| Basic Information | |
|---|---|
| Family ID | F070269 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKEENIRLAPL |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 60.98 % |
| % of genes near scaffold ends (potentially truncated) | 26.02 % |
| % of genes from short scaffolds (< 2000 bps) | 62.60 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.301 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (21.951 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.398 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (36.585 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF02391 | MoaE | 26.02 |
| PF01106 | NifU | 23.58 |
| PF01155 | HypA | 7.32 |
| PF02492 | cobW | 7.32 |
| PF03453 | MoeA_N | 4.88 |
| PF02634 | FdhD-NarQ | 4.07 |
| PF00378 | ECH_1 | 2.44 |
| PF02445 | NadA | 1.63 |
| PF03454 | MoeA_C | 1.63 |
| PF02748 | PyrI_C | 0.81 |
| PF07549 | Sec_GG | 0.81 |
| PF12698 | ABC2_membrane_3 | 0.81 |
| PF13540 | RCC1_2 | 0.81 |
| PF13237 | Fer4_10 | 0.81 |
| PF13451 | zf-trcl | 0.81 |
| PF00290 | Trp_syntA | 0.81 |
| PF01554 | MatE | 0.81 |
| PF00005 | ABC_tran | 0.81 |
| PF00041 | fn3 | 0.81 |
| PF12837 | Fer4_6 | 0.81 |
| PF14257 | DUF4349 | 0.81 |
| PF00581 | Rhodanese | 0.81 |
| PF14691 | Fer4_20 | 0.81 |
| PF00994 | MoCF_biosynth | 0.81 |
| PF01899 | MNHE | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0314 | Molybdopterin synthase catalytic subunit MoaE | Coenzyme transport and metabolism [H] | 26.02 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 23.58 |
| COG0375 | Hydrogenase maturation factor HypA/HybF, metallochaperone involved in Ni insertion | Posttranslational modification, protein turnover, chaperones [O] | 7.32 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 6.50 |
| COG1526 | Formate dehydrogenase assembly factor FdhD, a sulfurtransferase | Energy production and conversion [C] | 4.07 |
| COG0379 | Quinolinate synthase | Coenzyme transport and metabolism [H] | 1.63 |
| COG0159 | Tryptophan synthase alpha chain | Amino acid transport and metabolism [E] | 0.81 |
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 0.81 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.81 |
| COG1781 | Aspartate carbamoyltransferase, regulatory subunit | Nucleotide transport and metabolism [F] | 0.81 |
| COG1863 | Multisubunit Na+/H+ antiporter, MnhE subunit | Inorganic ion transport and metabolism [P] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.11 % |
| Unclassified | root | N/A | 17.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001749|JGI24025J20009_10003210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 11254 | Open in IMG/M |
| 3300001749|JGI24025J20009_10006524 | All Organisms → cellular organisms → Bacteria | 7103 | Open in IMG/M |
| 3300001749|JGI24025J20009_10086487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 961 | Open in IMG/M |
| 3300001751|JGI2172J19969_10010893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalogenimonas → Dehalogenimonas lykanthroporepellens | 3648 | Open in IMG/M |
| 3300001753|JGI2171J19970_10019317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3021 | Open in IMG/M |
| 3300001753|JGI2171J19970_10024432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2600 | Open in IMG/M |
| 3300001753|JGI2171J19970_10068166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1324 | Open in IMG/M |
| 3300001854|JGI24422J19971_10065843 | Not Available | 1997 | Open in IMG/M |
| 3300001854|JGI24422J19971_10203433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 860 | Open in IMG/M |
| 3300002053|SMTZ23_10033508 | All Organisms → cellular organisms → Bacteria | 12731 | Open in IMG/M |
| 3300002465|LO132_10060152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1490 | Open in IMG/M |
| 3300004481|Ga0069718_15492214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 670 | Open in IMG/M |
| 3300004481|Ga0069718_16090974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 722 | Open in IMG/M |
