NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072409

Metagenome / Metatranscriptome Family F072409

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072409
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 90 residues
Representative Sequence MRSMIMKYAAEEKTEDGAPSGNFFLNEASARAASAEVLGSHKGLKGADLKEYLATYFPRTWAHFDVNKSGFIGVEVMPQFVRFIASDQTLQL
Number of Associated Samples 84
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 31.62 %
% of genes near scaffold ends (potentially truncated) 25.62 %
% of genes from short scaffolds (< 2000 bps) 96.69 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.78

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.694 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(43.802 % of family members)
Environment Ontology (ENVO) Unclassified
(69.421 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(71.074 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.67%    β-sheet: 12.50%    Coil/Unstructured: 40.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.78
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.39.1.11: p25-alphad1wlma11wlm0.5886
a.39.1.9: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)d1ij5a_1ij50.57581
a.39.1.8: Penta-EF-hand proteinsd1y1xa_1y1x0.57464
a.39.1.2: S100 proteinsd1a4pa_1a4p0.5745
a.39.1.0: automated matchesd2n8za12n8z0.57316


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.69 %
UnclassifiedrootN/A3.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003701|Ga0005233J53080_1053004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300006356|Ga0075487_1027001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1144Open in IMG/M
3300006384|Ga0075516_1403342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium994Open in IMG/M
3300006393|Ga0075517_1507626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1124Open in IMG/M
3300007513|Ga0105019_1125619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1361Open in IMG/M
3300008832|Ga0103951_10425182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium710Open in IMG/M
3300008952|Ga0115651_1195946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1361Open in IMG/M
3300009269|Ga0103876_1035492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium666Open in IMG/M
3300009422|Ga0114998_10242265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium850Open in IMG/M
3300009432|Ga0115005_11473047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300009436|Ga0115008_11488426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300009441|Ga0115007_11022682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300009606|Ga0115102_10831993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium846Open in IMG/M
3300009677|Ga0115104_10030101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300009677|Ga0115104_10032273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1351Open in IMG/M
3300009677|Ga0115104_10226348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300009677|Ga0115104_11179021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1029Open in IMG/M
3300009785|Ga0115001_10522794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300010981|Ga0138316_10143186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1012Open in IMG/M
3300010981|Ga0138316_10655072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300010981|Ga0138316_10749530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300010987|Ga0138324_10452182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300012920|Ga0160423_10812690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium629Open in IMG/M
