| Basic Information | |
|---|---|
| Family ID | F069836 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 49 residues |
| Representative Sequence | LGDGFALGDGFALGDGFAIGDGFALGDGFAIGDGFAIGDCSLGDSGPGMR |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.37 % |
| % of genes from short scaffolds (< 2000 bps) | 89.43 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.057 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (9.756 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.659 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (69.919 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.38% Coil/Unstructured: 84.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00990 | GGDEF | 23.58 |
| PF07155 | ECF-ribofla_trS | 2.44 |
| PF13432 | TPR_16 | 1.63 |
| PF07584 | BatA | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG4720 | ECF-type riboflavin transporter, membrane (S) component | Coenzyme transport and metabolism [H] | 2.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.06 % |
| Unclassified | root | N/A | 8.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_120812228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300004156|Ga0062589_101105922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300004479|Ga0062595_101987319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300005093|Ga0062594_100714798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300005093|Ga0062594_101836744 | Not Available | 640 | Open in IMG/M |
| 3300005293|Ga0065715_10051119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
| 3300005330|Ga0070690_100183205 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300005331|Ga0070670_100074988 | All Organisms → cellular organisms → Bacteria | 2907 | Open in IMG/M |
| 3300005334|Ga0068869_101993154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005343|Ga0070687_100158885 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300005354|Ga0070675_100194695 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300005355|Ga0070671_100792406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300005364|Ga0070673_101000808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300005440|Ga0070705_100280718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1184 | Open in IMG/M |
| 3300005444|Ga0070694_101111307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300005456|Ga0070678_100114698 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300005458|Ga0070681_10894309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300005459|Ga0068867_101402595 | Not Available | 648 | Open in IMG/M |
| 3300005545|Ga0070695_101606586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300005546|Ga0070696_100443762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300005549|Ga0070704_101615386 | Not Available | 598 | Open in IMG/M |
| 3300005564|Ga0070664_102230776 | Not Available | 519 | Open in IMG/M |
| 3300005577|Ga0068857_101942990 | Not Available | 577 | Open in IMG/M |
| 3300005578|Ga0068854_102100792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005615|Ga0070702_100782839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300005617|Ga0068859_102917362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300005719|Ga0068861_101566205 | Not Available | 648 | Open in IMG/M |
| 3300005719|Ga0068861_102470838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300005840|Ga0068870_10057645 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
| 3300005841|Ga0068863_100338474 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300005843|Ga0068860_100138798 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
| 3300005843|Ga0068860_100530732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1177 | Open in IMG/M |