| 3300004481|Ga0069718_16228014 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300005782|Ga0079367_1050692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1774 | Open in IMG/M |
| 3300006224|Ga0079037_100522057 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300007533|Ga0102944_1298202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 508 | Open in IMG/M |
| 3300008468|Ga0115358_10041726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 703 | Open in IMG/M |
| 3300009034|Ga0115863_1014174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 11156 | Open in IMG/M |
| 3300009034|Ga0115863_1058785 | Not Available | 4911 | Open in IMG/M |
| 3300009034|Ga0115863_1211444 | Not Available | 2331 | Open in IMG/M |
| 3300009034|Ga0115863_1544149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1322 | Open in IMG/M |
| 3300009488|Ga0114925_11450322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 509 | Open in IMG/M |
| 3300009499|Ga0114930_10010107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 7144 | Open in IMG/M |
| 3300009504|Ga0114946_10631474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 540 | Open in IMG/M |
| 3300009509|Ga0123573_11964751 | Not Available | 538 | Open in IMG/M |
| 3300009528|Ga0114920_10864943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 619 | Open in IMG/M |
| 3300010284|Ga0129301_1009979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2865 | Open in IMG/M |
| 3300010284|Ga0129301_1011817 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2537 | Open in IMG/M |
| 3300010284|Ga0129301_1017687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1886 | Open in IMG/M |
| 3300010284|Ga0129301_1027354 | Not Available | 1382 | Open in IMG/M |
| 3300010284|Ga0129301_1053362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 865 | Open in IMG/M |
| 3300010994|Ga0139328_100405 | All Organisms → cellular organisms → Bacteria | 3345 | Open in IMG/M |
| 3300010997|Ga0139324_1042243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 981 | Open in IMG/M |
| 3300012931|Ga0153915_10112076 | All Organisms → cellular organisms → Bacteria | 2913 | Open in IMG/M |
| 3300012931|Ga0153915_10605863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1260 | Open in IMG/M |
| 3300012931|Ga0153915_10624834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1240 | Open in IMG/M |
| 3300012931|Ga0153915_13319706 | Not Available | 522 | Open in IMG/M |
| 3300012964|Ga0153916_10454623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1347 | Open in IMG/M |
| 3300012964|Ga0153916_12158440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 626 | Open in IMG/M |
| 3300012964|Ga0153916_12395256 | Not Available | 594 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10006987 | All Organisms → cellular organisms → Bacteria | 8338 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10150027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1454 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10017720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 5352 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10164729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1440 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10613802 | Not Available | 643 | Open in IMG/M |
| 3300017963|Ga0180437_10320912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1174 | Open in IMG/M |
| 3300017971|Ga0180438_10047994 | All Organisms → cellular organisms → Bacteria | 4084 | Open in IMG/M |
| 3300017971|Ga0180438_10141979 | Not Available | 1977 | Open in IMG/M |
| 3300017971|Ga0180438_10858196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 661 | Open in IMG/M |
| 3300018080|Ga0180433_10285412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1307 | Open in IMG/M |
| 3300018089|Ga0187774_10965672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 591 | Open in IMG/M |
| 3300022221|Ga0224506_10126040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1217 | Open in IMG/M |
| 3300022309|Ga0224510_10409291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 814 | Open in IMG/M |
