NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F071036

Metagenome Family F071036

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071036
Family Type Metagenome
Number of Sequences 122
Average Sequence Length 46 residues
Representative Sequence MGKKVVHVEFPAKDADRAQKFWETVGGWSIGDSGMPGIDYRMFQE
Number of Associated Samples 112
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 97.54 %
% of genes from short scaffolds (< 2000 bps) 90.98 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.590 % of family members)
Environment Ontology (ENVO) Unclassified
(28.689 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.443 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.18%    β-sheet: 10.96%    Coil/Unstructured: 69.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF00378ECH_1 54.10
PF07110EthD 6.56
PF16113ECH_2 2.46
PF01740STAS 0.82
PF06772LtrA 0.82
PF13365Trypsin_2 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 0.82

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2044078000|ZMB_F548DK202GKBSDAll Organisms → cellular organisms → Bacteria505Open in IMG/M
3300001305|C688J14111_10272719All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300001538|A10PFW1_10486985All Organisms → cellular organisms → Bacteria1685Open in IMG/M
3300001686|C688J18823_10389371All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300001991|JGI24743J22301_10127744All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300003203|JGI25406J46586_10089083All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300004114|Ga0062593_100961984All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300004156|Ga0062589_101033986All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300004643|Ga0062591_102234409All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300004643|Ga0062591_102424683All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300005175|Ga0066673_10710299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300005294|Ga0065705_10068264All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300005329|Ga0070683_101791597All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300005332|Ga0066388_106994265All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300005340|Ga0070689_101774351All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005355|Ga0070671_101122518All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005434|Ga0070709_11431452All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300005468|Ga0070707_102068155All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005471|Ga0070698_100078367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3303Open in IMG/M
3300005530|Ga0070679_100435077All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300005545|Ga0070695_100488830All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300005553|Ga0066695_10445135All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300006034|Ga0066656_10663008All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300006797|Ga0066659_11380453All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300006903|Ga0075426_11048693All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300006904|Ga0075424_101245095All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300007076|Ga0075435_100385508All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300009012|Ga0066710_101008901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1285Open in IMG/M