3300012953|Ga0163179_11782567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300018622|Ga0188862_1020776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300018639|Ga0192864_1065305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300018692|Ga0192944_1060237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300018730|Ga0192967_1051698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium688Open in IMG/M
3300018765|Ga0193031_1021409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium954Open in IMG/M
3300018765|Ga0193031_1021410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium954Open in IMG/M
3300018765|Ga0193031_1023901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium921Open in IMG/M
3300018871|Ga0192978_1010422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1560Open in IMG/M
3300018871|Ga0192978_1077441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300018873|Ga0193553_1101024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium735Open in IMG/M
3300018977|Ga0193353_10170073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300018977|Ga0193353_10253696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300018982|Ga0192947_10046591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1337Open in IMG/M
3300018982|Ga0192947_10060597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1203Open in IMG/M
3300018983|Ga0193017_10277613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300018989|Ga0193030_10030093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1280Open in IMG/M
3300018989|Ga0193030_10034355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1237Open in IMG/M
3300018989|Ga0193030_10035520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1227Open in IMG/M
3300018989|Ga0193030_10037231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1212Open in IMG/M
3300018989|Ga0193030_10137560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium783Open in IMG/M
3300018989|Ga0193030_10155873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium741Open in IMG/M
3300018989|Ga0193030_10192437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300018989|Ga0193030_10198408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300018989|Ga0193030_10203641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300019001|Ga0193034_10176744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300019031|Ga0193516_10147896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium794Open in IMG/M
3300019031|Ga0193516_10285524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300019032|Ga0192869_10043682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1449Open in IMG/M
3300019033|Ga0193037_10263276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300019050|Ga0192966_10233087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300019103|Ga0192946_1061867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300019149|Ga0188870_10027871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1289Open in IMG/M
3300021350|Ga0206692_1572877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300021355|Ga0206690_10100496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300021872|Ga0063132_103612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1341Open in IMG/M
3300021881|Ga0063117_1057620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300021885|Ga0063125_1016040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300021902|Ga0063086_1000616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1539Open in IMG/M
3300021902|Ga0063086_1000929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1052Open in IMG/M