| 3300022548|Ga0212092_1001006 | All Organisms → cellular organisms → Bacteria | 32060 | Open in IMG/M |
| 3300022548|Ga0212092_1006215 | All Organisms → cellular organisms → Bacteria | 10081 | Open in IMG/M |
| 3300022548|Ga0212092_1089501 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300024423|Ga0190286_1015811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2272 | Open in IMG/M |
| 3300025843|Ga0209182_10162099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 627 | Open in IMG/M |
| 3300027740|Ga0214474_1041093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1793 | Open in IMG/M |
| 3300027742|Ga0209121_10003728 | All Organisms → cellular organisms → Bacteria | 14568 | Open in IMG/M |
| 3300027742|Ga0209121_10123875 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300027742|Ga0209121_10136142 | Not Available | 967 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10071274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1180 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10168581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 751 | Open in IMG/M |
| 3300027811|Ga0256868_10000017 | All Organisms → cellular organisms → Bacteria | 99549 | Open in IMG/M |
| 3300027811|Ga0256868_10007385 | Not Available | 5430 | Open in IMG/M |
| 3300027822|Ga0209633_10172955 | Not Available | 1210 | Open in IMG/M |
| 3300027888|Ga0209635_10039984 | All Organisms → cellular organisms → Bacteria | 3817 | Open in IMG/M |
| 3300027888|Ga0209635_10224365 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300027888|Ga0209635_10371067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1120 | Open in IMG/M |
| 3300027888|Ga0209635_10487252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 943 | Open in IMG/M |
| 3300027888|Ga0209635_10788257 | Not Available | 683 | Open in IMG/M |
| 3300027888|Ga0209635_10945342 | Not Available | 602 | Open in IMG/M |
| 3300027893|Ga0209636_10029974 | All Organisms → cellular organisms → Bacteria | 5477 | Open in IMG/M |
| 3300027893|Ga0209636_10067612 | All Organisms → cellular organisms → Bacteria | 3498 | Open in IMG/M |
| 3300027893|Ga0209636_10133787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2347 | Open in IMG/M |
| 3300027893|Ga0209636_10273978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1501 | Open in IMG/M |
| 3300027893|Ga0209636_10527072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 969 | Open in IMG/M |
| 3300027901|Ga0209427_10444766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 990 | Open in IMG/M |
| 3300027917|Ga0209536_101285647 | Not Available | 895 | Open in IMG/M |
| 3300031255|Ga0315554_1000121 | All Organisms → cellular organisms → Bacteria | 39850 | Open in IMG/M |
| 3300031255|Ga0315554_1000881 | All Organisms → cellular organisms → Bacteria | 17828 | Open in IMG/M |
| 3300031257|Ga0315555_1194570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 821 | Open in IMG/M |
| 3300031281|Ga0307420_1027339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2181 | Open in IMG/M |
| 3300031337|Ga0307430_1148097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 595 | Open in IMG/M |
| 3300031356|Ga0307439_1000288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 36159 | Open in IMG/M |
| 3300031551|Ga0315548_1192055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 664 | Open in IMG/M |
| 3300031563|Ga0307436_1174740 | Not Available | 592 | Open in IMG/M |
| 3300031586|Ga0315541_1094340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1015 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1154244 | Not Available | 889 | Open in IMG/M |
| (restricted) 3300031593|Ga0315307_1253471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 563 | Open in IMG/M |
| 3300031620|Ga0315552_1110488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 944 | Open in IMG/M |
| 3300031624|Ga0315545_1068069 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300031651|Ga0315543_1034263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2281 | Open in IMG/M |
| 3300031654|Ga0315549_1028976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3398 | Open in IMG/M |