3300009090|Ga0099827_11003559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300009098|Ga0105245_10205398All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300009098|Ga0105245_10601034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1126Open in IMG/M
3300009100|Ga0075418_13060975All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300009137|Ga0066709_100708954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1448Open in IMG/M
3300009148|Ga0105243_12680771All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300009176|Ga0105242_11193310All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300009792|Ga0126374_10593001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium816Open in IMG/M
3300009818|Ga0105072_1046059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria825Open in IMG/M
3300010036|Ga0126305_10311825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1023Open in IMG/M
3300010335|Ga0134063_10620273All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300010371|Ga0134125_12395898All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300010373|Ga0134128_10214052All Organisms → cellular organisms → Bacteria2167Open in IMG/M
3300010396|Ga0134126_11515617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300010398|Ga0126383_10990253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium929Open in IMG/M
3300010403|Ga0134123_12975902All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300012198|Ga0137364_11404675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300012198|Ga0137364_11426700All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012200|Ga0137382_10099024All Organisms → cellular organisms → Bacteria1921Open in IMG/M
3300012201|Ga0137365_11335124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300012204|Ga0137374_10472162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria980Open in IMG/M
3300012206|Ga0137380_10022289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5823Open in IMG/M
3300012285|Ga0137370_10755090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300012925|Ga0137419_10203011All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300012961|Ga0164302_11117921All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300012975|Ga0134110_10550915All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300012985|Ga0164308_11256357All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300012986|Ga0164304_11804513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300012987|Ga0164307_11068581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300013102|Ga0157371_10653552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae785Open in IMG/M
3300014157|Ga0134078_10260013All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300014969|Ga0157376_10099653All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium2535Open in IMG/M
3300014969|Ga0157376_10844199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes931Open in IMG/M
3300015265|Ga0182005_1211073All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300015356|Ga0134073_10251555All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300015371|Ga0132258_11415362All Organisms → cellular organisms → Bacteria1756Open in IMG/M
3300015374|Ga0132255_104861431All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300015374|Ga0132255_106306193All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300017997|Ga0184610_1263411All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300018000|Ga0184604_10060830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1074Open in IMG/M
