| Basic Information | |
|---|---|
| Family ID | F073002 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 40.00 % |
| % of genes near scaffold ends (potentially truncated) | 90.00 % |
| % of genes from short scaffolds (< 2000 bps) | 98.33 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (80.833 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (58.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (64.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.62% β-sheet: 0.00% Coil/Unstructured: 65.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00098 | zf-CCHC | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 80.83 % |
| All Organisms | root | All Organisms | 19.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005330|Ga0070690_101223645 | Not Available | 599 | Open in IMG/M |
| 3300005331|Ga0070670_100881767 | Not Available | 810 | Open in IMG/M |
| 3300005335|Ga0070666_11181955 | Not Available | 569 | Open in IMG/M |
| 3300005355|Ga0070671_101256606 | Not Available | 652 | Open in IMG/M |
| 3300005438|Ga0070701_10238069 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1093 | Open in IMG/M |
| 3300005445|Ga0070708_100654949 | Not Available | 989 | Open in IMG/M |
| 3300005445|Ga0070708_101534093 | Not Available | 620 | Open in IMG/M |
| 3300005466|Ga0070685_11241691 | Not Available | 567 | Open in IMG/M |
| 3300005467|Ga0070706_101134003 | Not Available | 719 | Open in IMG/M |
| 3300005615|Ga0070702_101595919 | Not Available | 539 | Open in IMG/M |
| 3300005719|Ga0068861_100209117 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1642 | Open in IMG/M |
| 3300005841|Ga0068863_100713140 | Not Available | 997 | Open in IMG/M |
| 3300005841|Ga0068863_100938419 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 866 | Open in IMG/M |
| 3300005843|Ga0068860_101326283 | Not Available | 740 | Open in IMG/M |
| 3300005843|Ga0068860_102451389 | Not Available | 541 | Open in IMG/M |
| 3300005844|Ga0068862_101277723 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 735 | Open in IMG/M |
| 3300009092|Ga0105250_10406015 | Not Available | 605 | Open in IMG/M |
| 3300009101|Ga0105247_11302198 | Not Available | 583 | Open in IMG/M |
| 3300009981|Ga0105133_100363 | Not Available | 1693 | Open in IMG/M |
| 3300009990|Ga0105132_128968 | Not Available | 585 | Open in IMG/M |
| 3300009990|Ga0105132_133288 | Not Available | 560 | Open in IMG/M |
| 3300009992|Ga0105120_1019895 | Not Available | 733 | Open in IMG/M |
| 3300009992|Ga0105120_1022309 | Not Available | 707 | Open in IMG/M |
| 3300009994|Ga0105126_1028958 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 643 | Open in IMG/M |
| 3300009995|Ga0105139_1055077 | Not Available | 709 | Open in IMG/M |
| 3300009995|Ga0105139_1078628 | Not Available | 619 | Open in IMG/M |
| 3300010396|Ga0134126_13097256 | Not Available | 501 | Open in IMG/M |
| 3300010401|Ga0134121_11203716 | Not Available | 757 | Open in IMG/M |
| 3300012949|Ga0153798_10254406 | Not Available | 589 | Open in IMG/M |
| 3300014325|Ga0163163_11565381 | Not Available | 720 | Open in IMG/M |