| 3300031654|Ga0315549_1049916 | Not Available | 2301 | Open in IMG/M |
| 3300031698|Ga0315537_1004446 | All Organisms → cellular organisms → Bacteria | 10207 | Open in IMG/M |
| 3300031707|Ga0315291_10058680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 4297 | Open in IMG/M |
| 3300031707|Ga0315291_10137297 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
| 3300031772|Ga0315288_10413964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1360 | Open in IMG/M |
| 3300031873|Ga0315297_10011581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 6059 | Open in IMG/M |
| 3300031873|Ga0315297_10168050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1792 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10350549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 608 | Open in IMG/M |
| 3300031952|Ga0315294_10132421 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300031952|Ga0315294_10306327 | Not Available | 1524 | Open in IMG/M |
| 3300032020|Ga0315296_10059251 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
| 3300032029|Ga0315546_1062316 | Not Available | 1021 | Open in IMG/M |
| 3300032046|Ga0315289_10192432 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300032046|Ga0315289_10855281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 790 | Open in IMG/M |
| 3300032046|Ga0315289_11554827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 500 | Open in IMG/M |
| 3300032053|Ga0315284_10865632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1036 | Open in IMG/M |
| 3300032062|Ga0315551_10000129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 56945 | Open in IMG/M |
| 3300032118|Ga0315277_10044700 | All Organisms → cellular organisms → Bacteria | 5184 | Open in IMG/M |
| 3300032156|Ga0315295_10040067 | Not Available | 4336 | Open in IMG/M |
| 3300032156|Ga0315295_10596192 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300033480|Ga0316620_10152702 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300033513|Ga0316628_100276802 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300033991|Ga0334965_0019107 | All Organisms → cellular organisms → Bacteria | 3574 | Open in IMG/M |
| 3300033991|Ga0334965_0222462 | Not Available | 749 | Open in IMG/M |
| 3300034078|Ga0373900_057471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 712 | Open in IMG/M |
| 3300034083|Ga0373901_096677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 616 | Open in IMG/M |
| 3300034100|Ga0373910_0078198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 840 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 21.95% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 15.45% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 10.57% |
| Hot Spring Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat | 6.50% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 5.69% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 5.69% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 4.06% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.25% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 3.25% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.44% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.44% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 2.44% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.63% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.63% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.81% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.81% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake | 0.81% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.81% |
| Marine Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment | 0.81% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 0.81% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.81% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.81% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001749 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 | Environmental | Open in IMG/M |
