Metagenome / Metatranscriptome Family F071396

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F071396
Family Type	Metagenome / Metatranscriptome
Number of Sequences	122
Average Sequence Length	44 residues
Representative Sequence	MNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Number of Associated Samples	101
Number of Associated Scaffolds	122

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	42.62 %
% of genes near scaffold ends (potentially truncated)	43.44 %
% of genes from short scaffolds (< 2000 bps)	83.61 %
Associated GOLD sequencing projects	94
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (51.639 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil (13.934 % of family members)
Environment Ontology (ENVO)	Unclassified (32.787 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (48.361 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 56.82% β-sheet: 0.00% Coil/Unstructured: 43.18%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 122 Family Scaffolds
PF12697	Abhydrolase_6	20.49
PF00389	2-Hacid_dh	14.75
PF02826	2-Hacid_dh_C	8.20
PF13279	4HBT_2	3.28
PF12146	Hydrolase_4	3.28
PF00561	Abhydrolase_1	3.28
PF00486	Trans_reg_C	2.46
PF13414	TPR_11	1.64
PF08386	Abhydrolase_4	1.64
PF09084	NMT1	0.82
PF00497	SBP_bac_3	0.82
PF16868	NMT1_3	0.82
PF13561	adh_short_C2	0.82
PF13489	Methyltransf_23	0.82
PF13181	TPR_8	0.82
PF11937	DUF3455	0.82

COG ID	Name	Functional Category	% Frequency in 122 Family Scaffolds
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.82
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.82

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.64 %
All Organisms	root	All Organisms	48.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.64 %
cellular organisms	root	All Organisms → cellular organisms	48.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	48.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.64 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	36.07 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.64 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	29.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.64 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	19.67 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	3.28 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	2.46 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.64 %
Hyphomicrobiales incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis	11.48 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	3.28 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	2.46 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	1.64 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.64 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.64 %
Nordella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella	11.48 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	3.28 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	2.46 %
unclassified Rhodospirillaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae	1.64 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.64 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.64 %
unclassified Nordella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella	11.48 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	3.28 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	2.46 %
Rhodospirillaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	1.64 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.64 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.64 %
Nordella sp. HKS 07	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	11.48 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	3.28 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	2.46 %
Rhodospirillaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	1.64 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.64 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1.64 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000156\|NODE_c0687740	All Organisms → cellular organisms → Bacteria	3313	Open in IMG/M
3300000890\|JGI11643J12802_11015647	Not Available	987	Open in IMG/M
3300000891\|JGI10214J12806_13028958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	859	Open in IMG/M
3300001692\|JGI24247J19897_10093	Not Available	602	Open in IMG/M
3300003349\|JGI26129J50193_1004917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	952	Open in IMG/M
3300003911\|JGI25405J52794_10106135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	628	Open in IMG/M
3300004020\|Ga0055440_10010130	Not Available	1681	Open in IMG/M
3300004058\|Ga0055498_10005789	Not Available	1443	Open in IMG/M
3300004058\|Ga0055498_10113690	Not Available	561	Open in IMG/M
3300004070\|Ga0055488_10054723	Not Available	877	Open in IMG/M
3300004114\|Ga0062593_100062889	Not Available	2401	Open in IMG/M