3300018028|Ga0184608_10159596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae976Open in IMG/M
3300018052|Ga0184638_1302690All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300018054|Ga0184621_10333519All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300018061|Ga0184619_10201620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria914Open in IMG/M
3300018071|Ga0184618_10212577All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium811Open in IMG/M
3300018468|Ga0066662_10017075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3965Open in IMG/M
3300019879|Ga0193723_1039785All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300019999|Ga0193718_1008270All Organisms → cellular organisms → Bacteria2263Open in IMG/M
3300020012|Ga0193732_1024354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae1048Open in IMG/M
3300020015|Ga0193734_1005596All Organisms → cellular organisms → Bacteria2312Open in IMG/M
3300020018|Ga0193721_1024771All Organisms → cellular organisms → Bacteria1588Open in IMG/M
3300020018|Ga0193721_1163364All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300020022|Ga0193733_1068456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae998Open in IMG/M
3300021080|Ga0210382_10264811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300025903|Ga0207680_10164246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1491Open in IMG/M
3300025906|Ga0207699_10916345All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300025927|Ga0207687_11040188All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300025928|Ga0207700_10775516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300025929|Ga0207664_10889784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae800Open in IMG/M
3300025933|Ga0207706_10460003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae1100Open in IMG/M
3300025939|Ga0207665_10167403All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300025940|Ga0207691_10623242All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300025960|Ga0207651_11217738All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300025972|Ga0207668_10187034All Organisms → cellular organisms → Bacteria1638Open in IMG/M
3300025981|Ga0207640_11474431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300026524|Ga0209690_1079993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1378Open in IMG/M
3300026530|Ga0209807_1088095All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300026538|Ga0209056_10499666All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300026548|Ga0209161_10489226All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300028381|Ga0268264_11202419All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300028704|Ga0307321_1061640All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300028710|Ga0307322_10029183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae1300Open in IMG/M
3300028712|Ga0307285_10039548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae1152Open in IMG/M
3300028714|Ga0307309_10024002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae1207Open in IMG/M
3300028768|Ga0307280_10013690All Organisms → cellular organisms → Bacteria2246Open in IMG/M