| 3300005844|Ga0068862_102649912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300005844|Ga0068862_102776096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300006046|Ga0066652_101311564 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300006804|Ga0079221_10871766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300006847|Ga0075431_101170995 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300006876|Ga0079217_10902338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300006954|Ga0079219_10117317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1347 | Open in IMG/M |
| 3300006969|Ga0075419_11400086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300009093|Ga0105240_10678842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1126 | Open in IMG/M |
| 3300009098|Ga0105245_11620627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300009148|Ga0105243_10767724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
| 3300009156|Ga0111538_10671234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
| 3300009174|Ga0105241_11258769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300009176|Ga0105242_12843455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300009177|Ga0105248_12452203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300009545|Ga0105237_10464919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1271 | Open in IMG/M |
| 3300009553|Ga0105249_10023671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5513 | Open in IMG/M |
| 3300010037|Ga0126304_10027112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3335 | Open in IMG/M |
| 3300010362|Ga0126377_12041475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300010373|Ga0134128_10287108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1844 | Open in IMG/M |
| 3300010396|Ga0134126_12955754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300010397|Ga0134124_10243054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1653 | Open in IMG/M |
| 3300010397|Ga0134124_10338791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1413 | Open in IMG/M |
| 3300010397|Ga0134124_11864482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300010400|Ga0134122_12532184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300010400|Ga0134122_12580105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300010403|Ga0134123_10336496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1356 | Open in IMG/M |
| 3300011119|Ga0105246_12271800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012948|Ga0126375_11409534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300013100|Ga0157373_10443096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300013100|Ga0157373_10465638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300013102|Ga0157371_11429653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300013297|Ga0157378_10016891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6397 | Open in IMG/M |
| 3300013297|Ga0157378_12029785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300013297|Ga0157378_12788027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300014325|Ga0163163_11765362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300014487|Ga0182000_10583371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300014745|Ga0157377_10740342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300014968|Ga0157379_10985282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300015262|Ga0182007_10302912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300015371|Ga0132258_12191794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300017792|Ga0163161_10305802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1253 | Open in IMG/M |