3300004156\|Ga0062589_101685500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	632	Open in IMG/M
3300004157\|Ga0062590_100159300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1562	Open in IMG/M
3300004463\|Ga0063356_103769450	Not Available	653	Open in IMG/M
3300004480\|Ga0062592_100399159	All Organisms → cellular organisms → Bacteria	1093	Open in IMG/M
3300004643\|Ga0062591_100626295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	957	Open in IMG/M
3300004643\|Ga0062591_101149564	All Organisms → cellular organisms → Bacteria	752	Open in IMG/M
3300004643\|Ga0062591_101847297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	618	Open in IMG/M
3300004643\|Ga0062591_102358104	Not Available	557	Open in IMG/M
3300004643\|Ga0062591_102533038	All Organisms → cellular organisms → Bacteria	540	Open in IMG/M
3300005093\|Ga0062594_100244407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1305	Open in IMG/M
3300005093\|Ga0062594_102194979	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300005146\|Ga0066817_1022796	Not Available	586	Open in IMG/M
3300005164\|Ga0066815_10006341	Not Available	1329	Open in IMG/M
3300005168\|Ga0066809_10105131	Not Available	695	Open in IMG/M
3300005169\|Ga0066810_10021115	All Organisms → cellular organisms → Bacteria → Proteobacteria	1084	Open in IMG/M
3300005183\|Ga0068993_10091054	Not Available	962	Open in IMG/M
3300005213\|Ga0068998_10001915	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2225	Open in IMG/M
3300005332\|Ga0066388_100776509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1554	Open in IMG/M
3300005332\|Ga0066388_103938641	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300005332\|Ga0066388_105710967	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300005335\|Ga0070666_10083856	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2180	Open in IMG/M
3300005335\|Ga0070666_10677905	Not Available	755	Open in IMG/M
3300005353\|Ga0070669_101769575	Not Available	539	Open in IMG/M
3300005434\|Ga0070709_10429331	Not Available	992	Open in IMG/M
3300005435\|Ga0070714_101671285	All Organisms → cellular organisms → Bacteria	622	Open in IMG/M
3300005444\|Ga0070694_101780659	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300005530\|Ga0070679_101623334	Not Available	594	Open in IMG/M
3300005536\|Ga0070697_100460293	Not Available	1109	Open in IMG/M
3300005564\|Ga0070664_100119949	All Organisms → cellular organisms → Bacteria	2302	Open in IMG/M
3300005713\|Ga0066905_100922459	Not Available	766	Open in IMG/M
3300006048\|Ga0075363_100746081	Not Available	593	Open in IMG/M
3300006195\|Ga0075366_10182949	All Organisms → cellular organisms → Bacteria → Proteobacteria	1273	Open in IMG/M
3300006574\|Ga0074056_11819820	All Organisms → cellular organisms → Bacteria	1266	Open in IMG/M
3300006852\|Ga0075433_11401205	Not Available	605	Open in IMG/M
3300006871\|Ga0075434_100206930	All Organisms → cellular organisms → Bacteria	1983	Open in IMG/M
3300006954\|Ga0079219_10271570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1026	Open in IMG/M
3300006954\|Ga0079219_10333639	Not Available	962	Open in IMG/M
3300009094\|Ga0111539_10109076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3248	Open in IMG/M
3300009098\|Ga0105245_11749969	Not Available	674	Open in IMG/M
3300010043\|Ga0126380_10477494	Not Available	950	Open in IMG/M
3300010358\|Ga0126370_10425885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1099	Open in IMG/M
3300010359\|Ga0126376_12187311	Not Available	598	Open in IMG/M
3300010359\|Ga0126376_12275279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	588	Open in IMG/M
3300010362\|Ga0126377_10002409	All Organisms → cellular organisms → Bacteria	12869	Open in IMG/M
3300010362\|Ga0126377_10374325	Not Available	1428	Open in IMG/M
3300010371\|Ga0134125_10074528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3775	Open in IMG/M
3300010399\|Ga0134127_10127831	Not Available	2273	Open in IMG/M
3300012489\|Ga0157349_1009799	Not Available	755	Open in IMG/M
3300012893\|Ga0157284_10239688	Not Available	566	Open in IMG/M
3300012899\|Ga0157299_10123963	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300012908\|Ga0157286_10168418	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	713	Open in IMG/M
3300012913\|Ga0157298_10216238	Not Available	626	Open in IMG/M
3300012916\|Ga0157310_10451673	Not Available	547	Open in IMG/M
3300012948\|Ga0126375_10167210	Not Available	1407	Open in IMG/M
3300012948\|Ga0126375_10201504	Not Available	1307	Open in IMG/M
3300012955\|Ga0164298_10528933	Not Available	794	Open in IMG/M
3300012957\|Ga0164303_11155002	Not Available	563	Open in IMG/M
3300012987\|Ga0164307_10165619	All Organisms → cellular organisms → Bacteria → Proteobacteria	1471	Open in IMG/M