3300028791|Ga0307290_10303113All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300028796|Ga0307287_10373858All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300028807|Ga0307305_10214646All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300028807|Ga0307305_10325473All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300028811|Ga0307292_10136098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae986Open in IMG/M
3300028819|Ga0307296_10699417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300028828|Ga0307312_10513586All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300028828|Ga0307312_10549847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300028878|Ga0307278_10005006All Organisms → cellular organisms → Bacteria6361Open in IMG/M
3300028884|Ga0307308_10040125All Organisms → cellular organisms → Bacteria2192Open in IMG/M
3300028884|Ga0307308_10397072All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300028885|Ga0307304_10002877All Organisms → cellular organisms → Bacteria4908Open in IMG/M
3300028885|Ga0307304_10113846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae1095Open in IMG/M
3300031769|Ga0318526_10460894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300031831|Ga0318564_10089564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1363Open in IMG/M
3300032009|Ga0318563_10439293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300032043|Ga0318556_10724800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300032261|Ga0306920_102297395All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300033475|Ga0310811_10461703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae1352Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.59%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.38%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.10%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.28%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.28%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.28%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.28%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.46%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.64%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.64%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.82%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%
Switchgrass, Maize And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Switchgrass, Maize And Miscanthus Rhizosphere0.82%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.82%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.82%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.82%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2044078000Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, ILEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ZMB_12274502044078000Switchgrass, Maize And Miscanthus RhizosphereMGKRVVHLEFPAQDLERGKKFWEGVGGWEIKDSACPACST
C688J14111_1027271913300001305SoilMAKKMVHVEFPAQDADRAERFWETFAGWSIGDSGMEGFDY
A10PFW1_1048698513300001538PermafrostMGKKIVHVEFPAKDADRSESFWEGFAGWSIENAGMEG
C688J18823_1038937133300001686SoilMGKKVVHVEFPAQDIERAKTFWQGVGGWGINDSGMPGMQYLMWQQDDQGGGI
JGI24743J22301_1012774423300001991Corn, Switchgrass And Miscanthus RhizosphereMGKKVVHVEFPAKDADRAQKFWETVGGWSIGDSGMPGIDYRMFQEDGWGGAVFPEME
JGI25406J46586_1008908313300003203Tabebuia Heterophylla RhizosphereMGKKIVHVEFPAADXDRGERFWEGLGGWTIDSAGMPGIDYR
Ga0062593_10096198413300004114SoilMGKKIVHVEFPAQDADRAQKFWQSFAGWSIGDSGMEGMDYRMFQEDGWGGAVYPQQ
Ga0062589_10103398633300004156SoilMGKKIVHVEFPSKDADRAEKFWEGFGGWSIESSGMEGIDYRMFQEDG
Ga0062591_10223440923300004643SoilMGKKIVHVEFPAKDADRAESFWEGFGGWSIESAGMEGMDYRMFQDDGWGGAVYP