| 3300014325|Ga0163163_13298009 | Not Available | 503 | Open in IMG/M |
| 3300014326|Ga0157380_12776299 | Not Available | 556 | Open in IMG/M |
| 3300015270|Ga0182183_1084767 | Not Available | 522 | Open in IMG/M |
| 3300015278|Ga0182099_1064163 | Not Available | 524 | Open in IMG/M |
| 3300015301|Ga0182184_1061631 | Not Available | 597 | Open in IMG/M |
| 3300015306|Ga0182180_1042214 | Not Available | 672 | Open in IMG/M |
| 3300015310|Ga0182162_1039344 | Not Available | 768 | Open in IMG/M |
| 3300015310|Ga0182162_1072326 | Not Available | 625 | Open in IMG/M |
| 3300015310|Ga0182162_1095880 | Not Available | 564 | Open in IMG/M |
| 3300015311|Ga0182182_1012722 | Not Available | 1053 | Open in IMG/M |
| 3300015311|Ga0182182_1013976 | Not Available | 1025 | Open in IMG/M |
| 3300015311|Ga0182182_1014649 | Not Available | 1011 | Open in IMG/M |
| 3300015311|Ga0182182_1100284 | Not Available | 541 | Open in IMG/M |
| 3300015312|Ga0182168_1051116 | Not Available | 728 | Open in IMG/M |
| 3300015317|Ga0182136_1035410 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 829 | Open in IMG/M |
| 3300015319|Ga0182130_1108148 | Not Available | 551 | Open in IMG/M |
| 3300015320|Ga0182165_1064293 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 694 | Open in IMG/M |
| 3300015326|Ga0182166_1036197 | Not Available | 824 | Open in IMG/M |
| 3300015326|Ga0182166_1132199 | Not Available | 522 | Open in IMG/M |
| 3300015329|Ga0182135_1066726 | Not Available | 696 | Open in IMG/M |
| 3300015330|Ga0182152_1082909 | Not Available | 644 | Open in IMG/M |
| 3300015330|Ga0182152_1123568 | Not Available | 551 | Open in IMG/M |
| 3300015331|Ga0182131_1119260 | Not Available | 561 | Open in IMG/M |
| 3300015332|Ga0182117_1039328 | Not Available | 897 | Open in IMG/M |
| 3300015333|Ga0182147_1073134 | Not Available | 706 | Open in IMG/M |
| 3300015334|Ga0182132_1157460 | Not Available | 518 | Open in IMG/M |
| 3300015335|Ga0182116_1097143 | Not Available | 655 | Open in IMG/M |
| 3300015335|Ga0182116_1160909 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 529 | Open in IMG/M |
| 3300015335|Ga0182116_1162649 | Not Available | 526 | Open in IMG/M |
| 3300015336|Ga0182150_1157392 | Not Available | 514 | Open in IMG/M |
| 3300015337|Ga0182151_1112692 | Not Available | 590 | Open in IMG/M |
| 3300015338|Ga0182137_1076155 | Not Available | 721 | Open in IMG/M |
| 3300015339|Ga0182149_1152997 | Not Available | 531 | Open in IMG/M |
| 3300015340|Ga0182133_1149603 | Not Available | 562 | Open in IMG/M |
| 3300015349|Ga0182185_1198545 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 606 | Open in IMG/M |
| 3300015349|Ga0182185_1204823 | Not Available | 597 | Open in IMG/M |
| 3300015350|Ga0182163_1045666 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 1220 | Open in IMG/M |
| 3300015352|Ga0182169_1063476 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1136 | Open in IMG/M |
| 3300015352|Ga0182169_1243368 | Not Available | 585 | Open in IMG/M |
| 3300015353|Ga0182179_1122405 | Not Available | 794 | Open in IMG/M |