3300012988\|Ga0164306_10069717	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2199	Open in IMG/M
3300014308\|Ga0075354_1016038	Not Available	1150	Open in IMG/M
3300015371\|Ga0132258_10346040	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3674	Open in IMG/M
3300015371\|Ga0132258_13752925	Not Available	1035	Open in IMG/M
3300015372\|Ga0132256_100766883	Not Available	1081	Open in IMG/M
3300015372\|Ga0132256_103074239	Not Available	561	Open in IMG/M
3300015372\|Ga0132256_103160371	Not Available	554	Open in IMG/M
3300015373\|Ga0132257_100531255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1446	Open in IMG/M
3300015374\|Ga0132255_102183889	Not Available	844	Open in IMG/M
3300015374\|Ga0132255_105104072	Not Available	556	Open in IMG/M
3300017947\|Ga0187785_10071371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1341	Open in IMG/M
3300019356\|Ga0173481_10002864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4403	Open in IMG/M
3300019361\|Ga0173482_10006038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2876	Open in IMG/M
3300019362\|Ga0173479_10405575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	659	Open in IMG/M
3300021445\|Ga0182009_10055365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1693	Open in IMG/M
3300022883\|Ga0247786_1089520	Not Available	657	Open in IMG/M
3300023072\|Ga0247799_1097421	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	527	Open in IMG/M
3300025271\|Ga0207666_1007247	Not Available	1456	Open in IMG/M
3300025728\|Ga0207655_1251549	Not Available	501	Open in IMG/M
3300025901\|Ga0207688_10042502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	2530	Open in IMG/M
3300025903\|Ga0207680_10705183	Not Available	723	Open in IMG/M
3300025910\|Ga0207684_11728493	Not Available	503	Open in IMG/M
3300025912\|Ga0207707_10794955	Not Available	788	Open in IMG/M
3300025917\|Ga0207660_10707400	All Organisms → cellular organisms → Bacteria	822	Open in IMG/M
3300025925\|Ga0207650_10201858	Not Available	1593	Open in IMG/M
3300025932\|Ga0207690_11796460	All Organisms → cellular organisms → Bacteria → Proteobacteria	512	Open in IMG/M
3300025933\|Ga0207706_11613649	Not Available	525	Open in IMG/M
3300025935\|Ga0207709_11389509	All Organisms → cellular organisms → Bacteria → Proteobacteria	581	Open in IMG/M
3300025945\|Ga0207679_10180706	All Organisms → cellular organisms → Bacteria → Proteobacteria	1745	Open in IMG/M
3300025945\|Ga0207679_10282349	Not Available	1424	Open in IMG/M
3300025955\|Ga0210071_1016446	Not Available	895	Open in IMG/M
3300025957\|Ga0210089_1030682	Not Available	658	Open in IMG/M
3300026075\|Ga0207708_10887566	Not Available	771	Open in IMG/M
3300026452\|Ga0256821_1004594	Not Available	1271	Open in IMG/M
3300026655\|Ga0207530_100375	Not Available	616	Open in IMG/M
3300026761\|Ga0207495_100174	Not Available	1405	Open in IMG/M
3300026766\|Ga0207450_100221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2396	Open in IMG/M
3300027360\|Ga0209969_1075922	Not Available	536	Open in IMG/M
3300027435\|Ga0207553_1005088	Not Available	656	Open in IMG/M
3300027482\|Ga0207460_102919	Not Available	602	Open in IMG/M
3300027523\|Ga0208890_1012133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1157	Open in IMG/M
3300027523\|Ga0208890_1028322	All Organisms → cellular organisms → Bacteria → Proteobacteria	835	Open in IMG/M
3300027617\|Ga0210002_1001138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	3700	Open in IMG/M
3300027617\|Ga0210002_1001176	All Organisms → cellular organisms → Bacteria → Proteobacteria	3647	Open in IMG/M
3300027775\|Ga0209177_10228591	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	676	Open in IMG/M
3300027775\|Ga0209177_10354126	Not Available	576	Open in IMG/M
(restricted) 3300031150\|Ga0255311_1022214	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1308	Open in IMG/M
(restricted) 3300031197\|Ga0255310_10003499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4107	Open in IMG/M
3300031720\|Ga0307469_10033633	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3015	Open in IMG/M
3300031740\|Ga0307468_100351824	Not Available	1099	Open in IMG/M
3300031943\|Ga0310885_10217618	Not Available	952	Open in IMG/M
3300031944\|Ga0310884_10010343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	3467	Open in IMG/M
3300032205\|Ga0307472_101093206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	754	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	72.13%
Host-Associated	Host-Associated	27.05%
Engineered	Engineered	0.82%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	64.75%
Plants	Host-Associated → Plants	27.05%
Aquatic	Environmental → Aquatic	7.38%
Solid Waste	Engineered → Solid Waste	0.82%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	64.75%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.57%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.84%