| 3300001751 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 | Environmental | Open in IMG/M |
| 3300001753 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-24_28 | Environmental | Open in IMG/M |
| 3300001854 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 | Environmental | Open in IMG/M |
| 3300002053 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ | Environmental | Open in IMG/M |
| 3300002465 | Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005782 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf, PM3 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300007533 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_D_shore_MG | Environmental | Open in IMG/M |
| 3300008468 | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC10T | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
| 3300010284 | Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer H metaG | Environmental | Open in IMG/M |
| 3300010994 | ECM14MPS05_Bassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method B (2X150bp) | Environmental | Open in IMG/M |
| 3300010997 | ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022548 | Cone Pool_combined assembly | Environmental | Open in IMG/M |
| 3300024423 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-3-4_MG | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
| 3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
| 3300027822 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031255 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70 | Environmental | Open in IMG/M |
| 3300031257 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-80 | Environmental | Open in IMG/M |
| 3300031281 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-40 | Environmental | Open in IMG/M |
| 3300031337 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-130 | Environmental | Open in IMG/M |
| 3300031356 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-90 | Environmental | Open in IMG/M |
| 3300031551 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-110 | Environmental | Open in IMG/M |
| 3300031563 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40 | Environmental | Open in IMG/M |
| 3300031586 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-190 | Environmental | Open in IMG/M |
| 3300031587 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3 | Environmental | Open in IMG/M |
| 3300031593 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP2 | Environmental | Open in IMG/M |
| 3300031620 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-70 | Environmental | Open in IMG/M |
| 3300031624 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-10 | Environmental | Open in IMG/M |
| 3300031651 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-210 | Environmental | Open in IMG/M |
| 3300031654 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-200 | Environmental | Open in IMG/M |
| 3300031698 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-70 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031876 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
| 3300032029 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-170 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032062 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-90 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033991 | Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact | Environmental | Open in IMG/M |
| 3300034078 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.1 | Engineered | Open in IMG/M |
| 3300034083 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.2 | Engineered | Open in IMG/M |
| 3300034100 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.2 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24025J20009_100032106 | 3300001749 | Marine | VSQLVAAHELQEELSPIGVDGPSLLLEKEAKEENIRFAPL* |
| JGI24025J20009_100065245 | 3300001749 | Marine | MMLEEYYPLQVAQLMAEHVLQGELPPIRVDISSVPLEGEAKEENIRLAPL* |
| JGI24025J20009_100864872 | 3300001749 | Marine | VSQLVAEHELQEELPPIGIDGPSLLLEKEAKEENIRSAPL* |