Ga0062591_10242468313300004643SoilMGKKIVHVEFPAQDIERGQKFWKAVGGWDIKDSGMPGMQYLMWQE
Ga0066673_1071029913300005175SoilMGMRVVHVEFPAQDVDRAERFWEAVGGWKIEDSGMAGIDYRMFQEGDQ
Ga0065705_1006826413300005294Switchgrass RhizosphereMGRKIVHVEFPAQDADRAQKFWEGFGEWSLSVPEGMGEFDYRMFQD
Ga0070683_10179159713300005329Corn RhizosphereMGKRMVHVEFPAQDVDRAEKFWEAVGGWSIESMMPGMDYRMYQEG
Ga0066388_10699426513300005332Tropical Forest SoilMGKRIVHVEFPAQDADRAEGFWEGFAGWTIEGAGMEGIDYRMFQD
Ga0070689_10177435123300005340Switchgrass RhizosphereMGKRMVHVEFPAQDVDRAEKFWEAVGGWSIESMMPGMDYRMYQEGDQGGAVYEG
Ga0070671_10112251813300005355Switchgrass RhizosphereMGKRVVHLEFPAQDLERGKKFWEGVGGWEIKDSGMPGMQYLMWQEGDQG
Ga0070709_1143145213300005434Corn, Switchgrass And Miscanthus RhizosphereMGKKIVHVEFPAQDLERGQKFWEGVGGWDVKDSGMPGMQYLMWQQDDQG
Ga0070707_10206815513300005468Corn, Switchgrass And Miscanthus RhizosphereMAKKIVHIEFPADDVDRAELFWEGLGGWPIESAGMEGLDYRMFQDDGWGGAVYP
Ga0070698_10007836713300005471Corn, Switchgrass And Miscanthus RhizosphereMGKKVVHVEFPAQDLERGKKFWEGVGGWSLNDAGMQGMQYLMFQEGDQGGA
Ga0070679_10043507733300005530Corn RhizosphereMGKKVVHLEFPAQDLERGKKFWEGVGGWEIKDSGMPGMQYLMW
Ga0070695_10048883013300005545Corn, Switchgrass And Miscanthus RhizosphereMGKKVVHLEFPAQDLERGKKFWEGVGGWEIKDSGMPGMQYLMWQEGDQGGG
Ga0066695_1044513513300005553SoilMGKKVVHVELPAQDVERGKRFWEAVGGWTIEDAGMPGMQYLMFQE
Ga0066656_1066300833300006034SoilMGKRVVHVEFPAQDVGRAQTFWEGVGGWSIQDAGMPGVQYLMWQEGDQG
Ga0066659_1138045313300006797SoilMGKRIVHVEFPAQDIERSKKFWEGVGGWGINDAGMQGMQ
Ga0075426_1104869313300006903Populus RhizosphereMGKKIVHVEFPAQDLERGKKFWEGVGGWDVNDSGMPGMQYLMWQE
Ga0075424_10124509513300006904Populus RhizosphereMGKKVVHLEFPAQDLERGKKFWEGVGGWEIKDSGMPGM
Ga0075435_10038550833300007076Populus RhizosphereMGKRVVHVEFPAQDADRGERFWEAVGGWSIEGAGMPGIDYRMFQEGDQGGAVYP
Ga0066710_10100890133300009012Grasslands SoilVGKKVVHVEFPAQDVDRAERFWEGVGGWSIEDAGMPGMQYRMFQDGD
Ga0099827_1100355933300009090Vadose Zone SoilMGKKVVHVEFPAQDVDRAERFWEGVGGWSIEDAGM
Ga0105245_1020539843300009098Miscanthus RhizosphereMGKRMVHVEFPAQDVDRAEKFWEAVGGWSIESMMPGMDYRMY
Ga0105245_1060103433300009098Miscanthus RhizosphereMGKKIVHVEFPARDADRAAKFWESFAGWSIRDSGME
Ga0075418_1306097513300009100Populus RhizosphereMGKKIVHVEFPSKDADRGERFWEGFGGWTIESAGMPGMDYRMFQDDGWGG
Ga0066709_10070895443300009137Grasslands SoilVGKKVVHVEFPAPDVDRAKRSWEGVGGWSIEDAGMLGMQCRMFQDGE*
Ga0105243_1268077113300009148Miscanthus RhizosphereMGRKIVHVEFPAQDADRGQKFWEGFGEWSLSVPEGMGDFDYRMFQDDGWGGAV
Ga0105242_1119331033300009176Miscanthus RhizosphereMGKKVVHIEFPAKDADRAQKFWETVGGWSIGDSGM
Ga0126374_1059300133300009792Tropical Forest SoilMGKHIVHVEFPAQNADRAEGFWESFAGWTIEGSGMEGIDYRMFQDEGWGGAVYPQQEGEH
Ga0105072_104605913300009818Groundwater SandMGMKVVHVEFPAQDVDRAQKFWEGVGGWSIQDSGMPGI
Ga0126305_1031182533300010036Serpentine SoilMGKRIVHVEFPAKDADRAESFWEGLGGWSIGDSGMPGIDYRMFQ
Ga0134063_1062027333300010335Grasslands SoilMGKKVVHVEFPAQDADRGQKFWEGVGGWSIKDSGM
Ga0134125_1239589833300010371Terrestrial SoilMGKKIVHVEFPAQDLERGQKFWEGVGGWDVKDSGM
Ga0134128_1021405243300010373Terrestrial SoilMGKKVVHVEFPAKDADRAQKFWETVGGWSIGDSGM
Ga0134126_1151561713300010396Terrestrial SoilMGKKIVHVEFPAQDNDRAEKFWEGFGGWEIKDSGMEGIDYRMFQD
Ga0126383_1099025313300010398Tropical Forest SoilMGKHIVHVEFPAQNADRAEGFWESFAGWTIEGSGMEGIDYRMFQDEGWGGAVYPQQ
Ga0134123_1297590213300010403Terrestrial SoilMGRKIVHVEFPAQDTDRAQKFWEGFGGWQLSVPQGM
Ga0137364_1140467513300012198Vadose Zone SoilMGKKVVHVEFPAKDADRGQKFWEGVGGWSIKDSGMPGIDYRMFQEGDQGGAIFS