Marine	Environmental → Aquatic → Marine	6.56%
Roots	Host-Associated → Plants → Roots	1.64%
Freshwater	Environmental → Aquatic → Freshwater	0.82%
Grass	Engineered → Solid Waste → Grass	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	50.82%
Loam	Environmental → Terrestrial → Soil → Loam	10.66%
Soil	Host-Associated → Plants → Rhizosphere → Soil	10.66%
Wetlands	Environmental → Aquatic → Marine → Wetlands	6.56%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.10%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.64%
Sand	Environmental → Terrestrial → Soil → Sand	1.64%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	1.64%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.82%
Composting	Engineered → Solid Waste → Grass → Composting	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	26.23%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	18.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	10.66%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.38%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	6.56%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.10%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.28%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.46%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.64%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.64%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.64%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.64%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	1.64%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.82%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	0.82%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	13.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.84%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	6.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	6.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.10%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.10%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	4.10%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.10%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.10%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.28%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.28%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.46%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.46%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.46%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.46%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	2.46%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.64%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	1.64%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	1.64%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.82%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.82%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.82%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.82%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.82%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.82%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.82%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.82%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	0.82%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300001692	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1-11	Environmental	Open in IMG/M
3300003349	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM	Host-Associated	Open in IMG/M
3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300004020	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2	Environmental	Open in IMG/M
3300004058	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1	Environmental	Open in IMG/M
3300004070	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005146	Soil and rhizosphere microbial communities from Laval, Canada - mgHAB	Environmental	Open in IMG/M
3300005164	Soil and rhizosphere microbial communities from Laval, Canada - mgLAC	Environmental	Open in IMG/M
3300005168	Soil and rhizosphere microbial communities from Laval, Canada - mgLPC	Environmental	Open in IMG/M
3300005169	Soil and rhizosphere microbial communities from Laval, Canada - mgHPA	Environmental	Open in IMG/M
3300005183	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1	Environmental	Open in IMG/M
3300005213	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300006048	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Host-Associated	Open in IMG/M
3300006195	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Host-Associated	Open in IMG/M
3300006574	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300012489	Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610	Environmental	Open in IMG/M