| 3300015353|Ga0182179_1192171 | Not Available | 648 | Open in IMG/M |
| 3300015354|Ga0182167_1043401 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1512 | Open in IMG/M |
| 3300015354|Ga0182167_1311967 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 556 | Open in IMG/M |
| 3300015354|Ga0182167_1314709 | Not Available | 553 | Open in IMG/M |
| 3300017408|Ga0182197_1084632 | Not Available | 628 | Open in IMG/M |
| 3300017412|Ga0182199_1101463 | Not Available | 662 | Open in IMG/M |
| 3300017412|Ga0182199_1129061 | Not Available | 604 | Open in IMG/M |
| 3300017412|Ga0182199_1155171 | Not Available | 562 | Open in IMG/M |
| 3300017414|Ga0182195_1166138 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 567 | Open in IMG/M |
| 3300017435|Ga0182194_1120749 | Not Available | 552 | Open in IMG/M |
| 3300017435|Ga0182194_1134389 | Not Available | 530 | Open in IMG/M |
| 3300017440|Ga0182214_1136570 | Not Available | 539 | Open in IMG/M |
| 3300017445|Ga0182198_1049574 | Not Available | 850 | Open in IMG/M |
| 3300017694|Ga0182211_1159671 | Not Available | 537 | Open in IMG/M |
| 3300020023|Ga0182178_1013863 | Not Available | 598 | Open in IMG/M |
| 3300025530|Ga0207866_1024636 | Not Available | 1038 | Open in IMG/M |
| 3300025961|Ga0207712_10663670 | Not Available | 907 | Open in IMG/M |
| 3300028049|Ga0268322_1057455 | Not Available | 500 | Open in IMG/M |
| 3300028050|Ga0268328_1000209 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 2997 | Open in IMG/M |
| 3300028050|Ga0268328_1069660 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 508 | Open in IMG/M |
| 3300028051|Ga0268344_1005156 | Not Available | 816 | Open in IMG/M |
| 3300028056|Ga0268330_1004713 | Not Available | 1161 | Open in IMG/M |
| 3300028064|Ga0268340_1022573 | Not Available | 802 | Open in IMG/M |
| 3300028141|Ga0268326_1013799 | Not Available | 510 | Open in IMG/M |
| 3300028144|Ga0268345_1005270 | Not Available | 826 | Open in IMG/M |
| 3300028153|Ga0268320_1019684 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 575 | Open in IMG/M |
| 3300028154|Ga0268341_1022911 | Not Available | 559 | Open in IMG/M |
| 3300028253|Ga0268316_1002496 | Not Available | 970 | Open in IMG/M |
| 3300028253|Ga0268316_1025401 | Not Available | 501 | Open in IMG/M |
| 3300028473|Ga0268319_1001869 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1080 | Open in IMG/M |
| 3300028474|Ga0268331_1000040 | Not Available | 4419 | Open in IMG/M |
| 3300028474|Ga0268331_1010405 | Not Available | 683 | Open in IMG/M |
| 3300028476|Ga0268329_1002139 | Not Available | 1038 | Open in IMG/M |
| 3300032466|Ga0214503_1201020 | Not Available | 620 | Open in IMG/M |
| 3300032468|Ga0214482_1078358 | Not Available | 632 | Open in IMG/M |
| 3300032469|Ga0214491_1012291 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 1776 | Open in IMG/M |
| 3300032490|Ga0214495_1151889 | Not Available | 512 | Open in IMG/M |
| 3300032589|Ga0214500_1053598 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 1115 | Open in IMG/M |
| 3300032761|Ga0314733_1079681 | Not Available | 623 | Open in IMG/M |