3300021912|Ga0063133_1029331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1128Open in IMG/M
3300021922|Ga0063869_1069085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300021925|Ga0063096_1005841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1079Open in IMG/M
3300021941|Ga0063102_1026500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium963Open in IMG/M
3300021943|Ga0063094_1048382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1386Open in IMG/M
3300026462|Ga0247568_1127523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300026470|Ga0247599_1050215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium885Open in IMG/M
3300026495|Ga0247571_1122891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300026500|Ga0247592_1129633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300027810|Ga0209302_10535220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300027833|Ga0209092_10129720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1470Open in IMG/M
3300028134|Ga0256411_1121044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium879Open in IMG/M
3300028134|Ga0256411_1201447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300028134|Ga0256411_1249073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300028282|Ga0256413_1049997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1453Open in IMG/M
3300028282|Ga0256413_1209875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300028575|Ga0304731_10146567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1012Open in IMG/M
3300028575|Ga0304731_10252772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300028575|Ga0304731_11661681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300030670|Ga0307401_10503108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300030671|Ga0307403_10058042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1709Open in IMG/M
3300030709|Ga0307400_10770752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300030723|Ga0308129_1032240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300030780|Ga0073988_12340406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300030780|Ga0073988_12368216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium878Open in IMG/M
3300030912|Ga0073987_10000040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300030912|Ga0073987_11226409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium959Open in IMG/M
3300031062|Ga0073989_10007562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium736Open in IMG/M
3300031062|Ga0073989_13501711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium875Open in IMG/M
3300031580|Ga0308132_1138777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300031638|Ga0302125_10156501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300031710|Ga0307386_10124384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1167Open in IMG/M
3300031710|Ga0307386_10366704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium736Open in IMG/M
3300031710|Ga0307386_10390018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300031725|Ga0307381_10096040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium969Open in IMG/M
3300031725|Ga0307381_10126466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium860Open in IMG/M
3300031725|Ga0307381_10199829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300031725|Ga0307381_10313207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium567Open in IMG/M
3300031729|Ga0307391_10532024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300031734|Ga0307397_10316130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium711Open in IMG/M