| 3300018067|Ga0184611_1144848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300018422|Ga0190265_10100338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2711 | Open in IMG/M |
| 3300018429|Ga0190272_13210157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300018466|Ga0190268_11699199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300018476|Ga0190274_12807356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300021445|Ga0182009_10197585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
| 3300024179|Ga0247695_1005865 | Not Available | 1761 | Open in IMG/M |
| 3300025900|Ga0207710_10211785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300025911|Ga0207654_10306505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1081 | Open in IMG/M |
| 3300025912|Ga0207707_11430757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300025918|Ga0207662_10171122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1393 | Open in IMG/M |
| 3300025925|Ga0207650_10105837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2172 | Open in IMG/M |
| 3300025925|Ga0207650_10796545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300025927|Ga0207687_11244353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300025931|Ga0207644_11846647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300025936|Ga0207670_10593163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300025937|Ga0207669_10892769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300025939|Ga0207665_10976357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 673 | Open in IMG/M |
| 3300025941|Ga0207711_10540167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1087 | Open in IMG/M |
| 3300025960|Ga0207651_10872022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300025960|Ga0207651_11671387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300025981|Ga0207640_11834380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300025981|Ga0207640_12109880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300026023|Ga0207677_12058309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300026035|Ga0207703_10158203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1982 | Open in IMG/M |
| 3300026041|Ga0207639_11081852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300026089|Ga0207648_10128582 | Not Available | 2229 | Open in IMG/M |
| 3300026095|Ga0207676_11269551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300026116|Ga0207674_10800524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300026116|Ga0207674_11151748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300026118|Ga0207675_101309821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300026118|Ga0207675_101924555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300026121|Ga0207683_10148378 | Not Available | 2116 | Open in IMG/M |
| 3300026312|Ga0209153_1065928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1310 | Open in IMG/M |
| 3300026629|Ga0207534_10145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300027761|Ga0209462_10060576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300030511|Ga0268241_10172419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300031716|Ga0310813_10608974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300031892|Ga0310893_10197518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300032002|Ga0307416_103136075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300032003|Ga0310897_10308099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300032005|Ga0307411_11874069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300032013|Ga0310906_11263487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300032180|Ga0307471_103590680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300032180|Ga0307471_103713630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300032205|Ga0307472_100869288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300033475|Ga0310811_10363466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1613 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 6.