| 3300032792|Ga0314744_1098987 | Not Available | 551 | Open in IMG/M |
| 3300032914|Ga0314750_1114676 | Not Available | 628 | Open in IMG/M |
| 3300032915|Ga0314749_1011161 | Not Available | 1670 | Open in IMG/M |
| 3300032915|Ga0314749_1013736 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1553 | Open in IMG/M |
| 3300032916|Ga0314734_1107125 | Not Available | 546 | Open in IMG/M |
| 3300032934|Ga0314741_1028810 | Not Available | 1232 | Open in IMG/M |
| 3300033523|Ga0314768_1154328 | Not Available | 807 | Open in IMG/M |
| 3300033534|Ga0314757_1025081 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 1358 | Open in IMG/M |
| 3300033534|Ga0314757_1128852 | Not Available | 610 | Open in IMG/M |
| 3300033535|Ga0314759_1071399 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1065 | Open in IMG/M |
| 3300033538|Ga0314755_1105694 | Not Available | 715 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 58.33% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 13.33% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 6.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 0.83% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012949 | Switchgrass enrichment cultures co-assembly | Engineered | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025530 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-3-D (SPAdes) | Engineered | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032468 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032914 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033538 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070690_1012236452 | 3300005330 | Switchgrass Rhizosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVYSVS* |
| Ga0070670_1008817672 | 3300005331 | Switchgrass Rhizosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVCSVS* |
| Ga0070666_111819551 | 3300005335 | Switchgrass Rhizosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVCSV |
| Ga0070671_1012566061 | 3300005355 | Switchgrass Rhizosphere | MVRILSQLRESDLPVRDASRTLPSSSGLLEVLPIYQLLVDYIGSKVCSVS* |
| Ga0070701_102380691 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS* |
| Ga0070708_1006549492 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TLKFCNDAPTQGKKVRILSQLRESDLSVGDASRTLPSSSDLLEVLPIYQLSVDYIGSKVYSVS* |
| Ga0070708_1015340931 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVCSVS* |
| Ga0070685_112416911 | 3300005466 | Switchgrass Rhizosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLSVDYIGSKVYSVS* |
| Ga0070706_1011340031 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ILSQLREFDLPVGDASRTLPSSSGLLEVLPIYQLLVGYIGSKVYSVN* |
| Ga0070702_1015959191 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVYSVS* |
| Ga0068861_1002091171 | 3300005719 | Switchgrass Rhizosphere | KKVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLSVDYIGSKVYSVS* |
| Ga0068863_1007131401 | 3300005841 | Switchgrass Rhizosphere | LSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVCSVS* |
| Ga0068863_1009384191 | 3300005841 | Switchgrass Rhizosphere | GKKVRILSQLRESDLPVGDANRTLRSSSGLLELLPIY* |
