| Basic Information | |
|---|---|
| Family ID | F070953 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.54 % |
| % of genes near scaffold ends (potentially truncated) | 99.18 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.066 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (30.328 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.918 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.754 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.07 % |
| Unclassified | root | N/A | 13.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004467|Ga0068978_1235359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 605 | Open in IMG/M |
| 3300004468|Ga0068977_1007747 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 768 | Open in IMG/M |
| 3300004470|Ga0068967_1327204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 753 | Open in IMG/M |
| 3300004505|Ga0068941_1153333 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| 3300004598|Ga0068975_1262204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 761 | Open in IMG/M |
| 3300004599|Ga0068933_1269552 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
| 3300004609|Ga0068958_1003487 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 622 | Open in IMG/M |
| 3300004615|Ga0068926_1000900 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 761 | Open in IMG/M |
| 3300004964|Ga0072331_1003619 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300005640|Ga0075035_1015416 | Not Available | 608 | Open in IMG/M |
| 3300006860|Ga0063829_1004127 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 707 | Open in IMG/M |
| 3300006861|Ga0063777_1025703 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 581 | Open in IMG/M |
| 3300010164|Ga0063827_137540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
| 3300010859|Ga0126352_1083185 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 576 | Open in IMG/M |
| 3300010860|Ga0126351_1075043 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 654 | Open in IMG/M |
| 3300010860|Ga0126351_1190932 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 672 | Open in IMG/M |
| 3300010877|Ga0126356_10913854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 625 | Open in IMG/M |
| 3300011017|Ga0138558_116923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 741 | Open in IMG/M |
| 3300011021|Ga0138529_122910 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
| 3300011024|Ga0138530_112337 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 718 | Open in IMG/M |
| 3300011028|Ga0138577_138800 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
| 3300011039|Ga0138593_155476 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 795 | Open in IMG/M |
| 3300011040|Ga0138587_145910 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
| 3300011043|Ga0138528_116494 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 704 | Open in IMG/M |
| 3300011044|Ga0138545_164057 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 510 | Open in IMG/M |
| 3300011045|Ga0138598_138497 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 643 | Open in IMG/M |
| 3300011047|Ga0138553_164681 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 590 | Open in IMG/M |
| 3300011050|Ga0138571_178488 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 783 | Open in IMG/M |
| 3300011051|Ga0138540_133439 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 797 | Open in IMG/M |
| 3300011056|Ga0138538_1086491 | Not Available | 544 | Open in IMG/M |
| 3300011058|Ga0138541_1038370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 791 | Open in IMG/M |
| 3300011060|Ga0138583_1066021 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 540 | Open in IMG/M |
| 3300011063|Ga0138537_1118794 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 765 | Open in IMG/M |
| 3300011069|Ga0138592_1000812 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 765 | Open in IMG/M |
| 3300011072|Ga0138563_1035301 | Not Available | 621 | Open in IMG/M |
| 3300011073|Ga0138584_1153230 | Not Available | 665 | Open in IMG/M |
| 3300011074|Ga0138559_1114342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
| 3300011075|Ga0138555_1117836 | Not Available | 578 | Open in IMG/M |
| 3300011075|Ga0138555_1139441 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 603 | Open in IMG/M |
| 3300011078|Ga0138565_1069978 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 628 | Open in IMG/M |
| 3300011080|Ga0138568_1133376 | Not Available | 645 | Open in IMG/M |
| 3300011120|Ga0150983_14007061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 601 | Open in IMG/M |
| 3300011120|Ga0150983_16645876 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 836 | Open in IMG/M |
| 3300011305|Ga0138532_1021833 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 619 | Open in IMG/M |