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.06% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026629 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK08-C (SPAdes) | Environmental | Open in IMG/M |
| 3300027761 | Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1208122281 | 3300000956 | Soil | LLLADGYAIGDGYALGDGYAIGDGYAIGDGYAIGDGYAVGDGYAVGDCALGESGPGMK* |
| Ga0062589_1011059221 | 3300004156 | Soil | DGFAIGDGFAMGDGFAIGDGFAMGDGFAIGDGFAIGDGFAIGDCSLGDSGPGMK* |
| Ga0062595_1019873191 | 3300004479 | Soil | DGYALGDGYALGDGYALGDGFALGDGFAIGDCSLGDAGTGMK* |
| Ga0062594_1007147982 | 3300005093 | Soil | LSNVLLLGDGFVLGDGYVLGDGYVLGDGYVLGDGFVLGDGYVLGDGYVLGDCSLGDTTAGMK* |
| Ga0062594_1018367441 | 3300005093 | Soil | FGGSYALSNALLLGDGFVLGDGFVLGDGYVLGDGFVLGDGFVLGDGFVLGDCSLGDSTAGMK* |
| Ga0065715_100511192 | 3300005293 | Miscanthus Rhizosphere | FFSNVLLLGDGYAIGDGYALGDGYAIGDGYAIGDGYAIGDGYAIGDCSLGDSGPGMR* |
| Ga0070690_1001832051 | 3300005330 | Switchgrass Rhizosphere | DGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDCSLGDNGPGMK* |
| Ga0070670_1000749881 | 3300005331 | Switchgrass Rhizosphere | DGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDNGPGMK* |
| Ga0068869_1019931542 | 3300005334 | Miscanthus Rhizosphere | LGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDCSLGDSGPGMR* |
| Ga0070687_1001588852 | 3300005343 | Switchgrass Rhizosphere | DGYAMGDGYAMGDGYAMGDGYAMGDGYAMGDCSLGDNGPGMK* |
| Ga0070675_1001946952 | 3300005354 | Miscanthus Rhizosphere | DGYAMGDGYAMGDGYAMGDGYAMGDGYAMGDGYAMGDCSLGDNGPGMK* |
| Ga0070671_1007924062 | 3300005355 | Switchgrass Rhizosphere | AIGDGYAIGDGYAIGDGYAIGDGYAVGDGYAIGDGYAIGDCSLGDSGPGMK* |
| Ga0070673_1010008082 | 3300005364 | Switchgrass Rhizosphere | QFGGSMFFSNVLLLGDGFALGDGFALGDGYAIGDGFALGDGFAIGDGFAIGDCSLGDSGSGMR* |
| Ga0070705_1002807182 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDGGPGMK* |
| Ga0070694_1011113072 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | IGDGFAIGDGYAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSVGDSGPGMK* |
| Ga0070678_1001146982 | 3300005456 | Miscanthus Rhizosphere | GGSMFFSNVLLLGDGFALGDGFALGDGYAIGDGFALGDGFAIGDGFAIGDCSLGDSGSGMR* |
| Ga0070681_108943092 | 3300005458 | Corn Rhizosphere | ALGDGFALGDGYALGDGFALGDGYALGDGYALGDGYALGDCSLGDSGPAMK* |
| Ga0068867_1014025952 | 3300005459 | Miscanthus Rhizosphere | SYALSNVLLLGDGFVLGDGFVLGDGYVLGDGFVLGDGFVLGDGFVLGDCSLGDSTTGMK* |
| Ga0070695_1016065862 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLGDGFALGDGFALGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDSGPAMK* |
| Ga0070696_1004437621 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GDGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDGGPGMK* |
| Ga0070704_1016153861 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGDGFVLGDGFVLGDGYVLGDGFVLGDGFVLGDGFVLGDCSLGDSTAGMK* |
| Ga0070664_1022307762 | 3300005564 | Corn Rhizosphere | FGGSYVLSNVLLLGDGFVLGDGFVLGDGYVLGDGFVLGDGFVLGDGFVLGDSSLGDSGAGMK* |
| Ga0068857_1019429901 | 3300005577 | Corn Rhizosphere | ELFGGSYALSTVLLLGDGFVLGDGFVLGDGYVLGDGFVLGDGFVLGDGFVLGDCSLGDNASGMK* |
| Ga0068854_1021007921 | 3300005578 | Corn Rhizosphere | GDGYAIGDGYSIGDGYAIGDGYAIGDCSLGDSGPGMK* |
| Ga0070702_1007828391 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | DGYAIGDGYAVGDGYAIGDGYAVGDGYAVGDGYAVGDCSLGDTGPSMK* |