3300031738|Ga0307384_10072929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1333Open in IMG/M
3300031738|Ga0307384_10075396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1316Open in IMG/M
3300031738|Ga0307384_10151580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium995Open in IMG/M
3300031739|Ga0307383_10315754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium758Open in IMG/M
3300032127|Ga0315305_1184393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300032518|Ga0314689_10200160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1029Open in IMG/M
3300032521|Ga0314680_10158225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1255Open in IMG/M
3300032521|Ga0314680_10380638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium874Open in IMG/M
3300032540|Ga0314682_10122833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1295Open in IMG/M
3300032616|Ga0314671_10495718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300032651|Ga0314685_10473719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300032707|Ga0314687_10306898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium864Open in IMG/M
3300032745|Ga0314704_10616685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300032746|Ga0314701_10382720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine43.80%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine29.75%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater7.44%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.44%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.31%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.65%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.65%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.83%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.83%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_150m_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007651Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018639Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000791 (ERX1782310-ERR1712181)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018983Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032127Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_Tmax_529 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0005233J53080_105300413300003701MarineMKYAAEEKTEDGAPSGNFFLNEASTRALASEVLGSHKGLKGGDLKEYLNTYFPRTWAHYDVNKTGFIGVEVAPQFMRFVASDQTLQF*
Ga0066831_1023169013300005516MarineDDLFMRSMIMKYALEGKNEDGSPNGAFFMDEPSTRAAAGEVLASHKSLKGGELDSYLKTYFARTWAHYDVNKAGMIGVEVMPVFMRFLASDQTLNLS*
Ga0075487_102700113300006356AqueousMRSMIMKYAAEEKTEDGAPSGNFFLNEASARRASAEVIGTYMGLAGADLKNYLETYFPRTWEHFDVNGSGFIGVEVMPQFARFICSDQTLQL*
Ga0075516_140334233300006384AqueousMRSMIMKYAAEEKTEDGAPSGNFFLNEASARRASAEVIGTHMGLAGADLKNYLETYFPRTWEHFDVNGSGFIGVEVMPQFARFICSDQ
Ga0075517_150762613300006393AqueousMRSMIMKYAAEEKTEDGAPSGNFFLNEASARRASAEVIGTHMGLAGADLKNYLETYFPRTWEHFDVNGSGFIGVEVMPQFARFICSDQTLQL*
Ga0105019_112561933300007513MarineMIMKYAAEEKTEDGAPNGNFFLNEASARAAATEVLGSHKGLKGGDLKEYVKTYFPRTWAHFDVNKSGMIGVEVMPQFVRFIASDQTLQL*
Ga0102900_114499313300007651EstuarinePSNFSQGTDDLFMRSMIMNYALEGKTKKGDPAGVFVMDEAAARRAAKEVIETHKGLTGADNKEYLDTYFPRTWNHFDVNKSGKVGVEMMPQFMRFLASDQTLQF*
Ga0103951_1042518213300008832MarineMRSVIMKYAAELKTEDGAPSGNFFLNEASTRALAAEVLGTHKGLKGADLKEYLSTYFPRTWAHYDVNKTGFIGVEVAPQFMRFVASDQTMQL*
Ga0115651_119594623300008952MarineMRSMIMKYAAEEKTEDGAPNGNFFLNEASARAAATEVLGSHKGLKGGDLKEYVKTYFPRTWAHFDVNKSGMIGVEVMPQFVRFIASDQTLQL*
Ga0103876_103549213300009269Surface Ocean WaterMRSMIMKYAAEEKTEEGTPSGKFFLNEASARAASAEVVGTHLGLSGSALKGYLETYFPRTWAHFDVNGSGYVGVEVM