Ga0137364_1142670023300012198Vadose Zone SoilMGKSIVHVEFPAQDTDRGTSFWSSFAGWEIKDAGMPGIDYRMFQEDGW
Ga0137382_1009902443300012200Vadose Zone SoilMGKKVVHVEFPSQDVDRAETFWEGIGGWSIESAGMPGLDYRMFQEGEQGGAV
Ga0137365_1133512423300012201Vadose Zone SoilMGKKIVHVEFPAQDAERGKKFWEGVGGWTLKDAGMPG
Ga0137374_1047216233300012204Vadose Zone SoilMGKKIVHVEFPAKDADRGEKFWEGLGGWSIEGAGMEGIDYRMFQDDGWGG
Ga0137380_1002228913300012206Vadose Zone SoilMGKKIVHVEFPAQNLERGKKFWEGVGGWSLNDAGMP
Ga0137370_1075509033300012285Vadose Zone SoilMGKKVVHVEFPAQDADRGQKFWEGVGGWSIQNSGMPGIDYRMFQ
Ga0137419_1020301143300012925Vadose Zone SoilMGKKVVHVEFPSQDVDRAETFWEGIGGWSIESAGMPGLDYRMFQEGE
Ga0164302_1111792133300012961SoilMGKRMVHIEFPAQDVDRAEKFWEAVGGWSIESMMPGMDYRMYQEGDQ
Ga0134110_1055091523300012975Grasslands SoilMGKKVVHVEFPAQDADRGQKFWEGVGGWTIQDAGMPGIDYRMFHE
Ga0164308_1125635713300012985SoilMGKKMVHVEFPAQDLERGKKFWEGVGGWQVNDSGMPGMQYLMWQEGDQ
Ga0164304_1180451323300012986SoilMGKKIVHVEFPAKDANRAEGFWEGLGGWSIEDSGMAGMDYRMFQDDGWGG
Ga0164307_1106858133300012987SoilMGKKVVHVEFPAQNVDATQKFWEAVGGWSIKDSGMPGIDYRMFQECDQGGAIYPPMGDE
Ga0157371_1065355213300013102Corn RhizosphereMGKKVVHVEFPAKDADRAQKFWETVGGWSIGDSGMPGID
Ga0134078_1026001333300014157Grasslands SoilVEFPAQDVGRAQTFWEGVGGWSIQDAGMPGVQYLMWQEGDQGGAVYSMEGQ
Ga0157376_1009965313300014969Miscanthus RhizosphereVRRKGGGIGKKIVHVEFPAQDADRAQKFWQSFAGWSIGDSGMEGMDYRMFQEDGW
Ga0157376_1084419933300014969Miscanthus RhizosphereMGKRMVHVEFPAQDVDRAEKFWEAVGGWSIESMMPGMDYR
Ga0182005_121107333300015265RhizosphereMGKRIVHVEFPSDDADRAESFWENFAGWTIEGSGME
Ga0134073_1025155533300015356Grasslands SoilMGKRIVHVEFPAKELDRGKKFWESVGGWSMNDAGMQGMQYLMWQEGDQGG
Ga0132258_1141536243300015371Arabidopsis RhizosphereMGKRIVHVEFPSQDADRAERFWEGFAGWDIQDSGMEGMDYRMFQDEGWGGAVYP
Ga0132255_10486143113300015374Arabidopsis RhizosphereMGKKMVHVEFPAQDLERGKKFWEGVGGWDVKDSGMPGMQ
Ga0132255_10630619313300015374Arabidopsis RhizosphereMGKAIVHVEFPAKDADRAQKFWEGAGEWKLSVPQGMEEFDYRMFQEDGWGGAVYPQQ
Ga0184610_126341113300017997Groundwater SedimentMGKKIVHVEFPAKDADRAESFWEGLGGWSIESAGMEGLDYRMFQDDGWGGAVYPQQ
Ga0184604_1006083033300018000Groundwater SedimentMGKKIVHIEFPAQDLDRAEKFWEAVGGWSIEGMDMP
Ga0184608_1015959613300018028Groundwater SedimentMGKKVVHVEFPAQDIDRGKKFWEGVGGWSLNDAGMPGMQYLMFQEDDQGGAVYS
Ga0184638_130269013300018052Groundwater SedimentMGKKVVHVEFPAEDVDRAEKFWEGLGGWSIEDAGMPGIDYRMFQE
Ga0184621_1033351913300018054Groundwater SedimentMGKKIVHVEFPAQDVDRAEKFWEAVGGWSIEGMNMPGIDYRMYQEGDQGGA
Ga0184619_1020162013300018061Groundwater SedimentMGKRVVHVEFPAQDVDRAERFWEGVGGWSIEDAGMPGID
Ga0184618_1021257713300018071Groundwater SedimentMGKKIVHVEFPSKDADRAEAFWEGLGGWSIESAGMEGLDYRMFQQESEGQW
Ga0066662_1001707513300018468Grasslands SoilMGKKVVHVEFPAQDVDRAERFWEGVGEWSIEDAGMPGMEYRMFQDGDQGGAV
Ga0193723_103978513300019879SoilMGKKVVHIEFPAKDADRAQKFWEAVGGWSIADSGMPG
Ga0193718_100827013300019999SoilMGKKVVHIEFPAKDADRAQKFWEGVGGWSIGDSGMPGID
Ga0193732_102435433300020012SoilMGKKVVHIEFPAKDADRAQKFWETVGGWSIGDSGMPG
Ga0193734_100559653300020015SoilMGKKVVHIEFPAKDADRAQKFWEGVGGWSIGDSGMPGIDYRMFQEDGWGGA
Ga0193721_102477113300020018SoilMGKKVVHIEFPAKDADRAQKFWEGVGGWSIGDSGMPGIDYRMFQEDGWGGAVFPEMEGAS
Ga0193721_116336423300020018SoilMGKKIVHVEFPAQDLDRAEKFWEAVGGWSIEGMGMPGIDYRMYQEGDQGGAVYA
Ga0193733_106845613300020022SoilMGKKIVHIEFPAQDLDRAEKFWEAVGGWSIEGMNMPGVDRR
Ga0210382_1026481133300021080Groundwater SedimentMGKKIVHVEFPAQDLDRAEKFWEAVGGWSIEGMDMPGVDYRMY
Ga0207680_1016424613300025903Switchgrass RhizosphereMGKKVVHVEFPAKDADRAQKFWETVGGWSIGDSGMPGIDYRMFQEDGWGGAVFPEMEGASGTTI