| JGI2172J19969_100108934 | 3300001751 | Marine Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKEDNILFAPL* |
| JGI2171J19970_100193173 | 3300001753 | Marine Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKDDNIRFAPL* |
| JGI2171J19970_100244325 | 3300001753 | Marine Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKGAKEENIRFAPL* |
| JGI2171J19970_100681662 | 3300001753 | Marine Sediment | VAQLVAEHELQEEXPPIGVDEPSLLLERQANEENTRSTLL* |
| JGI24422J19971_100658432 | 3300001854 | Marine Sediment | VAEHELQEELPPIGVDGPSLLLEKEVKEDNIRFAPL* |
| JGI24422J19971_102034332 | 3300001854 | Marine Sediment | VSQLVAEQELQEELPPIGADGPSLLLEKEAKAENIRLARL* |
| SMTZ23_100335089 | 3300002053 | Marine Sediment | VAEHELQEELPPIGVDSPSPLLEKEEKDENIRSAPL* |
| LO132_100601522 | 3300002465 | Freshwater Lake | MWQLVQLVAEHELQDELPPIGADSPSPLLETEEKEESIRFAL* |
| Ga0069718_154922141 | 3300004481 | Sediment | GYMWQLVQLGAEHELQEELPPIGVDVPSLLLEKEEKQENIRLAL* |
| Ga0069718_160909741 | 3300004481 | Sediment | MWQLVQLGAEHEPQEELPPIGVDVPSLLLEKEAQDENTRLAPL* |
| Ga0069718_162280141 | 3300004481 | Sediment | MWQLVQLGAEHDPQDELPPIGADSPSPLLETEEKEESIRLAL* |
| Ga0079367_10506923 | 3300005782 | Marine Sediment | LQVVAAGYVWQVLQLVVEHEPQEELPPIGVDDPSLLLEKEAQEESTLLAPL* |
| Ga0079037_1005220573 | 3300006224 | Freshwater Wetlands | MWQLVQLEAEHEPQEELPPIGADVPSLLLEKEAQEENTRLAPL* |
| Ga0102944_12982022 | 3300007533 | Pond Soil | WQVSQLVAEHELQEELPPIGADGPSLLLEKDAQVENTRLAPL* |
| Ga0115358_100417262 | 3300008468 | Sediment | LGLFTVSRRGGYIWQVSQLVAEHELQKELAPIGVDGPSLLLEKEAKEENIRFAPL* |
| Ga0115863_101417412 | 3300009034 | Sediment, Intertidal | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKEENIRFALL* |
| Ga0115863_10587853 | 3300009034 | Sediment, Intertidal | VQESQLVAEHELQEEPPPIGVDSPSSLLEKEAKQDNMRSAPL* |
| Ga0115863_12114441 | 3300009034 | Sediment, Intertidal | VAEHELQEELPPIGADGPSPLLEKEAQGENIRLAPL* |
| Ga0115863_15441492 | 3300009034 | Sediment, Intertidal | VSQLVAEHELQEELPPIGVDGPSLPLEKEAKEENIRLAPL* |
| Ga0114925_114503221 | 3300009488 | Deep Subsurface | QLVAEQELQEELPPIGVDGPSLLLEKEAKEENIRLAPL* |
| Ga0114930_100101072 | 3300009499 | Deep Subsurface | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKEENIRLAPL* |
| Ga0114946_106314741 | 3300009504 | Sediment | VLAQGSYVLQVPQLVAEHVPQEDLPPIGVDDPSVFLEKEAKEENIRLAPL* |
| Ga0123573_119647512 | 3300009509 | Mangrove Sediment | VEEHEPQEEAPPTGVDSPSLSLEKEAQAENTRLAS |
| Ga0114920_108649432 | 3300009528 | Deep Subsurface | YIWQVSQLVAEHELQEELPPIRADSPSPLLEKEAKEENIRFAPL* |
| Ga0129301_10099794 | 3300010284 | Hot Spring Microbial Mat | MWQVAQLVAEHELQEELPPMGADDPSSPLEKQAKEETIRLARR* |
| Ga0129301_10118173 | 3300010284 | Hot Spring Microbial Mat | VAQLVAEHVLQEELPPIGVDVPSVPLEKEANEENMRLALL* |
| Ga0129301_10176874 | 3300010284 | Hot Spring Microbial Mat | VAQLVAEQVLQEELPPIGVDVPSLPLEKEANEENMRLALL* |
| Ga0129301_10273543 | 3300010284 | Hot Spring Microbial Mat | MFRGRSYIWQVAQLVAEHVLQGELPPSGVDVPSLLLEKEAKGENMRLAPL* |
| Ga0129301_10533623 | 3300010284 | Hot Spring Microbial Mat | VFRRRSYIWQVAQLVAEHVLQGELPPIGVDVPSLLLENEAKEENIRLAPL* |
| Ga0139328_1004056 | 3300010994 | Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKEENIRFAPL* |
| Ga0139324_10422432 | 3300010997 | Sediment | VSQLVAEHELQEELPLIGVDGPSLPLEKEAKGENIRFAPL* |
| Ga0153915_101120761 | 3300012931 | Freshwater Wetlands | MDYMWQLVQLGAEHEPQEELPPIGVDVPSPLLEKEAQDENTRLAPL* |
| Ga0153915_106058632 | 3300012931 | Freshwater Wetlands | MWQVAQLVAEHELQEGLPPIGVDGPSLLLEKEAKGENIRLALL* |
| Ga0153915_106248342 | 3300012931 | Freshwater Wetlands | MWQLAQLVAEHEPQEELPPIGLEVPSLLLEKEAQEENTRLAPI* |
| Ga0153915_133197062 | 3300012931 | Freshwater Wetlands | VQLGAEHELQEELPPIGADVPSLLLEKEEKQENTR |
| Ga0153916_104546232 | 3300012964 | Freshwater Wetlands | MWQLAQLVAEHEPQEELPPIGLDTPSPLLEKEEKQDNTRLAL* |
| Ga0153916_121584402 | 3300012964 | Freshwater Wetlands | GYILQVAQLVAEHELQEELPPIGLDSPSPLLQKDEKDDNIRSAPW* |
| Ga0153916_123952561 | 3300012964 | Freshwater Wetlands | VAEHELQEEPPPIGVDAPSLLRVCLGEAKEENIRLAP |
| (restricted) Ga0172365_100069872 | 3300013127 | Sediment | MWQLVQLVAEHELQEEPPPIGADVPSLLLEKEAQEENIRLAPL* |