| 3300012411|Ga0153880_1054840 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
| 3300012411|Ga0153880_1190609 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 603 | Open in IMG/M |
| 3300012411|Ga0153880_1371308 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 752 | Open in IMG/M |
| 3300012411|Ga0153880_1392421 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 748 | Open in IMG/M |
| 3300014156|Ga0181518_10470962 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 598 | Open in IMG/M |
| 3300016700|Ga0181513_1015968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 507 | Open in IMG/M |
| 3300016700|Ga0181513_1153222 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 719 | Open in IMG/M |
| 3300016701|Ga0181509_1152375 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 546 | Open in IMG/M |
| 3300016701|Ga0181509_1182246 | Not Available | 540 | Open in IMG/M |
| 3300016701|Ga0181509_1314470 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 526 | Open in IMG/M |
| 3300016705|Ga0181507_1218677 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
| 3300016705|Ga0181507_1223566 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 624 | Open in IMG/M |
| 3300016705|Ga0181507_1224250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 608 | Open in IMG/M |
| 3300016750|Ga0181505_10539724 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 751 | Open in IMG/M |
| 3300016750|Ga0181505_10726370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
| 3300019158|Ga0184580_103365 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300019163|Ga0184581_119867 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 783 | Open in IMG/M |
| 3300019177|Ga0184592_118250 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| 3300019179|Ga0184593_112424 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 782 | Open in IMG/M |
| 3300019181|Ga0184594_127766 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 769 | Open in IMG/M |
| 3300019185|Ga0184587_103936 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 770 | Open in IMG/M |
| 3300019188|Ga0184599_118589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 653 | Open in IMG/M |
| 3300019189|Ga0184585_151452 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
| 3300019192|Ga0184603_100225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 732 | Open in IMG/M |
| 3300019240|Ga0181510_1034399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 698 | Open in IMG/M |
| 3300019240|Ga0181510_1113297 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 581 | Open in IMG/M |
| 3300019240|Ga0181510_1287080 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 591 | Open in IMG/M |
| 3300019242|Ga0181502_1048411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 527 | Open in IMG/M |
| 3300019256|Ga0181508_1633886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 610 | Open in IMG/M |
| 3300019258|Ga0181504_1075806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 718 | Open in IMG/M |
| 3300019258|Ga0181504_1215675 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 555 | Open in IMG/M |
| 3300019260|Ga0181506_1148436 | Not Available | 575 | Open in IMG/M |
| 3300019260|Ga0181506_1182848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 747 | Open in IMG/M |
| 3300019260|Ga0181506_1447133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 586 | Open in IMG/M |
| 3300019268|Ga0181514_1144521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 749 | Open in IMG/M |
| 3300019268|Ga0181514_1443626 | Not Available | 780 | Open in IMG/M |
| 3300019270|Ga0181512_1032183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 747 | Open in IMG/M |
| 3300019275|Ga0187798_1030555 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 762 | Open in IMG/M |
| 3300019275|Ga0187798_1248352 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 712 | Open in IMG/M |
| 3300019275|Ga0187798_1501721 | Not Available | 794 | Open in IMG/M |
| 3300019284|Ga0187797_1849801 | Not Available | 663 | Open in IMG/M |
| 3300021858|Ga0213852_1270536 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 543 | Open in IMG/M |
| 3300021860|Ga0213851_1812339 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 754 | Open in IMG/M |
| 3300022498|Ga0242644_1011556 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 800 | Open in IMG/M |
| 3300022499|Ga0242641_1015284 | Not Available | 732 | Open in IMG/M |
| 3300022501|Ga0242645_1022304 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 568 | Open in IMG/M |
| 3300022507|Ga0222729_1017959 | Not Available | 813 | Open in IMG/M |
| 3300022508|Ga0222728_1027034 | Not Available | 866 | Open in IMG/M |
| 3300022512|Ga0242676_1035274 | Not Available | 579 | Open in IMG/M |
| 3300022513|Ga0242667_1038198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 574 | Open in IMG/M |
| 3300022522|Ga0242659_1045718 | Not Available | 761 | Open in IMG/M |
| 3300022523|Ga0242663_1057876 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 698 | Open in IMG/M |
| 3300022532|Ga0242655_10132771 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 715 | Open in IMG/M |
| 3300022709|Ga0222756_1088352 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 516 | Open in IMG/M |
| 3300022711|Ga0242674_1017996 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
| 3300022711|Ga0242674_1018257 | Not Available | 800 | Open in IMG/M |
| 3300022712|Ga0242653_1032009 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 792 | Open in IMG/M |
| 3300022713|Ga0242677_1057144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 586 | Open in IMG/M |
| 3300022714|Ga0242671_1032483 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 796 | Open in IMG/M |
| 3300022720|Ga0242672_1038244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 761 | Open in IMG/M |
| 3300022722|Ga0242657_1074538 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 794 | Open in IMG/M |
| 3300023539|Ga0247555_101197 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 782 | Open in IMG/M |
| 3300023547|Ga0247554_102767 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 666 | Open in IMG/M |
| 3300023558|Ga0247526_110283 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300028573|Ga0265334_10101748 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1040 | Open in IMG/M |
| 3300030535|Ga0210285_1453168 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 760 | Open in IMG/M |
| 3300030586|Ga0265393_1029548 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 891 | Open in IMG/M |
| 3300030589|Ga0210255_10846181 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 792 | Open in IMG/M |
| 3300030743|Ga0265461_10566788 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 966 | Open in IMG/M |
| 3300030762|Ga0265775_103746 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 831 | Open in IMG/M |
| 3300030863|Ga0265766_1005447 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300030880|Ga0265776_102923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
| 3300030880|Ga0265776_113272 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 510 | Open in IMG/M |
| 3300030978|Ga0265757_102854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| 3300031018|Ga0265773_1010523 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 782 | Open in IMG/M |
| 3300031591|Ga0310116_113445 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 735 | Open in IMG/M |
| 3300031866|Ga0316049_105892 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
| 3300034652|Ga0316598_139946 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 679 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 30.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 18.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.28% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 3.28% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.28% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.64% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.82% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.82% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004467 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 75 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004470 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004505 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 29 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004598 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004599 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004609 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004615 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004964 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300005640 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010164 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011017 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 39 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011021 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 7 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011024 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 8 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011028 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 64 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011039 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 20 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011040 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 79 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011043 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011044 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 26 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011045 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 66 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011047 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011050 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 56 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011051 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011056 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 16 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011058 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011060 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011063 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011069 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011072 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011305 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012411 | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016701 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019158 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019163 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019177 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019179 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019185 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019189 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023539 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023558 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300030535 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030586 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030589 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030978 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300034652 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068978_12353592 | 3300004467 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCFRRGFQA |
| Ga0068977_10077472 | 3300004468 | Peatlands Soil | MLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHTAALRLF |
| Ga0068967_13272042 | 3300004470 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFQAA |
| Ga0068941_11533331 | 3300004505 | Peatlands Soil | MLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHTAALRL |
| Ga0068975_12622042 | 3300004598 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFHAAALR |
| Ga0068933_12695521 | 3300004599 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAALRLF |
| Ga0068958_10034872 | 3300004609 | Peatlands Soil | MLPFDRGFTRIEGEGGTSCRRPFPGCPGLSQSCSRRVFHAAALRL |
| Ga0068926_10009002 | 3300004615 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAALR |
| Ga0072331_10036192 | 3300004964 | Peatlands Soil | MLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHTAALRLFY |
| Ga0075035_10154161 | 3300005640 | Permafrost Soil | VIVPFDSGFTHSEGEGGTSCHHPFPGHPGLSQSCS |
| Ga0063829_10041271 | 3300006860 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRR |
| Ga0063777_10257031 | 3300006861 | Peatlands Soil | VISPIDRGFTRIAGEGGTSCRRPFPGRPGLSQSCSRRVFHAAALRLF |
| Ga0063827_1375401 | 3300010164 | Peatlands Soil | MLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHTAALR |
| Ga0126352_10831851 | 3300010859 | Boreal Forest Soil | VPVDCGYIRLEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF |
| Ga0126351_10750431 | 3300010860 | Boreal Forest Soil | VPVDCGYIRLEGEGGTSCHRPFPGHPGLSQSCFRRGFQTAELRL |
| Ga0126351_11909321 | 3300010860 | Boreal Forest Soil | VPFDSGFTHSEGEGGTSCHLPFPGHQGLSQSCSRRVFHTAAPRL |
| Ga0126356_109138541 | 3300010877 | Boreal Forest Soil | VPFDCGFTRPEGDGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF |
| Ga0138558_1169232 | 3300011017 | Peatlands Soil | MLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHT |
| Ga0138529_1229101 | 3300011021 | Peatlands Soil | MLPFDTGFTRFEGEDGTSCHPPFPGNPGLSQSCSRRIFHTAALRL |
| Ga0138530_1123371 | 3300011024 | Peatlands Soil | VILPADRGFTRIEGEGGTSCHLPFPGRPGLSQPCSRRVFHAAALRLF |
| Ga0138577_1388002 | 3300011028 | Peatlands Soil | MLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRR |
| Ga0138593_1554761 | 3300011039 | Peatlands Soil | MLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFH |
| Ga0138587_1459101 | 3300011040 | Peatlands Soil | MLPFDTGFTRFEGEDGTSCHPPFPGRPRLSQSCSRRIFHTAALRL |
| Ga0138528_1164941 | 3300011043 | Peatlands Soil | VILPADRGFTRIEGEGGTSCHLPFPGRPGLSQPCSRRVFHAAALR |
| Ga0138545_1640571 | 3300011044 | Peatlands Soil | VILPADRGFTRIEGEGGTSCHLPFPGRPGLSRPRSRRVFQAAAL |
| Ga0138598_1384971 | 3300011045 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQPCFRRGFQAFTLRL |
| Ga0138553_1646812 | 3300011047 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFHAAAL |
| Ga0138571_1784882 | 3300011050 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLPQSCSRRVFQAAALR |
| Ga0138540_1334391 | 3300011051 | Peatlands Soil | VISPIDRGFTRIAGEGGTSCRRPFPGRPGLSQSCSRRIFHTAALRLF |
| Ga0138538_10864911 | 3300011056 | Peatlands Soil | VPVDCGFIRLEGEGGTSCHRPFPGHPGLSQPCFRR |
| Ga0138541_10383702 | 3300011058 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVF |
| Ga0138583_10660211 | 3300011060 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQPCFRRGFQASALRL |
| Ga0138537_11187941 | 3300011063 | Peatlands Soil | MLPFDRGFTRIEGEGGTSCRRPFPGCPGLSQSCSRRIFHSSALRLF |
| Ga0138592_10008121 | 3300011069 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRIFHTAALRL |
| Ga0138563_10353011 | 3300011072 | Peatlands Soil | VPFDCGFTRLEGDGDTSCHRPFPGHPGLSQSCSRRVFHTAA |
| Ga0138584_11532301 | 3300011073 | Peatlands Soil | VPFDCGFTRLEGDGDTSCHRPFPGHPGLSQSCSRRGFQAFALRLF |
| Ga0138559_11143421 | 3300011074 | Peatlands Soil | VISPIDRGFTRIAGEGGTSCRRPFPGRPGLSQSCSRRVFHAAALRLFYQ |
| Ga0138555_11178361 | 3300011075 | Peatlands Soil | VPFDCGFTRLEGDGDTSCHRPFPGHPGLSQSCSRRGFQAFALRL |
| Ga0138555_11394411 | 3300011075 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFQ |
| Ga0138565_10699782 | 3300011078 | Peatlands Soil | MLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRIFHTAALRLF |
| Ga0138568_11333762 | 3300011080 | Peatlands Soil | VPFDCGFIRLEGEGDTSCHLPFPGHPGLSQSCSRRVFHTAAPRLF |
| Ga0150983_140070611 | 3300011120 | Forest Soil | VPFDCGFIRLEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRL |
| Ga0150983_166458762 | 3300011120 | Forest Soil | MLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALRLLPR |
| Ga0138532_10218331 | 3300011305 | Peatlands Soil | VPVDCGFIRLEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF |
| Ga0153880_10548401 | 3300012411 | Freshwater Sediment | VILPADRGFTRIGGDGGTSCRLPFPGHPGLSQSCFRRVFHAAALRLF |
| Ga0153880_11906091 | 3300012411 | Freshwater Sediment | MTPAEELVMLPFDRGFTRSEGDGGTSCHRPFPGRPGLSQSCIRRVFQAAALRL |
| Ga0153880_13713081 | 3300012411 | Freshwater Sediment | VILPVDHGFTRIGGEDGTSCRLPFPGHPGLSQSCFRRVFHAAALRLFY |
| Ga0153880_13924211 | 3300012411 | Freshwater Sediment | VPVDRGFTRIEGDGGTSCRRPFPGHPGLSQSCSRRVFHTAALRLF |
| Ga0181518_104709622 | 3300014156 | Bog | MLPFDRGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHT |
| Ga0181513_10159681 | 3300016700 | Peatland | MLPFDRGFTRAEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAA |
| Ga0181513_11532221 | 3300016700 | Peatland | VILPADRGFTRIEGEGGTSCHLPFPGRPGLSQSCSRRVFHAAAL |
| Ga0181509_11523751 | 3300016701 | Peatland | MLPFDRGFTRFGGEGGTSCHRPFPGCPGLSQSCSRRVFHAAALR |
| Ga0181509_11822461 | 3300016701 | Peatland | MLPFDRGFTRFEGEGGTSCHHPFPGRPGLSQSCSRRVF |
| Ga0181509_13144701 | 3300016701 | Peatland | VILPADRGFTRIEGEGGTSCHLPFPGRPGLSQSCSRRVFHAAALRL |
| Ga0181507_12186771 | 3300016705 | Peatland | VILPADRGFTRIEGEGGTSCHLPFPGRPGLSQSCSRRVFHAAALRLLDR |
| Ga0181507_12235662 | 3300016705 | Peatland | MLPFDRGFTRAEGDGGTSCHRPFPGRPGLSQSCSRRVFQAAALRLRRNAVY |
| Ga0181507_12242501 | 3300016705 | Peatland | MLPFDRGFTRAEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAALRLR |
| Ga0181505_105397241 | 3300016750 | Peatland | VILPADRGFTRIEGEGGTSCHLPFPGRPGLSQSCSRRVFHTA |
| Ga0181505_107263702 | 3300016750 | Peatland | MLPFDRGFTRFGGEGGTSCHRPFPGCPGLSQSCSRRVFHAA |
| Ga0184580_1033651 | 3300019158 | Soil | MLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALR |
| Ga0184581_1198671 | 3300019163 | Soil | MLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRR |
| Ga0184592_1182501 | 3300019177 | Soil | MLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALR |
| Ga0184593_1124241 | 3300019179 | Soil | MLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSR |
| Ga0184594_1277661 | 3300019181 | Soil | MLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALRLF |
| Ga0184587_1039362 | 3300019185 | Soil | MLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVF |
| Ga0184599_1185891 | 3300019188 | Soil | VPFDCGFIRLEGEGGTSCHLPFPGHPGLSQSCSRRVFHTAAPR |
| Ga0184585_1514521 | 3300019189 | Soil | MLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHPAALR |
| Ga0184603_1002251 | 3300019192 | Soil | VPFDCGFIRLEGEGGTSCHLPFPGHPGLSQSCSRRVFHTAAPRLF |
| Ga0181510_10343991 | 3300019240 | Peatland | VPCDNGLTHSEGEGGTSCHHPFPGHPGLSQSCSRRVFHTAA |
| Ga0181510_11132971 | 3300019240 | Peatland | VPFDLGFTRFEGDGGTSCHRPFPGHPGLSQSCSQRVFHTAALRLF |
| Ga0181510_12870801 | 3300019240 | Peatland | MLPFDRGFTRAEGDGGTSCHRPFPGRPGLSQSCSRRVFQAAA |
| Ga0181502_10484111 | 3300019242 | Peatland | MLPFDRGFTRAEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAALRLFYQG |
| Ga0181508_16338861 | 3300019256 | Peatland | MLPFDRGFTRAEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAALRLF |
| Ga0181504_10758061 | 3300019258 | Peatland | VPCDNGLTHSEGEGGTSCHHPFPGHPGLSQSCSRRVFHT |
| Ga0181504_12156751 | 3300019258 | Peatland | MTPAEELVILPFDRGFARSEGDGGTSCHRPFPGRPGLSQSCSRRVFQAAAPR |
| Ga0181506_11484362 | 3300019260 | Peatland | VPFDLGFTRFEGDGGTSCHRPFPGHPGLSQSCSQRVFHTAALR |
| Ga0181506_11828481 | 3300019260 | Peatland | VPCDNGLTHSEGEGGTSCHHPFPGHPGLSQSCSRRVFHTAAPR |
| Ga0181506_14471331 | 3300019260 | Peatland | MLPFDRGFTRAEGDGGTSCHRPFPGRPGLSQSCSRRVF |
| Ga0181514_11445211 | 3300019268 | Peatland | VPCDNGLTHSEGEGGTSCHHPFPGHPGLSQSCSRRVFHTAAPRL |
| Ga0181514_14436261 | 3300019268 | Peatland | VPFDLGFTRFEGDGGTSCHSPFPGHPGLSQSCSQRVFHTAALR |
| Ga0181512_10321831 | 3300019270 | Peatland | VPCDNGLTHSEGEGGTSCHHPFPGHPGLSQSCSRRVFHTAALR |
| Ga0187798_10305551 | 3300019275 | Peatland | MLPIDRGFTRAAGEGGTSCRLPFPGCPGSSQSCSRRIFHIAALRL |
| Ga0187798_12483521 | 3300019275 | Peatland | VMVPSDRGLTRIEGGGGTSCRRPFPGHPGLSQSCSRRVFHAAALRLFY |
| Ga0187798_15017211 | 3300019275 | Peatland | MVPCDSGFTRFEGGGGTSCRRPFPGHPGLSQSCSRRVFH |
| Ga0187797_18498011 | 3300019284 | Peatland | MPAECGFARFGGEGGTSRRRPFPGRPGLSQPGTRRVFHAAAPRL |
| Ga0213852_12705361 | 3300021858 | Watersheds | MTPAEELVILPFDRGFTRSEGDGGTSCHRPFPGRPGLSQSCSRRVFQAA |
| Ga0213851_18123391 | 3300021860 | Watersheds | MLPFDLGFTRFEGEGDTSCHRPFPGRPGLSQSCSRRVFHTA |
| Ga0242644_10115561 | 3300022498 | Soil | VIFACRIRAFARLEGEGGTSCRRPFPGRPGLSQPCSRRGFQTAALRL |
| Ga0242641_10152841 | 3300022499 | Soil | VPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPRL |
| Ga0242645_10223041 | 3300022501 | Soil | VPCDSGLTHSEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPR |
| Ga0222729_10179591 | 3300022507 | Soil | VPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF |
| Ga0222728_10270342 | 3300022508 | Soil | VPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFRTAAPRLF |
| Ga0242676_10352742 | 3300022512 | Soil | VPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPR |
| Ga0242667_10381981 | 3300022513 | Soil | VPFDRGFIRLEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF |
| Ga0242659_10457181 | 3300022522 | Soil | VPYDSGLTRSEGDDGTSCHRPFPGNPGLSQSCSLRVFHTA |
| Ga0242663_10578761 | 3300022523 | Soil | VPFDCGFIRIEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF |
| Ga0242655_101327711 | 3300022532 | Soil | VIFACRIRAFARLEGEGGTSCRRPFPGRPGLSQPCSRRGFQNAAL |
| Ga0222756_10883522 | 3300022709 | Soil | VPFDRGLIRFEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF |
| Ga0242674_10179961 | 3300022711 | Soil | VIFACRIRAFARLEGEGGTSCRRPFPGRPGLSQPCSRRGFQTAALR |
| Ga0242674_10182571 | 3300022711 | Soil | VPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAA |
| Ga0242653_10320091 | 3300022712 | Soil | VIFACRIRAFARLEGEGGTSCRRPFPGRPGLSQPCSRRGFQTAALRLF |
| Ga0242677_10571441 | 3300022713 | Soil | VIVPFDRGLIRFEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF |
| Ga0242671_10324832 | 3300022714 | Soil | VPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLFYQ |
| Ga0242672_10382442 | 3300022720 | Soil | VPFDCGFIRLEGEGDTSCHRPFPGHPGLSQSCSRRVFHTAAPR |
| Ga0242657_10745382 | 3300022722 | Soil | VPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLFYQGT |
| Ga0247555_1011971 | 3300023539 | Soil | MLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHPAALR |
| Ga0247554_1027671 | 3300023547 | Soil | MLPSDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAA |
| Ga0247526_1102831 | 3300023558 | Soil | MLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAAL |
| Ga0265334_101017482 | 3300028573 | Rhizosphere | MLPFDRGLTRAEGEGGTSCHHPFPGRPGLSQSRSRRVFHTAALRLFYQGTLRS |
| Ga0210285_14531681 | 3300030535 | Soil | VPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLFYQG |
| Ga0265393_10295481 | 3300030586 | Soil | MLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCFRRVFQAFALRLFYQ |
| Ga0210255_108461811 | 3300030589 | Soil | MLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHPAALRLFYQ |
| Ga0265461_105667881 | 3300030743 | Soil | MLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHPAALRLFY |
| Ga0265775_1037461 | 3300030762 | Soil | VILPFDCGFTRTEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALRLF |
| Ga0265766_10054471 | 3300030863 | Soil | MLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHPAALRL |
| Ga0265776_1029231 | 3300030880 | Soil | VILPFDCGFTRTEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALR |
| Ga0265776_1132721 | 3300030880 | Soil | VPCDSGFTHSEGEDGTSCHLPFPGHPGLSQSCSRRVFHTAAPRLF |
| Ga0265757_1028541 | 3300030978 | Soil | VILPFDCGFTRTEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALRL |
| Ga0265773_10105231 | 3300031018 | Soil | VILPFDCGFTRTEGEGGTSCHLPFPGRPGLCQSCSRRVFHTAAL |
| Ga0310116_1134451 | 3300031591 | Soil | VILPFDCGFTRTEGEGGTSCHLPFPGRPGLSQSCFRRVFQAFALRLF |
| Ga0316049_1058921 | 3300031866 | Soil | MLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRGFQPAALRLF |
| Ga0316598_139946_2_133 | 3300034652 | Untreated Peat Soil | MPVIPLTRSGGEGGTNCRQPFPGRPGLSQSCSRRVFQAAALRLF |
| ⦗Top⦘ |