| Ga0068859_1029173622 | 3300005617 | Switchgrass Rhizosphere | LGNGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDCSLGDNGASMK* |
| Ga0068861_1015662052 | 3300005719 | Switchgrass Rhizosphere | LGDGFVIGDGFVLGDGFVLGDGFVLGDCSLGDSGAAMK* |
| Ga0068861_1024708382 | 3300005719 | Switchgrass Rhizosphere | MGDGYAMGDGYAMGDGYAMGDGYAMGDGYAMGDCSLGDNGPGMK* |
| Ga0068870_100576451 | 3300005840 | Miscanthus Rhizosphere | SALFGGSIFFSNVLLLGDGYVLGDGYVLGDGYVLGDGYVLGDGYVLGDCSLGDNTTGMK* |
| Ga0068863_1003384741 | 3300005841 | Switchgrass Rhizosphere | LLGDGFVLGDGFVLGDGYVLGDGFVLGDGFVLGDGFVLGDSSLGDSGAGMK* |
| Ga0068860_1001387981 | 3300005843 | Switchgrass Rhizosphere | DGFALGDGYPMGDGFAIGDGYAMGDGFALGDGFAIGDCSTGEPGPGMR* |
| Ga0068860_1005307321 | 3300005843 | Switchgrass Rhizosphere | DGYAIGDGYAIGDGYAVGDGYAVGDGYAVGDGYAIGDCSLGDNGAGMK* |
| Ga0068862_1026499122 | 3300005844 | Switchgrass Rhizosphere | FFSNALLLGDGFALGDGFALGDGYALGDGFALGDGFALGDGFALGDGFALGDCSLGDSGPAMK* |
| Ga0068862_1027760962 | 3300005844 | Switchgrass Rhizosphere | FAIGDGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSVGDNGPGMK* |
| Ga0066652_1013115641 | 3300006046 | Soil | LGDGFALGDGFALGDGFALGDGFALGDGFALGDCSLGDPGPAMK* |
| Ga0079221_108717662 | 3300006804 | Agricultural Soil | GFALGDGFALGDGYALGDGYALGDGYALGDGFALGDGFALGDCSLGDSGPAMK* |
| Ga0075431_1011709951 | 3300006847 | Populus Rhizosphere | SALFGGSYFLSNSLLLGDGFVLGDGFVLGDGFVIGDGFVLGDGFVLGDGFVLGDCSLGDSGAAMK* |
| Ga0075433_109326071 | 3300006852 | Populus Rhizosphere | DGFVIGDGFVLGDGFVLGDGFVLGDCSLGDSGAAMK* |
| Ga0079217_109023382 | 3300006876 | Agricultural Soil | GFAMGDGFAMGDGFAMGDGFAMGDCSLGDSGPEMK* |
| Ga0079219_101173172 | 3300006954 | Agricultural Soil | GDGYAIGDGYAIGDGYAVGDGYAIGDGYAVGDCSLGDSGAGMK* |
| Ga0075419_114000862 | 3300006969 | Populus Rhizosphere | GDGFAIGDGYAMGDGFALGDGFAIGDCSTGEPGPGMR* |
| Ga0105240_106788421 | 3300009093 | Corn Rhizosphere | AMGDGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDGGPGMK* |
| Ga0105245_116206272 | 3300009098 | Miscanthus Rhizosphere | GFAIGDGFAMGDGFAIGDGFAIGDGFAIGDCSLGDSGPGMK* |
| Ga0105243_107677241 | 3300009148 | Miscanthus Rhizosphere | GYALGDGYALGDGFALGDGFAIGDCSLGDAGSGMK* |
| Ga0105243_122604262 | 3300009148 | Miscanthus Rhizosphere | NVLLLGDGFVLGDGYVLGDGYVLGDGYVLGDGFVLGDGYVLGDGYVLGDCSLGDTTAGMK |
| Ga0111538_106712341 | 3300009156 | Populus Rhizosphere | NALLLGDGFVLGDGFVLGDGFVIGDGFVLGDGFVLGDGFVLGDCSLGDSGAAMK* |
| Ga0105241_112587692 | 3300009174 | Corn Rhizosphere | FAIGDGYAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSVGDSGPGMK* |
| Ga0105242_128434552 | 3300009176 | Miscanthus Rhizosphere | LLGDGFALGDGYALGDGYALGDGYALGDGFALGDGFAIGDCSLGDAGSGMK* |
| Ga0105248_124522032 | 3300009177 | Switchgrass Rhizosphere | GFAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDNGPGMK* |
| Ga0105237_104649192 | 3300009545 | Corn Rhizosphere | ALLLGDGFALGDGYALGDGYALGDGYALGDGFALGDGFAIGDCSLGDAGSGMK* |
| Ga0105249_100236711 | 3300009553 | Switchgrass Rhizosphere | ILLGDGFALGDGYPMGDGFAIGDGYAMGDGFALGDGFAIGDCSTGEPGPGMR* |
| Ga0126304_100271123 | 3300010037 | Serpentine Soil | SDGTAQFGGSVFFSNVILLGNGYVLGDGYVLGDGYVLGDGYALGDGYALGDGYVLGDCSTGDSGPGLR* |
| Ga0126377_120414752 | 3300010362 | Tropical Forest Soil | GSALFGGSYFLSNSLLLGDGFAMGDGFALGDGFAIGDGFALGDGFAIGDCSLGDSGAGMK |
| Ga0134128_102871082 | 3300010373 | Terrestrial Soil | GSYALSNVLLLGDGFVLGDGFVLGDGYVLGDGFVLGDGYVLGDGFVLGDCSLGDSTTGMK |
| Ga0134126_129557542 | 3300010396 | Terrestrial Soil | NVLLLGDGFALGDGFALGDGYAIGDGFALGDGFALGDGFALGDGFALGDCSLGDSGPAMK |
| Ga0134124_102430542 | 3300010397 | Terrestrial Soil | AIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDSGPGMK* |
| Ga0134124_103387912 | 3300010397 | Terrestrial Soil | AIGDGYALGDGYAIGDGYAVGDGYAIGDGYAVGDCSLGDSGAGMK* |
