNLIEMPADHLPHTFVEAFAAAYRDALKKPTQ |
| Ga0318530_104487881 | 3300031959 | Soil | RNLIEMPADHLPHTFVEAFATAYREALKKQPPETT |
| Ga0307479_101973061 | 3300031962 | Hardwood Forest Soil | YWELFVSFYRNLIEMPADHLPHTFVEAFSSAYREATKKTES |
| Ga0308176_124934772 | 3300031996 | Soil | LYADFYRNLVEKPAEHMPHTFVEAFSLAYREYLKKKPG |
| Ga0318563_105793421 | 3300032009 | Soil | ADKAQYWELFTSFYRNLIEMPADHLPHTFVEAFAAAYREALKKPTQ |
| Ga0318549_100219444 | 3300032041 | Soil | WELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT |
| Ga0318549_100706523 | 3300032041 | Soil | DKAQYWELFTTFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ |
| Ga0318545_100259513 | 3300032042 | Soil | RGKARSADKAQYWELFTTFYRNLIEMPPDHLPHTFVEAFAAAYREALKKPT |
| Ga0318556_106920942 | 3300032043 | Soil | KARSADKAQYWELFTSFYRNLVEMPTDHLPHTFVEAFAAAYREALKKPTQ |
| Ga0318533_101913791 | 3300032059 | Soil | GKARSADKAQYWDLFTAFYRNLIEMPADHLPHTFVEAFAAAYRDALKKPTQ |
| Ga0318513_103785571 | 3300032065 | Soil | TFYRNLIEMPTDHLPHTFVEAFATAYREALKKPTQ |
| Ga0335085_116691811 | 3300032770 | Soil | DKAQYWELFVNFYRNLIEMPADHLPHTFVEAFSAAYREAMKKQES |
| Ga0335079_113059453 | 3300032783 | Soil | ELFVSFYRNLIEMPADHLPHTFIEAFGAAYREALKKPE |
| Ga0335081_127305791 | 3300032892 | Soil | EFYRNLTEMPQDHLPHTFVEAFATAYKKALQAQAPSNP |
| Ga0335072_106530351 | 3300032898 | Soil | WELFTTFYRNLIEMPADHLPHTFVEAFAAAYREAQKKPPAA |
| Ga0335083_108000171 | 3300032954 | Soil | FYRNLIEMPADHLPHTFVEAFASAYREYIRKAAEKS |
| Ga0335073_120328031 | 3300033134 | Soil | QYWELFTTFYRNLIEMPADHLPHTFVEAFAAAYREALKKK |
| Ga0310811_112507941 | 3300033475 | Soil | YWEMFTTFYRNLIEMPADHLPHTFVEAFAAAYREHLKKAAEKT |
| ⦗Top⦘ |