| (restricted) Ga0172365_101500273 | 3300013127 | Sediment | MGYIGQVSQLVAEQELQEELPPIGVDDPSLLLEKEAKEENIRLAPL* |
| (restricted) Ga0172366_100177208 | 3300013128 | Sediment | MWQLVQLVAEHELQEEPPPIGADVPSLLLEKEAQQENIRLAPL* |
| (restricted) Ga0172366_101647291 | 3300013128 | Sediment | QVSQLVAEQELQEELPPIGVDDPSLLLEKEAKEENIRLAPL* |
| (restricted) Ga0172366_106138021 | 3300013128 | Sediment | MGYIGQVSQLVAEQELQEELPPIGVDDPSLLLEKEAKEENIRLAPL |
| Ga0180437_103209121 | 3300017963 | Hypersaline Lake Sediment | QVSQLVAAHVPQGELPPVGVDAPSLLFEKEAKEENIRFAPL |
| Ga0180438_100479945 | 3300017971 | Hypersaline Lake Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKGENIRFAPL |
| Ga0180438_101419792 | 3300017971 | Hypersaline Lake Sediment | VSQLVAAHVPQGELPPVGVDAPSLLFEKEAKEENIRFAPL |
| Ga0180438_108581961 | 3300017971 | Hypersaline Lake Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKEENIRFAPL |
| Ga0180433_102854122 | 3300018080 | Hypersaline Lake Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKRENIRFAPL |
| Ga0187774_109656722 | 3300018089 | Tropical Peatland | LCSYLRGSYIWQVSQLVAEHEPQGELPPIGVDDPSLLLEKQAKEESIRVAPL |
| Ga0224506_101260403 | 3300022221 | Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKEENIRFALL |
| Ga0224510_104092912 | 3300022309 | Sediment | MWQLVQLAAEHEPQEELPPIGADVPSLLLEKEEKEENTRLTL |
| Ga0212092_100100637 | 3300022548 | Hot Spring Microbial Mat | MFRGRSYIWQVAQLVAEHVLQGELPPSGVDVPSLLLEKEAKGENMRLAPL |
| Ga0212092_10062157 | 3300022548 | Hot Spring Microbial Mat | VAQLVAEQVLQEELPPIGVDVPSLPLEKEANEENMRLALL |
| Ga0212092_10895012 | 3300022548 | Hot Spring Microbial Mat | VAQLVAEHVLQGELPPIGVDVPSLLLENEAKEENIRLAPL |
| Ga0190286_10158113 | 3300024423 | Hydrothermal Vent Microbial Mat | VSQLVAEHELQEEIPPIGVDGLSLLLGKEAKEENIRFAPL |
| Ga0209182_101620991 | 3300025843 | Lake Sediment | VQPVAEHELQDELPPIGADSPSPLLETEEKEESIRLAL |
| Ga0214474_10410933 | 3300027740 | Soil | VQLGAEHEVQEELPPIGADVPSLLLEKEEKQENIRLAL |
| Ga0209121_100037286 | 3300027742 | Marine | VSQLVAAHELQEELSPIGVDGPSLLLEKEAKEENIRFAPL |
| Ga0209121_101238753 | 3300027742 | Marine | PPGFRAKGNYLLQLAQLSAEHVLQGLLFPIDVDISSVFPEGALKEEKIRLAPL |
| Ga0209121_101361422 | 3300027742 | Marine | MAEHVLQGELPPIGVDASSVFPEKEAKEENIRLATL |
| (restricted) Ga0233416_100712742 | 3300027799 | Sediment | MWQLAQLGAEHDPQEELPPTGVDTPSLLLEKEEKQDNIRLAL |
| (restricted) Ga0233416_101685811 | 3300027799 | Sediment | VSQLVAEHELQGALPPIGVDDPSLLLEKEAKEENIR |
| Ga0256868_1000001725 | 3300027811 | Soil | MWQVAQLVAEHEPQEELPPIGVDVPSPLLEKEEKDENIRLALW |
| Ga0256868_1000738510 | 3300027811 | Soil | MWQLVQPVAEHELQDEPPPIGADSPSPLLETEEKEESIRLAL |
| Ga0209633_101729552 | 3300027822 | Marine | MAEHVPQEEPPPSGVDVPSVLLEKEAKEENIRLASL |
| Ga0209635_100399844 | 3300027888 | Marine Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKDDNIRFAPL |
| Ga0209635_102243653 | 3300027888 | Marine Sediment | VSQLVAEHELQEGPPPIEVNGPSLLLEKEAKEENIRFAPL |
| Ga0209635_103710673 | 3300027888 | Marine Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKEENIRLAPL |
| Ga0209635_104872521 | 3300027888 | Marine Sediment | VSQLVAEHELQEELPPMGVDGPSLLLEKEAKEDNIRFAPL |
| Ga0209635_107882571 | 3300027888 | Marine Sediment | VSQLVAEHELQEEPPPIGIDGPSLLLEKEAKEDNIRFAP |
| Ga0209635_109453421 | 3300027888 | Marine Sediment | VSQLAAEHVLQEELPPIGVDGPSLFLEKEAKEENIRL |
| Ga0209636_100299741 | 3300027893 | Marine Sediment | GNYIWQVSQLVAEHELQEELPPIGVDGPSLLLEKEAKEENIRLAPL |
| Ga0209636_100676124 | 3300027893 | Marine Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKEDNILFAPL |
| Ga0209636_101337872 | 3300027893 | Marine Sediment | VAEHELQEELPPIGVDGPSLPLEKEAKEENIRLAPL |
| Ga0209636_102739782 | 3300027893 | Marine Sediment | VSQLVAEQELQEELPPIGADGPSLLLEKEAKAENIRLARL |
| Ga0209636_105270723 | 3300027893 | Marine Sediment | VAEHELQEELPPIGIDGPSLLLEKEAKEENIRFAPL |
| Ga0209427_104447662 | 3300027901 | Marine Sediment | VAEHELQEEVPPIGLDTPSVFLEKEAKEENIRSALL |
| Ga0209536_1012856473 | 3300027917 | Marine Sediment | VAEHGPQDELPPIGVDEPSSLLEKEAQVESTLLAPLWQRGQGATSFA |
| Ga0315554_100012131 | 3300031255 | Salt Marsh Sediment | LVSRKFVVRGSYIWQLEQLVAEHELQEEDPPIGVDGPSPLLEKEEKEENIRLAL |