| Ga0134124_118644821 | 3300010397 | Terrestrial Soil | LLLLGDGFALGDGFALGDGYALGNGFALGDGYALGDGYALGDGFALGDCSLGDSGPAMK* |
| Ga0134122_125321841 | 3300010400 | Terrestrial Soil | IGDGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDGFAMGDCSVGDNGPGMK* |
| Ga0134122_125801051 | 3300010400 | Terrestrial Soil | LGDGFALGDGYAIGDGYALGDGFALGDGFAIGDCSVGDAGSGMK* |
| Ga0134123_103364962 | 3300010403 | Terrestrial Soil | GDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDGGPGMK* |
| Ga0105246_122718002 | 3300011119 | Miscanthus Rhizosphere | AIGDGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDNGPGMK* |
| Ga0126375_114095342 | 3300012948 | Tropical Forest Soil | LLLGDGFVLGDGFVLGDGFVIGDGFVLGDGFVLGDGFVLGDCSLGDAGLAMK* |
| Ga0157373_104430961 | 3300013100 | Corn Rhizosphere | DGSALFGGSYALSSVLLLGDGFVLGDGFVLGDGYVLGDGFVLGDGYVRGDGFVLGDCSLGDSTAGMK* |
| Ga0157373_104656381 | 3300013100 | Corn Rhizosphere | IGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDCSLGDTGPGMK* |
| Ga0157371_114296531 | 3300013102 | Corn Rhizosphere | FGGSMFFSNVLLLGDGFALGDGFALGDGYAIGDGFALGDGFAIGDGFAIGDCSLGDSGSGMR* |
| Ga0157378_100168911 | 3300013297 | Miscanthus Rhizosphere | GDGYPMGDGFAIGDGYAMGDGFALGDGFAIGDCSTGEPGPGMR* |
| Ga0157378_120297852 | 3300013297 | Miscanthus Rhizosphere | FAIGDGFAMGDGFAIGDGFAIGDGFAMGDDCALGDSTLGMK* |
| Ga0157378_127880272 | 3300013297 | Miscanthus Rhizosphere | LLLGDGFALGDGFALGDGYAIGDGFALGDGFALGDGFALGDGFALGDCSLGDSGPAMK* |
| Ga0163163_117653622 | 3300014325 | Switchgrass Rhizosphere | AIGDGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDNGPGMK* |
| Ga0182000_105833711 | 3300014487 | Soil | GFALGDGYALGDGFALGDGYALGDGFALGDGFALGDCSTGDAGPAMK* |
| Ga0157377_107403422 | 3300014745 | Miscanthus Rhizosphere | ALFGGSVFFSNVILLGDGFALGDGYPMGDGFAIGDGYAMGDGFALGDGFAIGDCSTGEPGPGMR* |
| Ga0157379_109852821 | 3300014968 | Switchgrass Rhizosphere | VLLLGDGFVLGDGFVLGDGYVLGDGFVLGDGYVLGDGFVLGDCSLGDSTTGMK* |
| Ga0182007_103029121 | 3300015262 | Rhizosphere | FLSNALLLGDGFAIGDGFALGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGE* |
| Ga0132258_121917942 | 3300015371 | Arabidopsis Rhizosphere | LGDGFALGDGFALGDGFAIGDGFALGDGFAIGDGFAIGDCSLGDSGPGMR* |
| Ga0163161_103058021 | 3300017792 | Switchgrass Rhizosphere | IGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDCSLGDNGPGMK |
| Ga0184611_11448482 | 3300018067 | Groundwater Sediment | GTAQFGGSVFFSNVILLGDGFVLGDGFVLGDGYVLGDGFVLGDGYALGDGYVLGDCSTGDSGPGMR |
| Ga0190265_101003383 | 3300018422 | Soil | AIGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDCSLGDSGPGMK |
| Ga0190272_132101572 | 3300018429 | Soil | YAIGDGFAIGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDCSLGDSGPGMK |
| Ga0190268_116991992 | 3300018466 | Soil | IGDGFAIGDGFAIGDGFAIGDGFAIGDCSVGDSGAGMK |
| Ga0190274_128073562 | 3300018476 | Soil | DGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDNGPGMK |
| Ga0182009_101975852 | 3300021445 | Soil | GDGSALGDGYAIGDGFALGDGYALGDGFALGDGFALGDCALGDSGSAMK |
| Ga0247695_10058652 | 3300024179 | Soil | GFALGDGFALGDGFALGDGFALGDGFALGDCSLGDSSAGMK |
| Ga0207710_102117851 | 3300025900 | Switchgrass Rhizosphere | GFAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDNGPGMK |
| Ga0207654_103065052 | 3300025911 | Corn Rhizosphere | YAIGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDCSLGDNGAGMK |
| Ga0207707_114307571 | 3300025912 | Corn Rhizosphere | SNVILLGDGFAIGDGFAMGDGFAIGDGFAIGDGFAMGDDCALGDSSPGMK |
| Ga0207662_101711221 | 3300025918 | Switchgrass Rhizosphere | AMGDGYAMGDGYAMGDGYAMGDGYAMGDGYAMGDCSLGDNGPGMK |
| Ga0207650_101058371 | 3300025925 | Switchgrass Rhizosphere | DGFAIGDGFAIGDGFAIGDGFAIGDCSLGDNSPGMK |
| Ga0207650_107965452 | 3300025925 | Switchgrass Rhizosphere | FFSNVILLGDGFALGDGFALCDGFAIGDGYAMGDGFALGDGFAIGDCSTGEPGAGMR |