Ga0207699_1091634533300025906Corn, Switchgrass And Miscanthus RhizosphereMGKKIVHVEFPAQDLERGQKFWEGVGGWDVKDSGMPGMQYLMWQQDDQGGGIY
Ga0207687_1104018813300025927Miscanthus RhizosphereMGKRMVHVEFPAQDVDRAEKFWEAVGGWSIESMMPGMDY
Ga0207700_1077551613300025928Corn, Switchgrass And Miscanthus RhizosphereMGKKVVHVEFPAKDADRAQKFWETVGGWSIGDSGMPGIDYRMFQEDGWGGAVFPEMEGASGT
Ga0207664_1088978433300025929Agricultural SoilMGKKIVHVEFPAQDLERGQKFWEGVGGWDVKDYGM
Ga0207706_1046000333300025933Corn RhizosphereMGKKVVHVEFPAKDADRAQKFWETVGGWSIGDSGMPGIDYRMFQE
Ga0207665_1016740343300025939Corn, Switchgrass And Miscanthus RhizosphereMGKKVVHIEFPAKDADRAQKFWETVGGWSIGDSGMPGIDYR
Ga0207691_1062324233300025940Miscanthus RhizosphereMGKRIVHVEFPAQDIDRGQKFWEGVGGWSLNDAGMPGGKY
Ga0207651_1121773813300025960Switchgrass RhizosphereMGKKVVHVEFPAKDADRAQKFWETVGGWSIGDSGMPGIDYRMFQEDGWGGAVFPEMEGASGTTICFDSD
Ga0207668_1018703443300025972Switchgrass RhizosphereMGKKVVHVEFPAKDADRAQKFWETVGGWSIGGSRMPGID
Ga0207640_1147443133300025981Corn RhizosphereMGKRVVHVEFPAQDLERGKKFWEGVGGWKIEDSGMAGMQYLMWQEGDQGGG
Ga0209690_107999343300026524SoilLGKKVVHVEFPSQDVDRAQTFWEGIGGWSIESAGMPGLDYR
Ga0209807_108809513300026530SoilMGKKIVHVEFPAQDVERGKKFWEGVGGWSLNDAGMPGMQYL
Ga0209056_1049966633300026538SoilLGKKVVHVEFPSQDVDRAQTFWEGIGGWSIESAGMPGLDYRMFQEGEQGGAVYPGDAGV
Ga0209161_1048922613300026548SoilLGKKVVHVEFPSQDVDRAQTFWEGIGGWSIESAGMPGLDYRMFQEG
Ga0268264_1120241933300028381Switchgrass RhizosphereMGKKVVHVEFPAKDADRAQKFWETVGGWSIGDSGMPG
Ga0307321_106164033300028704SoilMGKKVVHVEFPAQDIDRGKKFWEGVGGWSLNDAGMPGMQYLMFQEGD
Ga0307322_1002918313300028710SoilMGKKVVHVEFPAQDIDRGKKFWEGVGGWSLNDAGMP
Ga0307285_1003954813300028712SoilMGKKVVHIEFPAKDADRAQKFWETVGGWSIGDSGMPGIDYRMFQEDGWGGAFFPE
Ga0307309_1002400233300028714SoilMGKKVVHIEFPAKDADRAQKFWETVGGWSIGDSGMPDI
Ga0307280_1001369053300028768SoilMGKKVVHIEFPAKDADRAQKFWETVGGWSIGDSGMPGI
Ga0307290_1030311333300028791SoilMGKKIVHIEFPAQDVDRAEKFWEAVGGWSIEGMNMPGIDY
Ga0307287_1037385813300028796SoilMGKKIVHVEFPAQDVDRAEKFWEAVGGWSIESAMPGMDYRM
Ga0307305_1021464613300028807SoilMGKKIVHVEFPAKDADRGEKFWEGFAGWSIESAGMEGMDYRMFQEDGW
Ga0307305_1032547313300028807SoilMGKKIVHVEFPAQDVDRAEKFWEAVGGWSIEGMNMPGIDYRMYQEGDHG
Ga0307292_1013609813300028811SoilMGKKIVHVEFPAQDVDRAEKFWEAVGGWSIEGMSMPGVDYR
Ga0307296_1069941723300028819SoilMGKKIVHVEFPTKDVDRGERFWEGLGGWSIEGAGMEGIDYRMFQDDGWGGAVYPN
Ga0307312_1051358613300028828SoilMGKKIVHIEFPAQDVDRAEKFWEAVGGWSIEGMNMPGIDYRMYQEGDQ
Ga0307312_1054984713300028828SoilMGKKIVHVEFPAQDLDRAEKFWEAVGGWSIEGMGMPGIDYRMYQE
Ga0307278_1000500613300028878SoilMGKRVVHVEFPAQDAERGKKFWEGVGGWTLNDAGMPGGQYLMFQEGDQGGA
Ga0307308_1004012513300028884SoilMGKKIVHVEFPAQDVDRAEKFWEAVGGWSIEGMNMPG
Ga0307308_1039707233300028884SoilMGKKIVHIEFPAQDVDRAEKFWEAVGGWSIEGMNMPGVDYRMYQEGDQGGAV
Ga0307304_1000287773300028885SoilMGKKVVHIEFPAKDADRAQKFWETVGGWSIGDSGMPDIDYRMFQEDGWGGAVFPEMEGAS
Ga0307304_1011384613300028885SoilMGKKVVHVEFPAQDIDRGKKFWEGVGGWSLNDAGMPGMQYLMFQEGDQGG
Ga0318526_1046089413300031769SoilMGKSIVHVEFPAKDTDRAEGFWEGFAGWTIESAGM
Ga0318564_1008956443300031831SoilMGKSIVHVEFPAKDTDRAEGFWEGFAGWTIESAGMEGMDYRMFQDEG
Ga0318563_1043929313300032009SoilMGKSIVHVEFPAKDTDRAEGFWEGFAGWTIESAGMEG
Ga0318556_1072480013300032043SoilMGKSIVHVEFPAKDTDRAEGFWEGFAGWTIESAGMEGMDYRMFQ
Ga0306920_10229739513300032261SoilMGRKIVHVEFPAQDADRAQKFWEGFGGWQLSVPPGMEDFGYRMFQDDGWG
Ga0310811_1046170313300033475SoilMGKKVVHLEFPAQDLERGKKFWEGVGGWEIKDSGMPGMQYLMWQEGDQGG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.