| Ga0068860_1013262831 | 3300005843 | Switchgrass Rhizosphere | MVRILSQLRESDLPVGDASRTLSSSSGLLEVLPIYQLLVDYIRSKVYSVS* |
| Ga0068860_1024513891 | 3300005843 | Switchgrass Rhizosphere | LSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS* |
| Ga0068862_1012777231 | 3300005844 | Switchgrass Rhizosphere | LRESDLPVGDVSRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVN* |
| Ga0105250_104060151 | 3300009092 | Switchgrass Rhizosphere | AKVRILSQLRESDLPVGDASRTQPSSSGLLEVLPIYQLLVDYIGSKVYSVS* |
| Ga0105247_113021981 | 3300009101 | Switchgrass Rhizosphere | MVRILSQLRELDLPVGDASRTLPSSSGLLEVLPIYHLL |
| Ga0105133_1003631 | 3300009981 | Switchgrass Associated | VRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYHLLVGYIGSKVYSVN* |
| Ga0105132_1289681 | 3300009990 | Switchgrass Associated | MMHLREGKKVRILCQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS |
| Ga0105132_1332881 | 3300009990 | Switchgrass Associated | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDY |
| Ga0105120_10198951 | 3300009992 | Switchgrass Associated | MHLREGKMVRILSQLRELDLPVGDANRTWPSSSGLLEVLPIYQLLVDYIGSNIYSVS* |
| Ga0105120_10223091 | 3300009992 | Switchgrass Associated | SQLRESDLPVGDASRTLPSSNGILEVLPIYQLSVDYIGSKVYSVS* |
| Ga0105126_10289581 | 3300009994 | Switchgrass Associated | HLRQGKMVGILSQLRELNLPVGDANRTLPSSSGLLEVLPIYQRLVDYIGSKMYSVN* |
| Ga0105139_10550771 | 3300009995 | Switchgrass Associated | MLNQLREFDLSVGDANRTLSSSSGLLDVLPMYQLLVGYIGSKVTMNTISV* |
| Ga0105139_10786281 | 3300009995 | Switchgrass Associated | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQRLVDY |
| Ga0134126_130972561 | 3300010396 | Terrestrial Soil | MHLREGKKVRILSQLRESDLPVGDASRTLPSSSGLLDVLIIYQLLVDYIGSKVYSVS*GSLTFPS |
| Ga0134121_112037161 | 3300010401 | Terrestrial Soil | GKKVWILSQLRESDLPVGNASRMLPSSSGLLEVLPIYQLLVDYIGSKVYSVS* |
| Ga0153798_102544061 | 3300012949 | Switchgrass Degrading | MVRILNQLRESDLPVGDASRTLPSSSGLLEVLPIYQR |
| Ga0163163_115653811 | 3300014325 | Switchgrass Rhizosphere | MVRILSQLRESDLPVGDASRTLPSSSDLLEVLPIYQLLVGYIG |
| Ga0163163_132980091 | 3300014325 | Switchgrass Rhizosphere | SQLRESDLPVGDASQTLPSSSGLLEVLPIYQLLVDYIGSKLYSVS* |
| Ga0157380_127762991 | 3300014326 | Switchgrass Rhizosphere | MGRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLL |
| Ga0182183_10847671 | 3300015270 | Switchgrass Phyllosphere | MTHLREGKMVRILSQLRELDLPIGDASRTLPSSSGLLELLPIYQRLVDYIGSKVYSVS |
| Ga0182099_10641631 | 3300015278 | Switchgrass Phyllosphere | MTHLREGKMVRILSQLRELDLPVGDASRMLPSSSGLLEVLPIYQLLVDYIGSKVYLVS* |
| Ga0182184_10616311 | 3300015301 | Switchgrass Phyllosphere | MVRILSQLRELDLPVGDANRMLPSSSGLLEVLPIYQRFVDNIGSKMCS |
| Ga0182180_10422141 | 3300015306 | Switchgrass Phyllosphere | MLSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSK |
| Ga0182162_10393441 | 3300015310 | Switchgrass Phyllosphere | DLPVGDASRTLPSSSGLLEVLPIYQLLVGYIGSKVYSVS* |
| Ga0182162_10723261 | 3300015310 | Switchgrass Phyllosphere | MVRIHSQLRELDLPVGDASRMLPSSSGLLEVLPIYQQLVDYIGSKVYSVS |
| Ga0182162_10958802 | 3300015310 | Switchgrass Phyllosphere | VRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQRLVDYIGSKVYSVS* |
| Ga0182182_10127221 | 3300015311 | Switchgrass Phyllosphere | DLPVGDASRTLPSSSGLLEVLPIYQLLVGYIGSKVYSVN* |
| Ga0182182_10139762 | 3300015311 | Switchgrass Phyllosphere | VRILSQLRESDLPVGDASRTLPSSNDLLEVLPIYQLSVDYIGSKVYSVS* |
| Ga0182182_10146491 | 3300015311 | Switchgrass Phyllosphere | DLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS* |
| Ga0182182_11002841 | 3300015311 | Switchgrass Phyllosphere | MIRILSQLRELDLPVGDANRTLPSSSGLLEVLPIYQLLVDYIGSKV |
| Ga0182168_10511161 | 3300015312 | Switchgrass Phyllosphere | SQLRESDLPVGDASRTLPSSNGLLEVLPIYQLLVDYIGSKVYSVS* |
| Ga0182136_10354101 | 3300015317 | Switchgrass Phyllosphere | SQLRELDLLVGDANRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS* |
| Ga0182130_11081481 | 3300015319 | Switchgrass Phyllosphere | RILSQLREFDLPVGDASRTLPSSSGLLEVLPIYHSHLRRL* |
| Ga0182165_10642931 | 3300015320 | Switchgrass Phyllosphere | ILSQLRELDLLVGDANRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS* |
| Ga0182166_10361971 | 3300015326 | Switchgrass Phyllosphere | ILSQLREFDLPVGDASRTLPSSSGLLEVLPIYQLLVGYIGSKVYSVS* |
| Ga0182166_11321991 | 3300015326 | Switchgrass Phyllosphere | MVRILSQLRELDLPIGDASRTLPSSSGLLEVLPIYQLLVD |
| Ga0182135_10667261 | 3300015329 | Switchgrass Phyllosphere | PVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVCSVR* |
| Ga0182152_10829091 | 3300015330 | Switchgrass Phyllosphere | VRILSQLREFDLPVGDASRTLPSSSGLFEVLPIYQLLLDYIGSKVYSVS* |
| Ga0182152_11235681 | 3300015330 | Switchgrass Phyllosphere | GDASRTVPSSSGLLEVLPIYQLSVDYIMSKVYSVS* |
| Ga0182131_11192601 | 3300015331 | Switchgrass Phyllosphere | MVRILSQLRESDLPVVDASRTLSSSSGLFELLLIYKLSVDY |
| Ga0182117_10393282 | 3300015332 | Switchgrass Phyllosphere | HNHLREGKKVRILSQLRESDLPVGDASRTLPSRSGLLKVLPIYQLFVDYIRSKVYSVS* |
| Ga0182147_10731341 | 3300015333 | Switchgrass Phyllosphere | SQLRESDLPVGDASRTLPSSSGLLEVLPIYKLLVDYIRSKVYSVS* |
| Ga0182132_11574601 | 3300015334 | Switchgrass Phyllosphere | MVRIHNQLRELDLPISDASRMLPSSSGLLEVLPIYQLLVDYIGSKVYS |
| Ga0182116_10971431 | 3300015335 | Switchgrass Phyllosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQRLV |
| Ga0182116_11609091 | 3300015335 | Switchgrass Phyllosphere | GKMVRILSQLRELDLPVGDANRTLPSSSGLIEVLPIYQRLVDYIGSKINSVN* |
| Ga0182116_11626491 | 3300015335 | Switchgrass Phyllosphere | LLSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVD |
| Ga0182150_11573921 | 3300015336 | Switchgrass Phyllosphere | MVRILSQLRESDLPIGDASRTLPSSSGLLEVLPIYRLLVDYI |
| Ga0182151_11126921 | 3300015337 | Switchgrass Phyllosphere | MVRILSQLRDSDLLVCDANRTLSSSSGLLELLPIYQPS |
| Ga0182137_10761551 | 3300015338 | Switchgrass Phyllosphere | LLSQLRESDLPISDASRTLGSSSSLLELLPIFQLSVDYMW |
| Ga0182149_11529971 | 3300015339 | Switchgrass Phyllosphere | SDLPVGDASRTLPSSSGLLEVLPIYQLIVDYIGSKVYSVS* |
| Ga0182133_11496032 | 3300015340 | Switchgrass Phyllosphere | MVRILSQLRGSDLPVGDASRTLPSSSGLLEVLSIYQLLVGYIGS |
| Ga0182185_11985451 | 3300015349 | Switchgrass Phyllosphere | GKKVRILSQLRESNLPVGDASRTLPSSSGLLEVLSIYQLLVDYIRSKVYSVI* |