| Ga0207687_112443532 | 3300025927 | Miscanthus Rhizosphere | YPMGDGFAIGDGYAMGDGFALGDGFAIGDCSTGEPGPGMR |
| Ga0207644_118466472 | 3300025931 | Switchgrass Rhizosphere | FFSNVILLGDGFALGDGYPMGDGFAIGDGYAMGDGFALGDGFAIGDCSTGEPGPGMR |
| Ga0207670_105931631 | 3300025936 | Switchgrass Rhizosphere | DGYAIGDGYAVGDGYAIGDGYAIGDCSLGDSGPGMK |
| Ga0207669_108927692 | 3300025937 | Miscanthus Rhizosphere | GDGFALGDGYAIGDGFALGDGFAIGDGFAIGDCSLGDSGSGMR |
| Ga0207665_109763571 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLGDGFALGDGFALGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDGGPAMK |
| Ga0207711_105401672 | 3300025941 | Switchgrass Rhizosphere | GDGFAIGDGYAMGDGFALGDGFAIGDCSTGEPGPGMR |
| Ga0207651_108720222 | 3300025960 | Switchgrass Rhizosphere | GFVIGDGFVLGDGFVLGDGFVLGDCSLGDSGAAMK |
| Ga0207651_116713871 | 3300025960 | Switchgrass Rhizosphere | QFGGSMFFSNVLLLGDGFALGDGFALGDGYAIGDGFALGDGFAIGDGFAIGDCSLGDSGSGMR |
| Ga0207640_118343801 | 3300025981 | Corn Rhizosphere | ALGDGFALGDGYAIGDGYALGDGFALGDGFAIGDCSLGDVGTGMK |
| Ga0207640_121098801 | 3300025981 | Corn Rhizosphere | LLLGDGFAIGDGYAIGDGYAIGDGYAVGDGYAIGDGYAIGDCSLGDSGPGMK |
| Ga0207677_120583091 | 3300026023 | Miscanthus Rhizosphere | GDGYAIGDGYAIGDGYAVGDGYAIGDCSLGDSGPGMK |
| Ga0207703_101582032 | 3300026035 | Switchgrass Rhizosphere | DGYAIGDGYAIGDGYAVGDGYAIGDGYAIGDCSLGDSGPGMK |
| Ga0207639_110818522 | 3300026041 | Corn Rhizosphere | SDLLLLGDGFALGDGFALGDGYALGDGFALGDGYALGDGYALGDGFALGDCSLGDSGPAM |
| Ga0207648_101285822 | 3300026089 | Miscanthus Rhizosphere | FALGDGYAIGDGFALGDGFAIGDGFAIGDCSLGDSGSGMR |
| Ga0207676_112695512 | 3300026095 | Switchgrass Rhizosphere | DGFALGDGFAMGDGFAIGDGYAMGDGFALGDGFAIGDCSTGDPGAGMR |
| Ga0207674_108005241 | 3300026116 | Corn Rhizosphere | IGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDSGPGMK |
| Ga0207674_111517481 | 3300026116 | Corn Rhizosphere | GYAIGDGYAIGDGYAIGDGYAIGDGYAIGDGYAIGDCSLGDNGAGMK |
| Ga0207675_1013098212 | 3300026118 | Switchgrass Rhizosphere | FVLGDGFVLGDGFVIGDGFVLGDGFVLGDGFVLGDCSLGDSGAAMK |
| Ga0207675_1019245552 | 3300026118 | Switchgrass Rhizosphere | GGSVFFSNVILLGDGFALGDGFALGDGFAIGDGYAMGDGFALGDGFAIGDCSTGEPGAGM |
| Ga0207683_101483782 | 3300026121 | Miscanthus Rhizosphere | SMFFSNVLLLGDGFALGDGFALGDGYAIGDGFALGDGFAIGDGFAIGDCSLGDSGSGMR |
| Ga0209153_10659281 | 3300026312 | Soil | DGFALGDGFAIGDGFALGDGFAIGDGFAIGDCYGGDDGPGMK |
| Ga0207534_101452 | 3300026629 | Soil | GYALGDGYALGDGFALGDGFAIGDCSLGDAGTGMK |
| Ga0209462_100605761 | 3300027761 | Agave | GDGYAMGDGYAMGDGYAMGDGYAMGDCSIGDNGPGMK |
| Ga0268241_101724192 | 3300030511 | Soil | ALGDGYALGDGYALGDGYALGDGFALGDCSLGDSGPAMK |
| Ga0310813_106089742 | 3300031716 | Soil | AIGDGFAIGDGYAIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDSGPGMK |
| Ga0310893_101975182 | 3300031892 | Soil | YAMGDGYAMGDGYAMGDGYAMGDGYAMGDGYAMGDCSLGDNGPGMK |
| Ga0307416_1031360752 | 3300032002 | Rhizosphere | ITNALLLGDGFALGDGFALGDGFALGDGFALGDGFALGDGFALGDCTTGDSGPGMK |
| Ga0310897_103080991 | 3300032003 | Soil | YAMGDGYAMGDGYAMGDGYAMGDGYAMGDCSLGDNGPGMK |
| Ga0307411_118740691 | 3300032005 | Rhizosphere | GDGYAIGDGYAIGDGYAIGDGYAIGDCSLGDSGPGMK |
| Ga0310906_112634872 | 3300032013 | Soil | VAHSVAVAMGDGYAMGDGYAMGDGYAMGDGYAMGDGYAMGDCSLGDNGPGMK |
| Ga0307471_1035906802 | 3300032180 | Hardwood Forest Soil | SNALLLGDGFVLGDGFVLGDGFVIGDGFVLGDGFVLGDGFVLGDCSLGDSGPSMK |
| Ga0307471_1037136301 | 3300032180 | Hardwood Forest Soil | PIGGGSIFMSNVLLLGDGFALGDGYALGDGYALGDGFALGDGYALGDDCLLGDDGPGME |
| Ga0307472_1008692882 | 3300032205 | Hardwood Forest Soil | AIGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGDSGPGMK |
| Ga0310811_103634661 | 3300033475 | Soil | LLLGDGFAIGDGFALGDGFAIGDGFAIGDGFAIGDGFAIGDCSLGE |
| ⦗Top⦘ |