| Ga0315554_100088110 | 3300031255 | Salt Marsh Sediment | VSQLVAEHELQEELSPIGVDGPALLLEKEAKEDNIRFAPL |
| Ga0315555_11945701 | 3300031257 | Salt Marsh Sediment | VSQLVAEHELQEELPPIGVDGPSLLLEKEAKEDNIRFAPL |
| Ga0307420_10273394 | 3300031281 | Salt Marsh | VSQLVAEHELQEELPPIGVDGHSLLLEKEAKEENIRFAPL |
| Ga0307430_11480971 | 3300031337 | Salt Marsh | VSQLVAEHELQEELSPIGVDGPALLLEKEAKEDNIRFVSL |
| Ga0307439_100028814 | 3300031356 | Salt Marsh | VAEHELQEELPPIGVDGPSLLLEKEAKEDNIRFAPL |
| Ga0315548_11920552 | 3300031551 | Salt Marsh Sediment | MWQVSQLVAEHELQEELPPIRVDGPSLPLEKEAKEDNIRFAPL |
| Ga0307436_11747402 | 3300031563 | Salt Marsh | VSQLVAEHELQEELSPIGVDGPALLLEKEAKEDNIRFA |
| Ga0315541_10943403 | 3300031586 | Salt Marsh Sediment | VSQLVAEHELQEELTPIGVDGLSLLLGKEAKEENIRFAPL |
| (restricted) Ga0315308_11542442 | 3300031587 | Sediment | VAQLVAEHELQGELPPIGVDDPSLLLEKEAKEENIRLAPL |
| (restricted) Ga0315307_12534712 | 3300031593 | Sediment | YLWQVSQVVAEHVLQGELPPIGVDTPSVLLEKEAKEERIRLAPLWQ |
| Ga0315552_11104881 | 3300031620 | Salt Marsh Sediment | FGLFAVSRWGSYIWQVSQLVAEHELQELPPIGVDGPSLLLEKEAKGENIRFAPL |
| Ga0315545_10680691 | 3300031624 | Salt Marsh Sediment | EQLAAGHELQEEVPPIGVDGPSPLLEKEEKEENTRLAL |
| Ga0315543_10342634 | 3300031651 | Salt Marsh Sediment | VLQLVAEHELQEELPPIGVDGPSVFLEKEAKEENIRFAPL |
| Ga0315549_10289762 | 3300031654 | Salt Marsh Sediment | VSQLVAEHELQEELSPIGIDGPSLLLEKEVKGENIRFAPL |
| Ga0315549_10499163 | 3300031654 | Salt Marsh Sediment | VSQLVAEHELQEELTPIGVDGPSLLLGKEAKEENIRFAPL |
| Ga0315537_10044469 | 3300031698 | Salt Marsh Sediment | VRGSYIWQLEQLVAEHELQEEDPPIGVDGPSPLLEKEEKEENIRLAL |
| Ga0315291_100586803 | 3300031707 | Sediment | MWQLVQLGAEHELQEALPPIGVDVPSLLLEKEEKQENIRLAL |
| Ga0315291_101372971 | 3300031707 | Sediment | MWQLVQLAAEHELQDELPPIGADSPSPLLETEEKEESIRLAL |
| Ga0315288_104139641 | 3300031772 | Sediment | MWQLVQLGAEHELQEEFPPIELEVPSLLLEKEEKQENIRLAL |
| Ga0315297_100115818 | 3300031873 | Sediment | MWQLVQPGAEHELQEALPPIGADVPSLLLEKEEKQENIRLAL |
| Ga0315297_101680504 | 3300031873 | Sediment | MWQLVQPVAEHELQDELPPIGADSPSPLLETEEKEESIRLAL |
| (restricted) Ga0315310_103505492 | 3300031876 | Sediment | MGYIWQVAQLVAEHELQGELPPIGVGSPSLLFEKEVKEENILVAPL |
| Ga0315294_101324213 | 3300031952 | Sediment | VAEHELQDELPPIGADSPSPLLETEEKEESIRLAL |
| Ga0315294_103063271 | 3300031952 | Sediment | MWQLVQPVAEHELQDELPPIGADSPSPLLETEEKEESI |
| Ga0315296_100592511 | 3300032020 | Sediment | IWPLCSFWRGSYVWQVAQLGAEHELQEELPPIGVDGPSPLLEKEAKEENIRVAPL |
| Ga0315546_10623162 | 3300032029 | Salt Marsh Sediment | VPQLVAEHELQEELTPIGVDGPSLLLGKEAKEENIRFAPL |
| Ga0315289_101924321 | 3300032046 | Sediment | MWQLVQLAAEHELQDELPPIGADSPSPLLETEEKEESIR |
| Ga0315289_108552813 | 3300032046 | Sediment | SQGSYMWQLVQPVAEHELQDELPPIGADSPSPLLETEEKEESIRLAL |
| Ga0315289_115548272 | 3300032046 | Sediment | MWQLVQPGAEHELQEALPPNGVDVPSLLLEKEEKQENIRLAL |
| Ga0315284_108656322 | 3300032053 | Sediment | MWQLVQLGAEHELQEELPPIELEVPSLLLEKEEKEESIRLAL |
| Ga0315551_1000012944 | 3300032062 | Salt Marsh Sediment | VAEHELQEELSPIGVDGPALLLEKEAKEDNIRFAPL |
| Ga0315277_100447006 | 3300032118 | Sediment | MWQVAQLVAEHEPQEELPPIGVDGPSLLLEKEAKEENTR |
| Ga0315295_1004006710 | 3300032156 | Sediment | MWQLVQLGAEHELQEELPPIELEVPSLLLEKEEKQESIRLAL |
| Ga0315295_105961921 | 3300032156 | Sediment | GAEHELQEALPPIGVDVPSLLLEKEEKQENIRLAL |
| Ga0316620_101527023 | 3300033480 | Soil | MDYMWQLVQLGAEHEPQEELPPIGVDVPSPLLEKEAQDENTRLAPL |
| Ga0316628_1002768024 | 3300033513 | Soil | MWQLVQLGAEHEPQEELPPIGVDVPSLLLEKEAQDENTRLPPL |
| Ga0334965_0019107_2823_2978 | 3300033991 | Sediment | LDPTVERGYMWQLVQLVAEHELQEELPPIGADVPSLLLEKEEKEENIRLTL |
| Ga0334965_0222462_600_707 | 3300033991 | Sediment | VAEHELQEELPPIGADGPSLLLEKEEKQENIRLAL |
| Ga0373900_057471_553_660 | 3300034078 | Sediment Slurry | VAEHELQEEVPSIGVDGPSPLLEKEAKEENIRLAP |
| Ga0373901_096677_394_522 | 3300034083 | Sediment Slurry | MWQLVQLGAEHELQEELPPIGVDVPSLLLEKEEKHENIRLAL |
| Ga0373910_0078198_652_783 | 3300034100 | Sediment Slurry | MWQLAQLGAEHELQEELPPIGADTPSLLLEKEEKQENIRLALW |
| ⦗Top⦘ |