3300012893	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012913	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2	Environmental	Open in IMG/M
3300012916	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300014308	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300022883	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4	Environmental	Open in IMG/M
3300023072	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6	Environmental	Open in IMG/M
3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)	Environmental	Open in IMG/M
3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025955	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025957	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)	Environmental	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026452	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4	Environmental	Open in IMG/M
3300026655	Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G10K1-12 (SPAdes)	Environmental	Open in IMG/M
3300026761	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-11 (SPAdes)	Environmental	Open in IMG/M
3300026766	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-D (SPAdes)	Environmental	Open in IMG/M
3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)	Host-Associated	Open in IMG/M
3300027435	Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K3-12 (SPAdes)	Environmental	Open in IMG/M
3300027482	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A2w-12 (SPAdes)	Environmental	Open in IMG/M
3300027523	Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)	Environmental	Open in IMG/M
3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300031150 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4	Environmental	Open in IMG/M
3300031197 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
NODE_06877404	3300000156	Sugar Cane Bagasse Incubating Bioreactor	MNSALAQVVIPHGNFDDGFEKYTVAAITFLLLCFAVWQYFRNRR*
JGI11643J12802_110156473	3300000890	Soil	MNSALAQVVIPHGNFDDGFEQYLVAAITFLLLCFAVWQYFRDRK*
JGI10214J12806_130289581	3300000891	Soil	SALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
JGI24247J19897_100931	3300001692	Soil	MNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAV
JGI26129J50193_10049172	3300003349	Arabidopsis Thaliana Rhizosphere	MNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
JGI25405J52794_101061352	3300003911	Tabebuia Heterophylla Rhizosphere	RGRGAAYGRMYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0055440_100101301	3300004020	Natural And Restored Wetlands	MSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRR*
Ga0055498_100057892	3300004058	Natural And Restored Wetlands	MSTALAQVVIPFGDFGDGFEKYLVATITFLFLCFAVWQYFRR*
Ga0055498_101136901	3300004058	Natural And Restored Wetlands	MNSASAQVVIPHGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRQ*
Ga0055488_100547231	3300004070	Natural And Restored Wetlands	MSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRS*
Ga0062593_1000628893	3300004114	Soil	MGTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR*
Ga0062589_1016855002	3300004156	Soil	AQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRK*
Ga0062590_1001593003	3300004157	Soil	MNSALAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWHYFRDRK*
Ga0063356_1037694501	3300004463	Arabidopsis Thaliana Rhizosphere	MNSAMAQVVIPYGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0062592_1003991592	3300004480	Soil	MNSVVAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRK*
Ga0062591_1006262952	3300004643	Soil	MYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRR*
Ga0062591_1011495643	3300004643	Soil	MNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRK*
Ga0062591_1018472972	3300004643	Soil	MNSAMAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0062591_1023581041	3300004643	Soil	NSALAQVVIPYGNFDDGFEKYLVATITFLLLCVAVWHYFRGRK*
Ga0062591_1025330382	3300004643	Soil	MNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0062594_1002444072	3300005093	Soil	MQMNSALAQVVIPHGNFDDGFEKYTVAAITFLLLCFAVWQYFRNRR*
Ga0062594_1021949791	3300005093	Soil	ALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR*
Ga0066817_10227961	3300005146	Soil	MNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRGRK*
Ga0066815_100063413	3300005164	Soil	MNSALAQVVIPYGSFDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
Ga0066809_101051312	3300005168	Soil	MNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRN*
Ga0066810_100211153	3300005169	Soil	MNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRR*
Ga0068993_100910543	3300005183	Natural And Restored Wetlands	MYMNTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRR*
Ga0068998_100019151	3300005213	Natural And Restored Wetlands	MSTALAQVVIPIGDFGDGFEKYLVATITFLFLCFAVWQYFRR*
Ga0066388_1007765092	3300005332	Tropical Forest Soil	MSTALAQVVIPFGDFGDGFEKYLVATITFVLLCFAVWQYFRDRK*