Ga0114998_1024226523300009422MarineMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALATEVLATHKGLKGADLKEYVNTYFPRTWAHYDVNKTGMVGVEVAPQFMRFIASDQTLQL*
Ga0115005_1147304713300009432MarineIMKYAAEEKTEDGAPSGNFFLNEASTRALATEVLGTHKGLKGDDLKEYVKTYFPRTWAHYDVNKTGYVGVEVAPQFMRFVASDQTLQL*
Ga0115008_1148842623300009436MarineMRSMIMKYAAEEKTGDGAPSGNFFLNEASARAASTEVIGSHNALKGADLKEYIKTYFPRTWAHFDVNKTGYIGV
Ga0115007_1102268213300009441MarineMKYAAEEKTEDGAPSGNFFLNEASTRALATEVLGTHKGLKGEDLKEYVKTYFPRTWAHYDVNKTGMVGVEVAPQFMRFIASDQTL
Ga0115102_1083199323300009606MarineMRSMIMKYAAEEKTADGVPSGNFFLNEASARAAATEVVGSHLGLAGAELKSYISTYFPRTWAHFDVNGSGFIGVEVMPQLARFIASDQYMQLA*
Ga0115104_1003010113300009677MarineMIMKYAAEEKTEDGAPSGNFFLNEASARAASGEVLGSHKGLKGADLKEYLSTYFPRTWAHFDVNKSGFIGVEVMPQFVRFIASDQTLQL*
Ga0115104_1003227323300009677MarineMRSMIMKYAAEEKTDDGAPSGNFFLNEASARAAAGEVLGSHKGLAGADLKGYLDTYFPRTWAHFDVNKSGFIGVEVMP*
Ga0115104_1022634813300009677MarineMRSMIMKYAAEEKTEDGAPSGNFFLNEASAKAAATEVIASHLGLKGGDLKSYISTYFPRTWAHFDVNGSGFVGVEVMPQLARFIASDQTLQL*
Ga0115104_1117902123300009677MarineMRSMIMKYAAEEKTEDGVPSGNFFLNEASARRASSEVLASHKGLKGADLKGYLDTYFPRTWAHFDVNGAGMVGVEVMPQFVRFIASDQTLQL*
Ga0115001_1052279423300009785MarineMRSMIMKYAAEEKTEDGAPSGNFFLNEASARAAATEVVGTHNGLSGGALKAYVKEYFPRTWAHFDVNAAGMIGVEVMPQLVRMFASDQYMML*
Ga0138316_1014318623300010981MarineMRSMIMKYAAEEKTDDGAPSGNFFLNEASARAASSEVLASHKGLKGGDLKEYLATYFPRTWAHFDVNKSGFIGVEVMPQFVRFIASDQTLQL*
Ga0138316_1065507213300010981MarineTEDGAPNGNFFMNEASARAAASEVLGTHKGLKGKDLSEYVKTYFPRTWAHFDVNKTGMIGVEVMPQFMRFIASDQTLQL*
Ga0138316_1074953013300010981MarineMRSMIMKYAAEEKTDDGTPSGNFFLNEASARAASSEVISSHLGLKGGDLKQYLNTYFPRTWAHFDVNGAGMIGVEVMPQFARFIASDQTLQL*
Ga0138316_1161539413300010981MarineMRSMIMKYALEGKNEDGSPNGAFFMDEASTRAAAGEVLGSHKSLKGGELDSYLKTYFPRTWAHYDVNKAGMVGVETMPQFMRFLASDQTLNLS*
Ga0138324_1045218213300010987MarineMRSMIMKYAAEEKTEDGAPNGNFFMNEASARAACSEVLGTHKGLKGGDLKAYLSTYFPRTWAHFDVNKTGMIGVEVMPQFMRFIASDQTLQL*
Ga0160423_1081269013300012920Surface SeawaterMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALATEVLGTHKGLKGGDLKEYLATYFPRTWAHYDVNKTGYIGVEVAPQFMRFIASDQTMQL*
Ga0163179_1178256723300012953SeawaterAPSGNFFLNEASTRALATEVLGTHKGLKGADLKEYVKTYFPRTWAHYDVNKTGYIGVEVAPQFMRFIASDQTMQL*
Ga0188862_102077623300018622Freshwater LakeMRSMIMKYAAEEKTEDGAPSGNFFLNEASARAASAEVLGSHLNLAGADLKSYLSTYFPRTWAHFDVNGSGFIGVEVMPQFVRFIASDQTLQL
Ga0192864_106530523300018639MarineMRSMIMKYAAEEKTEDGAPSGNFFLNEASARAAAGEVLSSHKGLKGADLKEYLATYFPRTWAHYDVNKSGFIGVEVMPQFVRFIASDQTLQL
Ga0192944_106023713300018692MarineMRVPPVRFSSDSDDLFMRSMIMKYAAEEKTDDGTPSGNFFLNEASARAASGEVLSSHKGLKGGDLKGYLDTYFPRTWAHFDVNGSGFIGVEVMPQ
Ga0192967_105169823300018730MarineMRVPPVRFASDSDDLFMRSMIMKYAAEEKTDEGTPSGNFFLNEASARAASGEVLSSHKGLKGGDLKGYLDTYFPRTWAHFDVNGSGFIGVEVMPQFARFIASDQTLQL
Ga0193031_102140923300018765MarineMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALASEVLGTHKGLKGADLKEYLSTYFPRTWAHYDVNKTGFIGVEVAPQFMRFVASDQTMQL
Ga0193031_102141023300018765MarineMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALATEVLGTHKGLKAGDLKEYVNTYFPRTWAHYDVNKTGYIGVEVAPQFMRFVASDQTMQL
Ga0193031_102390113300018765MarineMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALAAEVLGTHKGLKGGDLKEYLNTYFPRTWAHYDVNKTGFIGVEVAPQFMRFVSSDQTLQL
Ga0192978_101042223300018871MarineMRSMIMKYAAEEKTEDGAPSGNFYLNEASARAASTEVLASHKALKGADLKEYINTYFPRTWAHFDVNKSGFIGVETMPQFVRFVASDQTLQL
Ga0192978_107744123300018871MarineMRSMIMKYAAEEKTEDGAPSGAFFLNEASARAAATEVLGTHKGLKGADLKEYVKTYFPRTWAHFDVNHGGFIGVEVMP
Ga0193553_110102413300018873MarineMRSMIMKYAAEEKTEDGAPSGNFFMNEASARAACTEVLGSHKGLKGADLKEYVKTYFPRTWAHYDVNKSGMVGVEVMPQFVRFIASDQTLQL
Ga0193353_1017007323300018977MarineMRSMIMKYAAEEKTEDGAPSGNFFLNEASARAASTEVLGSHKGLKGADLKEYVATYFPRTWAHFDVNKSGFIGVEVMPQFVRFIASDQTLQL
Ga0193353_1025369613300018977MarinePPARFSADSDDLFMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALATEVLGTHKGLKGADLKEYVKTYFPRTWAHYDVNKTGYIGVEVAPQFMRFIASDQTLQL
Ga0192947_1004659113300018982MarineMRSMIMKYAAEEKTEDGAPSGAFFMNEASAKAAATEVVGTHLGLKGGDLKSYISTYFPRTWANFDVNGSGFIGVEVMPQLARFIASDQTLQL
Ga0192947_1006059723300018982MarineMRVPPVRFSSDSDDLFMRSMIMKYAAEEKTDDGTPSGNFFLNEASARAASGEVLSSHKGLKGGDLKGYLDTYFPRTWAHFDVNGSGFIGVEVMPQFARFIASDQTLQL
Ga0193017_1027761313300018983MarineDKTYERVPPENFSSDSDDLFMRSMIMKYAMEGKNEDESPNGAFFMDEASTRAASSEVLSSHKGLKGAELAEYMKTYFPRTWAHYDVNKAGHIGVEMMP
Ga0193030_1003009313300018989MarineMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALASEVLGTHKGLKGADLKEYLGTYFPRTWAHYDVNKTGFIGVEVAPQFMRFVASDQTLQL
Ga0193030_1003435513300018989MarineMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALASEVLGTHKGLKGADLKEYLGTYFPRTWAHYDVNKTGFIGVEVAPQFMRFVASDQTMQL
Ga0193030_1003552013300018989MarineMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALAAEVLGTHKGLKGGDLKEYLKTYFPRTWAHYDVNKTGFIGVEVAPQFMRFVASDQTMQL
Ga0193030_1003723113300018989MarineMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALATEVLGTHKGLKGGDLKEYISTYFPRTWAHYDVNKTGMIGVEVAPQFMRFIASDQTMQL
Ga0193030_1013756013300018989MarineMKYAAEEKTEDGAPSGNFFLNEASARAASAEVLGSHKGLKGGDLKEYLATYFPRTWAHFDVNKSGFIGVEVMPQFVRFIASDQTLQL
Ga0193030_1015587313300018989MarineMKYAAEEKTEDGAPSGNFFLNEASAKAAATEVIGTHLGLKGGDLKEYMSTYFPRTWAHFDVNGSGFIGVEVMPQLARFIASDQTLQL
Ga0193030_1019243713300018989MarineMRSMIMKYAAEEKTEDGAPSGNFFMNEASARAACSEVLASHKGLKGADLKEYVKTYFPRTWAHYDVNKTGYVGVEVMPQFVRFIASDQTL
Ga0193030_1019840813300018989MarineMRSMIMKYAAEEKTEDGAPSGAFFINEASARAAASEVLGTHKGLKGKDLKEYIATYFPRTFAHFDVNKTGMLGVEVMPQFMRFIASDQTLQL
Ga0193030_1020364123300018989MarineMRSMIMKYAAEEKTEDGAPSGAFFMNEASTRAAASEVLSTHKGLKGGDLKEYIKTYFPRTWAHFDVNKTGMIGVEVMPQFMRFVASDQTLQL
Ga0193034_1017674413300019001MarineERVPPENFSSDSDDLFMRSMIMKYAMEGKNEDESPNGAFAMDEASTRAAASEVLATHKGLKGAELAEYMKTYFPRTWAHYDVNKAGNIGVEMMP
Ga0193516_1014789613300019031MarineMRSMIMKYAAEEKTEDGAPSGAFFLNEASARAAATEVLGTHKGLKGADLKEYVKTYFPRTWAHFDVNKGGFIGVEVMPQFMRFIASDQTLQL
Ga0193516_1028552423300019031MarineMKSMIMKYAMESKDDDGAPTGAFFMDEAATRAAATEVLGTHKGLKGADLKDYVKTYFPRTWAHFDVNKGGVVGVEVMPQFMRFIASDQTLKLE
Ga0192869_1004368213300019032MarineMRSMIMKYAAEEKTDDGTPSGNFFLNEASARAASAEVLGSHKGLKGGDLKEYLSTYFPRTWAHFDVNKSGFIGVEVMPQFVRFIASDQTLQL
Ga0193037_1026327613300019033MarineMKYAAEEKTDDGAPNGNFFLNEASARAAASEVLGTHKGLKGGDLKEYIKTYFPRTWAHFDVNKTGMIGVEVMPQFMRFIASDQTL
Ga0192966_1023308723300019050MarineMRVPPVRFASDSDDLFMRSMIMKYAAEEKTDEGTPSGNFFLNEASARAASGEVLASHKGLKGGDLKGYLDTYFPRTWAHFDVNGSGFIGVEVMPQFARFIASDQTLQL
Ga0192946_106186723300019103MarineMKYAAEEKTEDGAPSGAFFMNEASAKAAATEVVGTHLGLKGGDLKSYISTYFPRTWANFDVNGSGFIGVEVMPQLARFIASDQTLQ
Ga0188870_1002787133300019149Freshwater LakeMKYAAEEKTEDGAPSGNFFLNEASARAASAEVIGSHLNLAGADLKSYLSTYFPRTWAHFDVNSSGFIGVEVMPQFVRFIASDQTLQL
Ga0206691_179296423300021342SeawaterMKYALEGKNEDGSPNGAFFMDEASTRAAAGEVLASHKSLKGGELDSYLKTYFPRTWAHYDVNKAGMIGVEVMPVFMRFLASDQTLNLS
Ga0206692_157287723300021350SeawaterMKYAAEEKTEDGAPSGNFFLNEASARRASAEVIGTHMGLAGADLKNYLETYFPRTWEHFDVNGSGFIGVEVMPQFARFICSDQTLQL
Ga0206690_1010049613300021355SeawaterMRSMIMKYAAEEKTEDGAPNGNFFLNEASARAAATEVLGSHKALKGGDLKEYVKTYFPRTWAHFDVNKTGYIGVEVMPQFVRFIASDQTFLL
Ga0063132_10361223300021872MarineMRSMITTYAAEEKDEDGVPNGNFFLNKASAERALTEVVGTHKGLSGKNLKAYVTEYFPRTWAHFDVNGAGMVGVEVMPQMARFFA
Ga0063117_105762013300021881MarineMFSADSDDLFMRSMIMKYAAEGTNGDGAPNGVFTIEEPAARAAATEVLGTHKGLKGADLKEYVATYFPRTWAHFDVNKAGEIGVEVLPQFMRFIASDQTLKLDXAIKYXIYNND
Ga0063125_101604023300021885MarineMKYAAEEKTDDGTPSGNFFLNEASARAASAEVLGSHKGLKGGDLKEYLSTYFPRTWAHFDVNKSGFIGVEVMPQFVRFIASDQTLQL
Ga0063086_100061623300021902MarineMRSMIMKYAAEEKTGDGVPSGNFFLNEASARAAATEVVGSHLGLAGAELKSYITTYFPRTWAHFDVNGSGFIGVEVMPQLARFIASDQYMQLA
Ga0063086_100092923300021902MarineMIMKYAAEEKTGDGAPSGNFFLNEASARAASTEVIGSHNALKGADLKEYIKTYFPRTWAHFDVNKTGYIGVEVMPQFVRFIASDQTLQL
Ga0063133_102933123300021912MarineMRSMIMKYAAEEKTEDGVPSGNFFLNEASARRASSEVLASHKGLKGADLKGYLDTYFPRTWAHFDVNGAGMVGVEVMPQFVRFIASDQTLQL
Ga0063869_106908523300021922MarineMKYAAEEKTGDGLPSGAFFMNEASARRAATEIVGSHAGLKGDDLKAYIETYFPRTWAHFDVNGTGMIGVEVMPQLARFIASDQTL
Ga0063096_100584123300021925MarineMRSMITKYAAEEKDDDGVPNGNFFMNEASARAAATEVVGTHNGLSGGALKAYVKEYFPRTWAHFDVNAAGMIGVEVMPQLVRMFASDQYMML
Ga0063102_102650023300021941MarineMKYAAEEKTEDGAPSGNFFLNEASARAASTEVVGSHNGLKGDDLKEYVKTYFPRTWAHFDVNGTGFVGVEVMPQLVRLFASD
Ga0063094_104838233300021943MarineMKYAAEEKTEDGAPSGNFFLNEASARAASSEVIGSHNALKGDDLKEYIKTYFPRTWAHFDVNKTGYVGVEVMPQFVRFIASDQTLQL
Ga0247568_112752323300026462SeawaterMRSMIMKYAAEEKTEDGAPSGNFFLNEASARRASAEVIGTHMGLAGADLKNYLETYFPRTWEHFDVNGSGFIGVEVMPQFARFIC
Ga0247599_105021513300026470SeawaterMRSMIMKYAAEEKDEDGVPNGAFFLNEASARAASAEVLGSHKGLKGAELKGYLDTYFPRTWAHFDVNGAGFIGVEVMPQFARFIASDQTMQL
Ga0247571_112289113300026495SeawaterMKYAAEENTEDGAPSGNFFLNEASTRALASEVLGTHKGLKGGDLNEYLSTYFPRTWAHYDVNKTGYIGVEVAPQFMRFIASDQTLQL
Ga0247592_112963313300026500SeawaterDSDDLFMRSMIMKYAAEEKTEDGVPSGNFFLNEASARRASSEVLASHKGLKGADLKGYLDTYFPRTWAHFDVNGAGMVGVEVMPQFVRFIASDQTLQL
Ga0209302_1053522013300027810MarineRFSADSDDLFMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALATEVLGTHKGLKGEDLKEYVKTYFPRTWAHYDVNKTGMVGVEVAPQFMRFIASDQTLQL
Ga0209092_1012972023300027833MarineMKYAAEEKTGDGAPSGNFFLNEASARAASTEVIGSHNALKGADLKEYIKTYFPRTWAHFDVNKTGYIGVEVM
Ga0256411_112104413300028134SeawaterMRVPPVRFSSDSDDLFMRSMIMNYAAEEKTEEGTPSGNFFLNEASARRASAEVIGSHLGLKGGDLKTYLDTYFPRTWAHFDVNGSGFIGVEVMPQFVRFIASDQTLQL
Ga0256411_120144723300028134SeawaterMKYAAEEKTEDGAPSGNFFLNEASARAASGEVLSSHKGLKGGDLKEYLATYFPRTWAHFDVNKSGMIGVEVMPQFVRFLSSDQQLSL
Ga0256411_124907323300028134SeawaterERVPPARFSADSDDLFMRSVIMKYAAEEKDGDGAPSGNFFLNEASTRALAAEVLGTHKGLKGADLKEYLGTYFPRTWAHYDVNKSGFIGVEVAPQFMRFVASDQTMQL
Ga0256413_104999713300028282SeawaterMRSMIMKYAAEEKDEDGVPNGAFFLNEASARAASAEVLGSHKGLKGADLKGYLDTYFPRTWAHFDVNGAGFIGVEVMPQFARFIASDQTMQL
Ga0256413_120987523300028282SeawaterMRSMIMKYAAEEKTEDGAPSGNFFLNEASARAASGEVLSSHKGLKGGDLKEYLATYFPRTWAHFDVNKSGMIGVEVMPQFVRFIASDQTLQL
Ga0304731_1014656723300028575MarineMRSMIMKYAAEEKTDDGAPSGNFFLNEASARAASSEVLASHKGLKGGDLKEYLATYFPRTWAHFDVNKSGFIGVEVMPQFVRFIASDQTLQL
Ga0304731_1025277213300028575MarineTEDGAPNGNFFMNEASARAAASEVLGTHKGLKGKDLSEYVKTYFPRTWAHFDVNKTGMIGVEVMPQFMRFIASDQTLQL
Ga0304731_1166168113300028575MarineMRSMIMKYAAEEKTDDGTPSGNFFLNEASARAASSEVISSHLGLKGGDLKQYLNTYFPRTWAHFDVNGAGMIGVEVMPQFARFIASDQTLQL
Ga0307401_1050310813300030670MarineMELKDGDGAPAGQFFMDEAGSRAAVSEVLGTHKGLKGADLKEYVKTYFPRTWAHFDVNKSGAIGVEVMPQFMRFVASDQTLQLD
Ga0307403_1005804213300030671MarineMITKYAAEEKDDDGVPNGNFFMNEASARAAGSEVVGTHNGLSGAALKAYVKEYWPRTWAHFDVNGGGMIGVEVMPQLVRLFASDQYMQL
Ga0307400_1077075213300030709MarineMRSMITKYAAEEKDDDGVPNGNFFMNEASARAAGSEVVGTHNGLSGAALKAYVKEYWPRTWAHFDVNGGGMIGVEVMPQLVRLFAS
Ga0308129_103224023300030723MarineMRSMITKYAAEEKDDDGVPNGNFFMNEASARAAATEVVGTHNGLSGGALKAYVKEYFPRTWAHFDVNAAGMIGVEVMPQLVRMFAS
Ga0073988_1234040623300030780MarineMKYAAEEKTEDGAPSGAFFLNEASARAASAEVLSSHKGLSGADLKSYLETYFPRTWAHFDVNGSGFVGVEVMPQFVRFIASDQTLQL
Ga0073988_1236821613300030780MarineMRSMIMKYAAEEKTEDGAPSGNFFMNEASTRAACAEVLGSHKGLKGGDLKEYLATYFPRTWAHFDVNKSGMIGVEVMPQFVRFIA
Ga0073987_1000004013300030912MarineTLDKKYERVPPARFSADSDDLFMRSVIMKYAAEEKTEDGAPSGNFFLNEASTRALAAEVLGTHKGLKGADLKEYLATYFPRTWAHYDVNKTGFIGVEVAPQFMRFVASDQTMQL