| Ga0182185_12048231 | 3300015349 | Switchgrass Phyllosphere | MVRILSQLREFDLPVDDASRTLPSSSGLLEVLPIYQLLVGYIG |
| Ga0182163_10456661 | 3300015350 | Switchgrass Phyllosphere | LRELELPVGDANRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS* |
| Ga0182169_10634762 | 3300015352 | Switchgrass Phyllosphere | MVRILSQLRELGLPVGDASRTLPSNSGLLEVLPIYQRIVDYIG |
| Ga0182169_12433681 | 3300015352 | Switchgrass Phyllosphere | MVRILSQLRELDLSVGDASRMLPSSSGLLEVLPIYQLLVDYIGSKVY |
| Ga0182179_11224051 | 3300015353 | Switchgrass Phyllosphere | LHLNIVSTRRREGMMLSQLREPDLPVGDASRTLRSSSGLLELLPIYQPSVDYMGS |
| Ga0182179_11921711 | 3300015353 | Switchgrass Phyllosphere | REFDLPVGDANRTLYSSSGLLDVLPMYQLLVGYIGSKVTMNTISV* |
| Ga0182167_10434011 | 3300015354 | Switchgrass Phyllosphere | TVRILSQLREFDLPVGDANQTLPLSSGLLEVLPIYQLLFDYIGSKIYSVN* |
| Ga0182167_13119671 | 3300015354 | Switchgrass Phyllosphere | SQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS* |
| Ga0182167_13147091 | 3300015354 | Switchgrass Phyllosphere | MVRILSQLRELDLSVGDASRMLPSSSGLLEVLPIYQLLVDYIGSK |
| Ga0182197_10846321 | 3300017408 | Switchgrass Phyllosphere | MTHLREGKMVRILGQLREIDLPIGDASRMLPSSSVLFEMLPIYQLLVDYIGSKVY |
| Ga0182199_11014631 | 3300017412 | Switchgrass Phyllosphere | MVRILSQLREFDLPVDDASRTLPSSSGLLEVLPIYQLLVGYI |
| Ga0182199_11290611 | 3300017412 | Switchgrass Phyllosphere | MVRIHNQLRELDLPISDASRTLPSSSGLLEVLPIYQLLVDYIGSKST |
| Ga0182199_11551711 | 3300017412 | Switchgrass Phyllosphere | DLPVGDASRTLPSSSGLLEVLPIYQLLVGYIGSKVYSVS |
| Ga0182195_11661381 | 3300017414 | Switchgrass Phyllosphere | QPRLIILGVNILSQLREIDLPVGDANRTLPSSSGLLEVLAIYQCVVDYIGSKIYSVN |
| Ga0182194_11207491 | 3300017435 | Switchgrass Phyllosphere | MVRILSQLRELDLPVGDASQTLPSSSGLLEVLPIYQLLVDYIGSKVYSV |
| Ga0182194_11343892 | 3300017435 | Switchgrass Phyllosphere | GKMVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVYSVN |
| Ga0182214_11365701 | 3300017440 | Switchgrass Phyllosphere | KMVRIVSQLRESDLPVGDASRTLPSSSGLLEVLPIY |
| Ga0182198_10495741 | 3300017445 | Switchgrass Phyllosphere | MVRILSQLRDSDLPVGDANRTLSSSSGLLELLPIYEPSVDYIGSNGF |
| Ga0182211_11596711 | 3300017694 | Switchgrass Phyllosphere | MLSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYTVS |
| Ga0182178_10138631 | 3300020023 | Switchgrass Phyllosphere | GKKVRILSQLRESDFPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVCSVR |
| Ga0207866_10246361 | 3300025530 | Ionic Liquid And High Solid Enriched | KVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVCSVS |
| Ga0207712_106636701 | 3300025961 | Switchgrass Rhizosphere | KVRILSQLRESDLPVGDASRTLPSSSDLLEVLPIYQLSVDYIGSKVYSVS |
| Ga0268322_10574551 | 3300028049 | Phyllosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIY |
| Ga0268328_10002093 | 3300028050 | Phyllosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVCSVS |
| Ga0268328_10696601 | 3300028050 | Phyllosphere | SDASRTLPSSSVLLEVLPIYQLLVDYIGSKVYSVS |
| Ga0268344_10051561 | 3300028051 | Phyllosphere | MVRILSQLREFDLPVDDASRTLPSSSGLLEVLPIYQ |
| Ga0268330_10047132 | 3300028056 | Phyllosphere | QLRESDLPVGDASRTLSSSNGLLEVLPIYQLSVDYIGSKEYSVS |