Ga0066388_1039386412	3300005332	Tropical Forest Soil	MHMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0066388_1057109672	3300005332	Tropical Forest Soil	MSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0070666_100838561	3300005335	Switchgrass Rhizosphere	QVVIPFGDFGDGFEKYLVAGIAFVLLCVAVLRFFRNRDG*
Ga0070666_106779052	3300005335	Switchgrass Rhizosphere	MYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYLRDRK*
Ga0070669_1017695752	3300005353	Switchgrass Rhizosphere	PAAAQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG*
Ga0070709_104293313	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	AAQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG*
Ga0070714_1016712852	3300005435	Agricultural Soil	AQVVIPFGDFGDGFEKYLVAVIAFVLLCVAVWRFFRNRS*
Ga0070694_1017806592	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MQMNSALAQVVIPHGNFDDGFEKYTVAAITFLLLCFAVWQYFRNPR*
Ga0070679_1016233342	3300005530	Corn Rhizosphere	MNSAMAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYF
Ga0070697_1004602933	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRR*
Ga0070664_1001199491	3300005564	Corn Rhizosphere	YGWTHMGTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR*
Ga0066905_1009224591	3300005713	Tropical Forest Soil	LAQVVIPFGDFGGGFEKYLVATITFVLLCFAVWQFFRDRR*
Ga0075363_1007460811	3300006048	Populus Endosphere	CLRSTHMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0075366_101829492	3300006195	Populus Endosphere	MNSALAQVVIPFGDFDDRFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0074056_118198202	3300006574	Soil	MNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRERK*
Ga0075433_114012052	3300006852	Populus Rhizosphere	TPAAAQVVIPFGDFGDGFEKYLVAAIAFVLLCVAVLRFFRNRDG*
Ga0075434_1002069303	3300006871	Populus Rhizosphere	MYMSTALAQVVIPFGDFGDGFEKYLVATITFVLLCFAVWQYFRDRK*
Ga0079219_102715702	3300006954	Agricultural Soil	MQMNSALAQVVIPHGNFDDGFEKYTVVAITFLLLCFAVWQYFGNRR*
Ga0079219_103336393	3300006954	Agricultural Soil	MSTALAQVVIPFGDFGDGFEKHLIAAITFLLLCFAVGQYFRGRK*
Ga0111539_101090761	3300009094	Populus Rhizosphere	MYMSTALAQVVIPYGDFNDGFEKYLVATITFLLLCFAVWQYFRNRK*
Ga0105245_117499692	3300009098	Miscanthus Rhizosphere	MNSTLAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
Ga0126380_104774942	3300010043	Tropical Forest Soil	VAQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNR*
Ga0126370_104258852	3300010358	Tropical Forest Soil	MNAALAQVVIPFGDFDDGFEKYLVATITFLLLCVAVWQYYRDRK*
Ga0126376_121873111	3300010359	Tropical Forest Soil	MQMNSALAQVVIPHGNFDDGFEKYTVVAITFLLLCFAVWQYFRNRR*
Ga0126376_122752792	3300010359	Tropical Forest Soil	IPFGDFDDGFEKYLVATITFLLLCVAVWQYFRDRK*
Ga0126377_100024096	3300010362	Tropical Forest Soil	MHMSTALAQVVIPFGDFGGGFEKYLVATITFVLLCFAVWQFFRNRK*
Ga0126377_103743251	3300010362	Tropical Forest Soil	MQMSTALAQVVIPFGGFGDGFEKYLVATITFVLLCFAVWQYFRDRK*
Ga0134125_100745283	3300010371	Terrestrial Soil	MNTALAQVVIPYGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0134127_101278312	3300010399	Terrestrial Soil	MAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0157349_10097991	3300012489	Unplanted Soil	QVVIPFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG*
Ga0157284_102396881	3300012893	Soil	MNSALAQVVIPYGSFDDGFEKYLVAAITFLLLCFAVWQYFRDR
Ga0157299_101239631	3300012899	Soil	ELCLRSTHMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0157286_101684181	3300012908	Soil	IPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0157298_102162382	3300012913	Soil	MYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR*
Ga0157310_104516732	3300012916	Soil	MNSAMAQVVIPYGDFDDGFEKYLVTTITFLLLCFAVWQYFRDRK*
Ga0126375_101672102	3300012948	Tropical Forest Soil	RGAAFGWTYMSTALAQVVIPFGDFGDGFEKYLVATITFVLLCFAVWQYFRDRK*
Ga0126375_102015042	3300012948	Tropical Forest Soil	MSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQFYRDRK*
Ga0164298_105289333	3300012955	Soil	MNSALAQVVIPYGSFDDGFEKYLVAAITFLLLCFAVWQYLRDR
Ga0164303_111550021	3300012957	Soil	PAAAQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVLRFFRNRDG*
Ga0164307_101656191	3300012987	Soil	AGAFIDRAVAQVVIPFGDFGDGFEKYLVAVIAFVLLCIAVWRFFRNRS*
Ga0164306_100697171	3300012988	Soil	IPFGDFGDGFEKYLVAGIAFVLLCVAVLRFFRNRDG*
Ga0075354_10160382	3300014308	Natural And Restored Wetlands	MYMSTALAQVVIPFGDFGDGFEKYLVAAITFLLLCFAVWQYFRDRQ*
Ga0132258_103460405	3300015371	Arabidopsis Rhizosphere	MYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0132258_137529253	3300015371	Arabidopsis Rhizosphere	PFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG*
Ga0132256_1007668831	3300015372	Arabidopsis Rhizosphere	MSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQY
Ga0132256_1030742391	3300015372	Arabidopsis Rhizosphere	MNSALAQVVIPYGNLDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
Ga0132256_1031603712	3300015372	Arabidopsis Rhizosphere	MNSALAQVVIPYGNYDDGFEKYLVAAITFLLLCFAVWQYFRDRK*