Ga0073987_1122640923300030912MarineMRSMIMKYAAEEKTEDGAPSGNFFLNEASARAASAEVLGSHKGLKGADLKEYLATYFPRTWAHFDVNKSGFIGVEVMPQFVRFIASDQTLQL
Ga0073989_1000756213300031062MarineDGAPSGNFFLNEASTRALASEVLGTHKGLKGADLKEYLATYFPRTWAHYDVNKTGFIGVEVAPQFMRFIASDQTMQL
Ga0073989_1350171113300031062MarineMRVPPVRFSADSDDLFMRSMIMKYAAEEKTDDGTPSGNFFLNEASARAAAGEVVGTHLGLKGGDLKEYLNTYFPRTWAHFDVNGSGMVGVEVMPQLARFICSDQTMQL
Ga0308132_113877713300031580MarineMKYAAEEKTEDGAPSGNFFLNEASTRALASEVLGSHKGLKGGDLKEYLNTYFPRTWAHYDVNKTGFIGVEVAPQFMRFVASDQTLQF
Ga0302125_1015650123300031638MarineMRSMITKYAAEEKDDDGVPNGNFFMNEASARAAATEVVGTHNGLSGGALKAYVKEYFPRTWAHFDVNAAGMI
Ga0307386_1012438443300031710MarineMKYAAEEKTEDGAPNGNFFLNEASAKRAATEVVSTHLGLKGGDLKSYIGTYFPRTWAHFDVNGSGMIGVEVMPQLARF
Ga0307386_1036670413300031710MarineMIMKYAAEEKTDDLTPSGNFFMNEASARRACSEVLGAHKNLAGADLKGYLDTYFPRTWAHFDVNGSGMVGVEVMPQLVRFIASDQYMQL
Ga0307386_1039001823300031710MarineMRVPPPRFATDSDDLFMRSMIMKYAAEEKTGDGVPSGNFFLNEASARAAATEVVGSHLGLAGAELKSYITTYFPRTWAHFDVNGSGFIGVEVMPQLARFIASDQYMQLA
Ga0307381_1009604033300031725MarineMKSMIMKYAMESKDGDGAPTGAFFMDEAATRAASSEVLGSHKGLKGADLKEYVKTYFPRTWAHFDVNKGGVVGVEVMPQFMRFIASD
Ga0307381_1012646613300031725MarineMRSMITKYAAEEKDDDGVPNGNFFMNEASATAAASEVVGTHNGLSGGALKAYVKEYWPRTWAHFDVNGAGMIGVEVMPQLVRMFASDQYMQL
Ga0307381_1019982923300031725MarineMFSADSDDVFMRSMIMKYAAEGTNGDGAPNGVFTVEEPAARAAATEVLGTHKGLKGADLKEYVKTYFPRTWAHFDVNKSGEVGVEVLP
Ga0307381_1031320723300031725MarineMIMKYAAEGKDENGAPNGQFFIQEAQAKAAATEVLATHKGLKDADLAEYVKTYFPRSWAHFDVNKSGTIGVEAMPMFMRFIASD
Ga0307391_1053202413300031729MarineMRSMITKYAAEEKDDDGVPNGNFFMNEASARAAGSEVVGTHNGLSGAALKAYVKEYWPRTWAHFDVNGGGMIGVEVMPQLVRLFASDQYMQL
Ga0307397_1031613013300031734MarineMRSMIMKYAMEEKNDDGAPTGNFFMDEASTRAAASEVLGSHKGLKGGDLKEYVKTYFPRAWGHFDVNKGGVVGVEVMP
Ga0307384_1007292943300031738MarineMKYAAEEKTEDGAPNGNFFLNEASAKRAATEVVSTHLGLKGGDLKSYIGTYFPRTWAHFDVNGSGMIGVEVMPQLARFIASDQTLQL
Ga0307384_1007539613300031738MarineLRIPPVRFSSDSDDLFMRSMIMKYAAEEKTDDLTPSGNFFMNEASARRACSEVLGAHKNLAGADLKGYLDTYFPRTWAHFDVNGSGMVGVEVMPQLVRFIASDQYMQL
Ga0307384_1015158013300031738MarineMRVPPVRFASDSDDLFMRSMIMKYAAEEKTDDGTPSGNFFLNEASARAASGEVLSSHKGLKGGDLKGYLDTYFPRTWAHFDVNGSGFIGVEVMPQFARFIASDQTLQL
Ga0307383_1031575423300031739MarineMFSADSDDIFMRSMIMKYAAEGTNGDGAPNGSFTIEEPAARAAATEVLGTHKGLKGADLKEYVKTYFPRTWAHFDVNKSGEIGVEVLP
Ga0315305_118439313300032127MarineMKYAMEEKTEDGAPSGNFFMDEAATRAASAEVLETHKGLKKGDLKDYIKTYFPRTWAHFDVNKAGSVGVDVMPQFMRFLASDQALKLE
Ga0314689_1020016013300032518SeawaterMRSMIMKYAAEEKTEDGAPSGNFFLNEASARAASAEVLGSHLNLAGADLKSYLSTYFPRTWAHFDVNSSGFIGVEVMPQFVRFIASDQTLQL
Ga0314680_1015822523300032521SeawaterMRSMIMKYAAEEKTEDGAPSGNFFLNEASARAASAEVIGSHLNLAGADLKSYLSTYFPRTWAHFDVNSSGFIGVEVMPQFVRFIASDQTLQL
Ga0314680_1038063823300032521SeawaterMIMKYAAEEKTGDGAPSGNFFLNEASARAASTEVIGSHNALKGADLKEYIKTYFPRTWAHFDVNKTGYIGVEVMPQLARFIASD
Ga0314682_1012283323300032540SeawaterMRSMIMKYAAEEKTEDGAPSGNFFLNEASARAASAEVIGSHLNLAGADLKSYLSTYFPRTWAHFDVNGSGFIGVEVMPQFVRFIASDQTLQL
Ga0314671_1049571813300032616SeawaterMKYAAEEKTGDGLPSGAFFMNEASARRAATEIVGSHAGLKGDDLKAYIETYFPRTWAHFDVNGTGMIGVEVMPQLARF
Ga0314685_1047371923300032651SeawaterMKYAAEEKTEDGAPSGNFFLNEASARAASAEVIGSHLNLAGADLKTYLSTYFPRTWAHFDVNGSGFIGVEVMPQFVRFIASDQTLQL
Ga0314687_1030689823300032707SeawaterMKYAAEEKTEDGAPSGNFFLNEASARAASAEVLGSHLNLAGADLKSYLSTYFPRTWAHFDVNSSGFIGVEVMPQFVRFIASDQTLQL
Ga0314704_1061668523300032745SeawaterMKYAAEEKTEDGAPSGNFFLNEASARAASAEVIGSHLNLAGADLKSYLSTYFPRTWAHFDVNGSGFIGVEVMPQFVRFIASDQTLQL
Ga0314701_1038272023300032746SeawaterMRSMIMKYAAEEKTGDGLPSGAFFMNEASARRAATEIVGSHAGLKGDDLKAYIETYFPRTWAHFDVNGTGMIGVEVMPQLARFIASDQTLQLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.