| Ga0268340_10225731 | 3300028064 | Phyllosphere | MHLRLGKKVRILNQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVY |
| Ga0268326_10137991 | 3300028141 | Phyllosphere | MVRILSQLREFDLPVDDASRTLPSSSGLLEVLPIY |
| Ga0268345_10052701 | 3300028144 | Phyllosphere | MVRILSQLSESDLPVGDASRTISSSSGLLELLPIYQPSVDYI |
| Ga0268320_10196841 | 3300028153 | Phyllosphere | QLREFDLPVGDASRTLPSSNGILEVLPIYQLSVAYIGSKVYSVS |
| Ga0268341_10229112 | 3300028154 | Phyllosphere | GDANRTLPSSSDLLEVLPIYQLSVDYIGSKVYSVS |
| Ga0268316_10024962 | 3300028253 | Phyllosphere | ISQLRESNLPVGDASRMLPSSSGLLEVLPIYQRLVDYIGSKVYSVS |
| Ga0268316_10254011 | 3300028253 | Phyllosphere | MVRILSQLRELDLPIGDASRTLPSSSGFLEVLPIYQLLV |
| Ga0268319_10018691 | 3300028473 | Phyllosphere | MILSQLRESDLPVGDASRTVPSSSGLLEVLPIYQLS |
| Ga0268331_10000406 | 3300028474 | Phyllosphere | QLRESDLPIGDASRTLPSSSDLLEVLPIYQLSVDYIGSKVYSVS |
| Ga0268331_10104051 | 3300028474 | Phyllosphere | MVRILSQLREFDLSVGDASRTLPSSSGLLEVLPIYQLLVGYIGSK |
| Ga0268329_10021392 | 3300028476 | Phyllosphere | KKVRILSQLRESDLPVGDASRTLPSSNDLLEVLPIYQLSVDYIGSKVYSVS |
| Ga0214503_12010201 | 3300032466 | Switchgrass Phyllosphere | MHLREGKMVRILSQLRELDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS |
| Ga0214482_10783581 | 3300032468 | Switchgrass Phyllosphere | SDLPVGDASRTLPSSSGLLEVLPIYQLSVDYIGSKVYSVS |
| Ga0214491_10122914 | 3300032469 | Switchgrass Phyllosphere | LSQLRESDLTVGDANRTLHSSSGLLELLLIYRPSVDYIGSKSTP |
| Ga0214495_11518891 | 3300032490 | Switchgrass Phyllosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYR |
| Ga0214500_10535981 | 3300032589 | Switchgrass Phyllosphere | ILSQLRESDLLVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS |
| Ga0314733_10796811 | 3300032761 | Switchgrass Phyllosphere | MHLREGKMVRILSQLRELDIPVGDASRTLPSSSGLLEVLPIY |
| Ga0314744_10989871 | 3300032792 | Switchgrass Phyllosphere | MHLREGKMVRILSQLRELDLPVGDASRTLPSSSGLLEVL |
| Ga0314750_11146763 | 3300032914 | Switchgrass Phyllosphere | KVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLSVDYIGSKVYSVS |
| Ga0314749_10111611 | 3300032915 | Switchgrass Phyllosphere | ESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVYSVS |
| Ga0314749_10137363 | 3300032915 | Switchgrass Phyllosphere | VRILSQLRESDLPVGDASRTLPSSSDLLEVLPIYQLLVGYIGSKVYSVN |
| Ga0314734_11071251 | 3300032916 | Switchgrass Phyllosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLV |
| Ga0314741_10288101 | 3300032934 | Switchgrass Phyllosphere | SQLRESDLPVGDASRTLPSSSGLLEVLPIYQLSVDYIGSKVYSVS |
| Ga0314768_11543281 | 3300033523 | Switchgrass Phyllosphere | LRESDLPVGDASRTLPSSSGLLEVLPIYQLSVGYNGSKVYSVS |
| Ga0314757_10250811 | 3300033534 | Switchgrass Phyllosphere | LPVGDASRTLPSSSVLLEVLPIYQLLVDYIGSKVYSVS |
| Ga0314757_11288521 | 3300033534 | Switchgrass Phyllosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQRLVDYIGSKV |
| Ga0314759_10713991 | 3300033535 | Switchgrass Phyllosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQ |
| Ga0314755_11056941 | 3300033538 | Switchgrass Phyllosphere | MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLFVDYVGSKVYSVSCGSLTFLSVM |
| ⦗Top⦘ |