Ga0132257_1005312552	3300015373	Arabidopsis Rhizosphere	MSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAAWQYFRDRR*
Ga0132255_1021838891	3300015374	Arabidopsis Rhizosphere	MYMSTALAQVVIPFGDFGDGFKKYLVATITFLLLCFAVW
Ga0132255_1051040721	3300015374	Arabidopsis Rhizosphere	MNSALAQVVIPYGKFDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
Ga0187785_100713712	3300017947	Tropical Peatland	MAQVLIPFGDYGDGFEKYLLAGIAFVLLCVAVWRFFRNRDG
Ga0173481_100028642	3300019356	Soil	MNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK
Ga0173482_100060382	3300019361	Soil	MNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0173479_104055753	3300019362	Soil	MGTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDR
Ga0182009_100553652	3300021445	Soil	MGTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR
Ga0247786_10895201	3300022883	Soil	MNSAMAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0247799_10974212	3300023072	Soil	MNSAMAQVVIPYGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0207666_10072471	3300025271	Corn, Switchgrass And Miscanthus Rhizosphere	MNSTLAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK
Ga0207655_12515491	3300025728	Miscanthus Rhizosphere	MNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFA
Ga0207688_100425022	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MNSALAQVVIPYGSFDDGFEKYLVAAITFLLLCFAVWQYLRDRK
Ga0207680_107051832	3300025903	Switchgrass Rhizosphere	MYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYLRDRK
Ga0207684_117284931	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	LRSTHMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0207707_107949553	3300025912	Corn Rhizosphere	MNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVW
Ga0207660_107074002	3300025917	Corn Rhizosphere	RSELSAATGFAYGRTHMNSAMAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0207650_102018582	3300025925	Switchgrass Rhizosphere	TALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR
Ga0207690_117964602	3300025932	Corn Rhizosphere	AGAFIDRAVAQVVIPFGDFGDGFEKYLVAVIAFVLLCVAVWRFFRNRS
Ga0207706_116136491	3300025933	Corn Rhizosphere	MYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRR
Ga0207709_113895092	3300025935	Miscanthus Rhizosphere	MYMSTALAQVVTPFGDFGDGFEKYLVATITFLLLCFAVWQYFRR
Ga0207679_101807064	3300025945	Corn Rhizosphere	MQMNSALAQVVIPHGNFDDGFEKYTVAAITFLLLCFAVWQYFRNRR
Ga0207679_102823491	3300025945	Corn Rhizosphere	WTHMGTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR
Ga0210071_10164461	3300025955	Natural And Restored Wetlands	MSTALAQVVIPFGDFGDGFEKYLVATITFLFLCFAVWQYFRR
Ga0210089_10306822	3300025957	Natural And Restored Wetlands	MYMSTALAQVVIPFGDFGDGFEKYLVATITFLFLCFAVWQYFRR
Ga0207708_108875662	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	PFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG
Ga0256821_10045943	3300026452	Sediment	MRAAYGRMYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLY
Ga0207530_1003751	3300026655	Soil	THMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0207495_1001741	3300026761	Soil	MNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQY
Ga0207450_1002211	3300026766	Soil	MNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYL
Ga0209969_10759222	3300027360	Arabidopsis Thaliana Rhizosphere	MNSALAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRR
Ga0207553_10050881	3300027435	Soil	THMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK
Ga0207460_1029193	3300027482	Soil	MNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQY
Ga0208890_10121332	3300027523	Soil	VVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRK
Ga0208890_10283222	3300027523	Soil	MNSALAQVVIPYGNFDDGSEKYLVAAITFLLLCFAVWQYFRR
Ga0210002_10011383	3300027617	Arabidopsis Thaliana Rhizosphere	MNSALAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0210002_10011767	3300027617	Arabidopsis Thaliana Rhizosphere	MNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQ
Ga0209177_102285911	3300027775	Agricultural Soil	RMQMNSALAQVVIPHGNFDDGFEKYTVVAITFLLLCFAVWQYFGNRR
Ga0209177_103541261	3300027775	Agricultural Soil	AAAQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG
(restricted) Ga0255311_10222142	3300031150	Sandy Soil	MNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRK
(restricted) Ga0255310_100034992	3300031197	Sandy Soil	MNSALAQVVIPYGNFDDGFEKYLVAAVTFLLLCFAVWQYFRDRK
Ga0307469_100336333	3300031720	Hardwood Forest Soil	MSTALAQVVIPFGDFGDGLEKYLVATITFLLLCFAVWQYFRDRK
Ga0307468_1003518243	3300031740	Hardwood Forest Soil	MYMSTALAQVVIPFGDFGDGLEKYLVATITFLLLCFAVWQYFRDRK
Ga0310885_102176181	3300031943	Soil	MNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFR
Ga0310884_100103434	3300031944	Soil	AVGGDELCLRSTHMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0307472_1010932061	3300032205	Hardwood Forest Soil	MYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters