| Basic Information | |
|---|---|
| Family ID | F070535 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSP |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.11 % |
| % of genes near scaffold ends (potentially truncated) | 23.58 % |
| % of genes from short scaffolds (< 2000 bps) | 71.54 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.732 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (19.512 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.024 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (70.732 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.54% β-sheet: 0.00% Coil/Unstructured: 78.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00733 | Asn_synthase | 25.20 |
| PF13537 | GATase_7 | 4.88 |
| PF00005 | ABC_tran | 4.07 |
| PF01061 | ABC2_membrane | 3.25 |
| PF08241 | Methyltransf_11 | 1.63 |
| PF01381 | HTH_3 | 1.63 |
| PF01510 | Amidase_2 | 1.63 |
| PF07638 | Sigma70_ECF | 0.81 |
| PF13472 | Lipase_GDSL_2 | 0.81 |
| PF01370 | Epimerase | 0.81 |
| PF01112 | Asparaginase_2 | 0.81 |
| PF00884 | Sulfatase | 0.81 |
| PF14907 | NTP_transf_5 | 0.81 |
| PF13419 | HAD_2 | 0.81 |
| PF00092 | VWA | 0.81 |
| PF00004 | AAA | 0.81 |
| PF01408 | GFO_IDH_MocA | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 0.81 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.73 % |
| Unclassified | root | N/A | 29.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0823807 | Not Available | 602 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0825360 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3420 | Open in IMG/M |
| 3300000550|F24TB_12271435 | Not Available | 549 | Open in IMG/M |
| 3300000550|F24TB_12271436 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 615 | Open in IMG/M |
| 3300000956|JGI10216J12902_103146041 | Not Available | 611 | Open in IMG/M |
| 3300003267|soilL1_10156401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1469 | Open in IMG/M |
| 3300003324|soilH2_10145962 | All Organisms → cellular organisms → Bacteria | 4164 | Open in IMG/M |
| 3300004463|Ga0063356_104825311 | Not Available | 579 | Open in IMG/M |
| 3300005329|Ga0070683_100634306 | Not Available | 1023 | Open in IMG/M |
| 3300005340|Ga0070689_100121328 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2088 | Open in IMG/M |
| 3300005366|Ga0070659_100762401 | Not Available | 840 | Open in IMG/M |
| 3300005367|Ga0070667_100504089 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300005455|Ga0070663_101155118 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 679 | Open in IMG/M |
| 3300005471|Ga0070698_100000004 | All Organisms → cellular organisms → Bacteria | 132184 | Open in IMG/M |
| 3300005526|Ga0073909_10663601 | Not Available | 520 | Open in IMG/M |
| 3300005543|Ga0070672_101568410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
| 3300005548|Ga0070665_100020105 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 6703 | Open in IMG/M |
| 3300005548|Ga0070665_100190229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2053 | Open in IMG/M |
| 3300005549|Ga0070704_101117544 | Not Available | 716 | Open in IMG/M |
| 3300005564|Ga0070664_100011766 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 7103 | Open in IMG/M |
| 3300005564|Ga0070664_100139131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2137 | Open in IMG/M |
| 3300005577|Ga0068857_100048910 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3751 | Open in IMG/M |
| 3300005578|Ga0068854_100415084 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300005718|Ga0068866_10332265 | Not Available | 960 | Open in IMG/M |
| 3300005718|Ga0068866_11304590 | Not Available | 527 | Open in IMG/M |
| 3300005764|Ga0066903_102515880 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 997 | Open in IMG/M |
| 3300005834|Ga0068851_10016455 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3539 | Open in IMG/M |
| 3300005840|Ga0068870_10671994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 712 | Open in IMG/M |
| 3300006058|Ga0075432_10109239 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300006169|Ga0082029_1767191 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300006173|Ga0070716_100989416 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
| 3300006237|Ga0097621_102434998 | Not Available | 501 | Open in IMG/M |
| 3300006844|Ga0075428_100024729 | All Organisms → cellular organisms → Bacteria | 6645 | Open in IMG/M |
| 3300006844|Ga0075428_100054341 | All Organisms → cellular organisms → Bacteria | 4389 | Open in IMG/M |
| 3300006844|Ga0075428_100209689 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2105 | Open in IMG/M |
| 3300006845|Ga0075421_100001144 | All Organisms → cellular organisms → Bacteria | 30390 | Open in IMG/M |
| 3300006845|Ga0075421_100066601 | All Organisms → cellular organisms → Bacteria | 4547 | Open in IMG/M |
| 3300006845|Ga0075421_100947052 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300006846|Ga0075430_100313438 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300006846|Ga0075430_100647159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 872 | Open in IMG/M |
| 3300006852|Ga0075433_10060234 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3323 | Open in IMG/M |
| 3300006852|Ga0075433_10148164 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 2087 | Open in IMG/M |
| 3300006852|Ga0075433_10717925 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 875 | Open in IMG/M |
| 3300006853|Ga0075420_100629009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 926 | Open in IMG/M |
| 3300006854|Ga0075425_100388332 | Not Available | 1608 | Open in IMG/M |
| 3300006871|Ga0075434_102523107 | Not Available | 515 | Open in IMG/M |
| 3300006904|Ga0075424_100025466 | All Organisms → cellular organisms → Bacteria | 6089 | Open in IMG/M |
| 3300007004|Ga0079218_10859383 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 883 | Open in IMG/M |
| 3300009094|Ga0111539_11125750 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300009147|Ga0114129_10305518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2119 | Open in IMG/M |
| 3300009147|Ga0114129_10725685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1275 | Open in IMG/M |
| 3300009156|Ga0111538_14133947 | Not Available | 501 | Open in IMG/M |
| 3300009174|Ga0105241_11210500 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 716 | Open in IMG/M |
| 3300010038|Ga0126315_10104972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 1626 | Open in IMG/M |
| 3300010166|Ga0126306_11288728 | Not Available | 602 | Open in IMG/M |
| 3300010398|Ga0126383_11498707 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 764 | Open in IMG/M |
| 3300010400|Ga0134122_11465959 | Not Available | 700 | Open in IMG/M |
| 3300012212|Ga0150985_105804925 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 812 | Open in IMG/M |
| 3300012212|Ga0150985_108102813 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1315 | Open in IMG/M |
| 3300012212|Ga0150985_108325681 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012212|Ga0150985_109117278 | Not Available | 519 | Open in IMG/M |
| 3300012212|Ga0150985_115655518 | Not Available | 746 | Open in IMG/M |
| 3300012212|Ga0150985_120590776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 771 | Open in IMG/M |
| 3300012469|Ga0150984_102712914 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 733 | Open in IMG/M |
| 3300012469|Ga0150984_106572414 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 648 | Open in IMG/M |
| 3300012469|Ga0150984_111576295 | Not Available | 616 | Open in IMG/M |
| 3300012971|Ga0126369_11960601 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 674 | Open in IMG/M |
| 3300013307|Ga0157372_10388190 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300013308|Ga0157375_10719614 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1151 | Open in IMG/M |
| 3300015371|Ga0132258_10694294 | All Organisms → cellular organisms → Bacteria | 2562 | Open in IMG/M |
| 3300015371|Ga0132258_11018537 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300015372|Ga0132256_100172194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2192 | Open in IMG/M |
| 3300015373|Ga0132257_100541018 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300015374|Ga0132255_100538420 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300015374|Ga0132255_102214402 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300018067|Ga0184611_1303761 | Not Available | 554 | Open in IMG/M |
| 3300018083|Ga0184628_10611864 | Not Available | 550 | Open in IMG/M |
| 3300018469|Ga0190270_10203936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1674 | Open in IMG/M |
| 3300021445|Ga0182009_10182016 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1014 | Open in IMG/M |
| 3300022756|Ga0222622_10936741 | Not Available | 635 | Open in IMG/M |
| 3300025315|Ga0207697_10264892 | Not Available | 761 | Open in IMG/M |
| 3300025893|Ga0207682_10056813 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300025893|Ga0207682_10180697 | Not Available | 963 | Open in IMG/M |
| 3300025899|Ga0207642_10875409 | Not Available | 574 | Open in IMG/M |
| 3300025908|Ga0207643_10393980 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300025920|Ga0207649_10240789 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300025921|Ga0207652_10953071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 756 | Open in IMG/M |
| 3300025925|Ga0207650_10071899 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2603 | Open in IMG/M |
| 3300025925|Ga0207650_10879625 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300025928|Ga0207700_11598338 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 577 | Open in IMG/M |
| 3300025930|Ga0207701_10004012 | All Organisms → cellular organisms → Bacteria | 14995 | Open in IMG/M |
| 3300025931|Ga0207644_10395127 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1129 | Open in IMG/M |
| 3300025933|Ga0207706_10109703 | All Organisms → cellular organisms → Bacteria | 2428 | Open in IMG/M |
| 3300025934|Ga0207686_10178552 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1504 | Open in IMG/M |
| 3300025934|Ga0207686_10346448 | Not Available | 1117 | Open in IMG/M |
| 3300025944|Ga0207661_10360001 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1314 | Open in IMG/M |
| 3300025944|Ga0207661_11761755 | Not Available | 565 | Open in IMG/M |
| 3300025945|Ga0207679_11533729 | Not Available | 611 | Open in IMG/M |
| 3300025960|Ga0207651_10869109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 802 | Open in IMG/M |
| 3300025981|Ga0207640_10616926 | Not Available | 920 | Open in IMG/M |
| 3300026075|Ga0207708_10043460 | All Organisms → cellular organisms → Bacteria | 3424 | Open in IMG/M |
| 3300027886|Ga0209486_11002163 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
| 3300027909|Ga0209382_10021138 | All Organisms → cellular organisms → Bacteria | 7899 | Open in IMG/M |
| 3300027909|Ga0209382_10050474 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4956 | Open in IMG/M |
| 3300027909|Ga0209382_10130342 | All Organisms → cellular organisms → Bacteria | 2927 | Open in IMG/M |
| 3300027909|Ga0209382_10265795 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 1943 | Open in IMG/M |
| 3300028379|Ga0268266_10061354 | All Organisms → cellular organisms → Bacteria | 3243 | Open in IMG/M |
| 3300028876|Ga0307286_10423101 | Not Available | 501 | Open in IMG/M |
| 3300030993|Ga0308190_1132128 | Not Available | 578 | Open in IMG/M |
| 3300031476|Ga0314827_112538 | Not Available | 669 | Open in IMG/M |
| 3300031481|Ga0314816_1040291 | Not Available | 612 | Open in IMG/M |
| 3300031548|Ga0307408_100002749 | All Organisms → cellular organisms → Bacteria | 12218 | Open in IMG/M |
| 3300031716|Ga0310813_10101404 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300031731|Ga0307405_10189334 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| (restricted) 3300031825|Ga0255338_1000132 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 327979 | Open in IMG/M |
| 3300031846|Ga0318512_10649952 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 539 | Open in IMG/M |
| 3300031908|Ga0310900_10001380 | All Organisms → cellular organisms → Bacteria | 9611 | Open in IMG/M |
| 3300031939|Ga0308174_10531160 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300031995|Ga0307409_102544392 | Not Available | 540 | Open in IMG/M |
| 3300033412|Ga0310810_10000283 | All Organisms → cellular organisms → Bacteria | 52931 | Open in IMG/M |
| 3300033475|Ga0310811_10841110 | Not Available | 845 | Open in IMG/M |
| 3300033513|Ga0316628_101237973 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300034817|Ga0373948_0158096 | Not Available | 570 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 19.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.88% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 4.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.06% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.06% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.44% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.44% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.63% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.81% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031476 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031481 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031825 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_08238072 | 3300000033 | Soil | MYQAPKLERLGTFREVTLAGGDFNPGDGXNPYXRYA |
| ICChiseqgaiiDRAFT_08253604 | 3300000033 | Soil | MYQAPKLERLGTFREVTLAGGMVSQADATNPYHRYS* |
| F24TB_122714352 | 3300000550 | Soil | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYA |
| F24TB_122714361 | 3300000550 | Soil | LSREGWMYQAPKLERLGTFREVTLSGGMVSQADATNPYHRYS* |
| JGI10216J12902_1031460412 | 3300000956 | Soil | MYQAPKLERLGTFREVTLAGGQVSQADATNPYHRYS* |
| soilL1_101564012 | 3300003267 | Sugarcane Root And Bulk Soil | MYSAPKLERLGTFREVTLSGGAFLQADASNPYHRYDQLVS* |
| soilH2_101459622 | 3300003324 | Sugarcane Root And Bulk Soil | MYEAPKLERLGTFRDVTQAGGAFEPGDGSNAFHRYAPIIA* |
| Ga0063356_1048253111 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSPLPS* |
| Ga0070683_1006343062 | 3300005329 | Corn Rhizosphere | MYEAPKLERLGTLRELTLAGGDFTPGDGANAFHRYAPLPG* |
| Ga0070689_1001213283 | 3300005340 | Switchgrass Rhizosphere | EGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA* |
| Ga0070659_1007624012 | 3300005366 | Corn Rhizosphere | LTQEGSMYEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA* |
| Ga0070667_1005040892 | 3300005367 | Switchgrass Rhizosphere | MYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSPNG* |
| Ga0070663_1011551182 | 3300005455 | Corn Rhizosphere | EGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA* |
| Ga0070698_10000000439 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MYEAPKLERLGTFREITLAGGDFNPGDGGNPYHRYAPLPS* |
| Ga0073909_106636011 | 3300005526 | Surface Soil | MYQAPKLERLGTFREVTLAGGAFEAGDGVNPYHRYSE* |
| Ga0070672_1015684102 | 3300005543 | Miscanthus Rhizosphere | MYQAPKLERLGSFREITQAGGDFSPGDGANAFHRYAP |
| Ga0070665_1000201053 | 3300005548 | Switchgrass Rhizosphere | MYQSPKLERLGTFREVTLNGGDVLASDAGNPYHRYS* |
| Ga0070665_1001902292 | 3300005548 | Switchgrass Rhizosphere | MYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA* |
| Ga0070704_1011175441 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYAPLPS* |
| Ga0070664_1000117664 | 3300005564 | Corn Rhizosphere | MYQAPKLERLGSFREVTLAGGDFNPGDGGNPFHRYAPLPS* |
| Ga0070664_1001391314 | 3300005564 | Corn Rhizosphere | MYEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA* |
| Ga0068857_1000489103 | 3300005577 | Corn Rhizosphere | MYQSPKLERLGTFREVTLAGGAVLAADASNPYHRYR* |
| Ga0068854_1004150841 | 3300005578 | Corn Rhizosphere | MYQAPKLERLGSFREVTLAGGDFNPGDGGNPYHRYAPL* |
| Ga0068866_103322652 | 3300005718 | Miscanthus Rhizosphere | MYERPTLERLGTLRELTRAGGANTPGDGANPYHRYGP* |
| Ga0068866_113045901 | 3300005718 | Miscanthus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPIG* |
| Ga0066903_1025158802 | 3300005764 | Tropical Forest Soil | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPFHRYAPA* |
| Ga0068851_100164552 | 3300005834 | Corn Rhizosphere | MYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA* |
| Ga0068870_106719942 | 3300005840 | Miscanthus Rhizosphere | MYQTPKLERLGTFREVTLAGGAVLNSDASNPYHRYR* |
| Ga0075432_101092392 | 3300006058 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYAPIG* |
| Ga0082029_17671911 | 3300006169 | Termite Nest | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPA* |
| Ga0070716_1009894161 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HLSWEGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA* |
| Ga0097621_1024349981 | 3300006237 | Miscanthus Rhizosphere | QEGSMYEAPKLERLGTLRELTLGGGDFTPGDGANAFHRYSP* |
| Ga0075428_1000247294 | 3300006844 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGEFNPGDGGNPYHRYAPIG* |
| Ga0075428_1000543414 | 3300006844 | Populus Rhizosphere | MYETPKLERLGTMRDLTLAGGDFATGDGGNPYHRYTP* |
| Ga0075428_1002096892 | 3300006844 | Populus Rhizosphere | VYVKPKLERLGTLRELTLAGGDFAPGDGANPYHRYSP* |
| Ga0075421_1000011444 | 3300006845 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYTALS* |
| Ga0075421_1000666015 | 3300006845 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYAPL* |
| Ga0075421_1009470522 | 3300006845 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLPS* |
| Ga0075430_1003134382 | 3300006846 | Populus Rhizosphere | MYQSPKLERLGTFREVTLNGGDVLAADASNPYHRYS* |
| Ga0075430_1006471591 | 3300006846 | Populus Rhizosphere | EGWMYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYSP* |
| Ga0075433_100602342 | 3300006852 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYSQIG* |
| Ga0075433_101481641 | 3300006852 | Populus Rhizosphere | MYETPKLERLGTLRELTQAGGDFAPGDGANPYHRYAP* |
| Ga0075433_107179251 | 3300006852 | Populus Rhizosphere | QAPKLERLGTFREVTLAGGDFNPGDGANPYHRYAPIG* |
| Ga0075420_1006290092 | 3300006853 | Populus Rhizosphere | QAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSPLPS* |
| Ga0075425_1003883322 | 3300006854 | Populus Rhizosphere | MYETPKLERLGTVRELTLAGGANTPGDGANPYHRYGP* |
| Ga0075434_1025231072 | 3300006871 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLIG* |
| Ga0075424_1000254661 | 3300006904 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRY |
| Ga0079218_108593832 | 3300007004 | Agricultural Soil | MYQAPKLERLGSFREVTLAGGDFNPGDGANPYHRYSPLPS* |
| Ga0111539_111257501 | 3300009094 | Populus Rhizosphere | MYQAPKLERLGSFREITLGGGDFNPGDGTNAFHRYSPNG* |
| Ga0114129_103055183 | 3300009147 | Populus Rhizosphere | MYETPKLERLGTVRELTRAGGANTPGDGANPYHRYGP* |
| Ga0114129_107256852 | 3300009147 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYGPIG* |
| Ga0111538_141339472 | 3300009156 | Populus Rhizosphere | YEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA* |
| Ga0105241_112105002 | 3300009174 | Corn Rhizosphere | MYQAPKLERLVTFLEVTLAGGMISAGDGVNPYHRYSQ* |
| Ga0126315_101049722 | 3300010038 | Serpentine Soil | MYQSPKLERLGTFREVTLNGGDVLAADAGNPYHRYS* |
| Ga0126306_112887282 | 3300010166 | Serpentine Soil | MYQSPKLERLGTFREVTLAGGEVLAADASNPYHRYS* |
| Ga0126383_114987072 | 3300010398 | Tropical Forest Soil | MYQAPKLERLGTFREVILAGGMVEAGDGANPYHRYA* |
| Ga0134122_114659592 | 3300010400 | Terrestrial Soil | MYQAPKLERLGTFREVTLAGGMIEAGDGANPYHRYSA* |
| Ga0150985_1058049251 | 3300012212 | Avena Fatua Rhizosphere | PETVVTGGWMYEKPKLERLGSLRELTLAGGEFAPGDGANPYHRYAP* |
| Ga0150985_1081028133 | 3300012212 | Avena Fatua Rhizosphere | MYQAPKLERLGSFREVTLGGGEFNPGDGTNAFHRYAPTG* |
| Ga0150985_1083256812 | 3300012212 | Avena Fatua Rhizosphere | MKDVYTKPKLERLGTFREVTQSGGEFVCADAAGPYARYPMA* |
| Ga0150985_1091172781 | 3300012212 | Avena Fatua Rhizosphere | MYETPKFERLGTLRELTRAGGDFSPGDATNAFHRYAP* |
| Ga0150985_1156555182 | 3300012212 | Avena Fatua Rhizosphere | MYEAPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSAGG* |
| Ga0150985_1205907762 | 3300012212 | Avena Fatua Rhizosphere | MYQAPKLERLGSFREITLGGGDFNPGDGTNAFHRYAPLPS* |
| Ga0150984_1027129142 | 3300012469 | Avena Fatua Rhizosphere | MYQAPKLERLGSFREVTLGGGDFNPGDGTNAFHRYAPIG* |
| Ga0150984_1065724141 | 3300012469 | Avena Fatua Rhizosphere | MYQAPKLERLGSFREITQAGGDFSPGDGTNAFHRYTP* |
| Ga0150984_1115762952 | 3300012469 | Avena Fatua Rhizosphere | MYESPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSAGG* |
| Ga0126369_119606011 | 3300012971 | Tropical Forest Soil | REGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA* |
| Ga0157372_103881902 | 3300013307 | Corn Rhizosphere | MYEAPKLERLGTLREITLAGGEFLAADGANPFHRYSAP* |
| Ga0157375_107196141 | 3300013308 | Miscanthus Rhizosphere | MYEAPKLERLGTLRELTLAGGDFTPGDGANPFHRYSP* |
| Ga0132258_106942944 | 3300015371 | Arabidopsis Rhizosphere | MYEAPKLERLGTLRELTLGGGDFTPGDGANPFHRYSP* |
| Ga0132258_110185372 | 3300015371 | Arabidopsis Rhizosphere | MKDAYTKPKLERLGTFREVTQGGGEFICADGANPYARYPMA* |
| Ga0132256_1001721942 | 3300015372 | Arabidopsis Rhizosphere | MYQTPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPL* |
| Ga0132257_1005410181 | 3300015373 | Arabidopsis Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPL* |
| Ga0132255_1005384201 | 3300015374 | Arabidopsis Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLTG* |
| Ga0132255_1022144021 | 3300015374 | Arabidopsis Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPIS* |
| Ga0184611_13037611 | 3300018067 | Groundwater Sediment | MYQSPKLERLGTFREVTLAGGDVLSADASNPYHRYS |
| Ga0184628_106118642 | 3300018083 | Groundwater Sediment | MYQSPKLERLGTFREVTLNGGDVLAADASNPYHRYS |
| Ga0190270_102039362 | 3300018469 | Soil | MYQSPKLERLGTFREVTLNGGDILAADASNPYHRYS |
| Ga0182009_101820161 | 3300021445 | Soil | YEAPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSQAG |
| Ga0222622_109367411 | 3300022756 | Groundwater Sediment | MYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSPNG |
| Ga0207697_102648922 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MYQAPKLERLGTFREVTLAGGMVSQADATNPYHRYS |
| Ga0207682_100568132 | 3300025893 | Miscanthus Rhizosphere | MYQTPKLERLGTFREVTLAGGAVLNSDASNPYHRYR |
| Ga0207682_101806972 | 3300025893 | Miscanthus Rhizosphere | MYETPKIERLGTLRDLTRAGGDFSPGDGANPFHRYAP |
| Ga0207642_108754091 | 3300025899 | Miscanthus Rhizosphere | MYERPTLERLGTLRELTRAGGANTPGDGANPYHRYGP |
| Ga0207643_103939802 | 3300025908 | Miscanthus Rhizosphere | MYQAPKLERLGTFREVTLAGGMVEAGDGANPYLRYA |
| Ga0207649_102407893 | 3300025920 | Corn Rhizosphere | MYEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA |
| Ga0207652_109530711 | 3300025921 | Corn Rhizosphere | NHLSWEGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA |
| Ga0207650_100718992 | 3300025925 | Switchgrass Rhizosphere | MYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA |
| Ga0207650_108796251 | 3300025925 | Switchgrass Rhizosphere | MYQAPKLERLGSFREVTLAGGDFNPGDGGNPFHRYAPLPS |
| Ga0207700_115983382 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | NHLSWEGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA |
| Ga0207701_100040125 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MYQSPKLERLGTFREVTLAGGAVLNSDASNPYHRYR |
| Ga0207644_103951272 | 3300025931 | Switchgrass Rhizosphere | HLSWEGWMYQAPKLERLGTFREVTLAGGAFEAGDGVNPYHRYSE |
| Ga0207706_101097032 | 3300025933 | Corn Rhizosphere | MYQSPKLERLGTFREVTLAGGAVLAADASNPYHRYR |
| Ga0207686_101785522 | 3300025934 | Miscanthus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPIG |
| Ga0207686_103464481 | 3300025934 | Miscanthus Rhizosphere | MYQAPKLERLGTFREVTLAGGAFEAGDGVNPYHRYSE |
| Ga0207661_103600011 | 3300025944 | Corn Rhizosphere | KKPLLGGFMYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSPNG |
| Ga0207661_117617552 | 3300025944 | Corn Rhizosphere | WMYEAPKLERLGTLRELTLAGGDFTPGDGANAFHRYAPLPG |
| Ga0207679_115337292 | 3300025945 | Corn Rhizosphere | MYQAPKLERLGTFREVTLAGGMVSAADGSNPYHRYA |
| Ga0207651_108691092 | 3300025960 | Switchgrass Rhizosphere | HGGLMYQSPKLERLGTFREVTLAGGAVLAADASNPYHRYR |
| Ga0207640_106169261 | 3300025981 | Corn Rhizosphere | MYQAPKLERLGSFREVTLAGGDFNPGDGGNPYHRYAPL |
| Ga0207708_100434604 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MYQTPKLERLGTFREVTLAGGAVLAADASNPYHRYR |
| Ga0209486_110021632 | 3300027886 | Agricultural Soil | MYQAPKLERLGSFREVTLAGGDFNPGDGANPYHRYSPLPS |
| Ga0209382_100211384 | 3300027909 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYTALS |
| Ga0209382_100504743 | 3300027909 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYSQIG |
| Ga0209382_101303422 | 3300027909 | Populus Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYAPL |
| Ga0209382_102657951 | 3300027909 | Populus Rhizosphere | VYVKPKLERLGTLRELTLAGGDFAPGDGANPYHRYSP |
| Ga0268266_100613541 | 3300028379 | Switchgrass Rhizosphere | MYQSPKLERLGTFREVTLNGGDVLASDAGNPYHRYS |
| Ga0307286_104231011 | 3300028876 | Soil | MYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSQNG |
| Ga0308190_11321281 | 3300030993 | Soil | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLP |
| Ga0314827_1125382 | 3300031476 | Soil | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLPS |
| Ga0314816_10402911 | 3300031481 | Soil | MYQAPKLERLGTFREVTLAGGEYNPGDGGNPFHRYSPLVVS |
| Ga0307408_1000027498 | 3300031548 | Rhizosphere | MYQAPKLERLGTFREVTLSGGMVSQADATNPYHRYS |
| Ga0310813_101014042 | 3300031716 | Soil | MYEAPKLERLGTLREITLAGGDFNPGDGGNPFHRYSPIIG |
| Ga0307405_101893341 | 3300031731 | Rhizosphere | MYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSP |
| (restricted) Ga0255338_1000132141 | 3300031825 | Sandy Soil | MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLPA |
| Ga0318512_106499522 | 3300031846 | Soil | WEGWMYQAPKLERLGTFREVTLSGGMVEAGDGANPYHRYA |
| Ga0310900_100013809 | 3300031908 | Soil | MYQSPKLERLGTFREVTLAGGVVLAADASNPYHRYR |
| Ga0308174_105311602 | 3300031939 | Soil | MYQAPKLERLGSFREVTLGGGEFNPGDGTNAFHRYAPTG |
| Ga0307409_1025443922 | 3300031995 | Rhizosphere | MYQAPKLERLGSFREVTLGGGDFNPGDGVNAFHRYAPLPS |
| Ga0310810_1000028323 | 3300033412 | Soil | MYEAPKLERLGTLRELTLAGGDFTPGDGANAFHRYAPLPG |
| Ga0310811_108411102 | 3300033475 | Soil | PEVWMYEAPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSQAG |
| Ga0316628_1012379731 | 3300033513 | Soil | MYQAPKLERLGTFREVTLAGGGFTPGDGANPYHRYAPL |
| Ga0373948_0158096_20_133 | 3300034817 | Rhizosphere Soil | MYQAPKLERLGTFREVTLAGGMIEAGDGATPYHRYSA |
| ⦗Top⦘ |