| Basic Information | |
|---|---|
| Family ID | F069475 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 44 residues |
| Representative Sequence | SAAVHRLAAAARPLIGTLDADQMRAAHGLAQEMGLGPVVAALR |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 97.58 % |
| % of genes from short scaffolds (< 2000 bps) | 88.71 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.065 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (9.677 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.968 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF03480 | DctP | 58.06 |
| PF06808 | DctM | 4.03 |
| PF13458 | Peripla_BP_6 | 2.42 |
| PF12697 | Abhydrolase_6 | 1.61 |
| PF07813 | LTXXQ | 1.61 |
| PF04290 | DctQ | 0.81 |
| PF00211 | Guanylate_cyc | 0.81 |
| PF02775 | TPP_enzyme_C | 0.81 |
| PF13751 | DDE_Tnp_1_6 | 0.81 |
| PF13520 | AA_permease_2 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 6.45 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.06 % |
| All Organisms | root | All Organisms | 41.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908028|beta3_all_NODE_36418_len_624_cov_18_391026 | Not Available | 674 | Open in IMG/M |
| 2170459005|F1BAP7Q01DW6F7 | Not Available | 509 | Open in IMG/M |
| 2209111022|2221189781 | Not Available | 511 | Open in IMG/M |
| 3300000734|JGI12535J11911_1019014 | Not Available | 541 | Open in IMG/M |
| 3300001417|JGI20196J14858_1002659 | Not Available | 1549 | Open in IMG/M |
| 3300002244|JGI24742J22300_10107284 | Not Available | 544 | Open in IMG/M |
| 3300003995|Ga0055438_10253490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300004019|Ga0055439_10287088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300005168|Ga0066809_10106967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
| 3300005186|Ga0066676_10980460 | Not Available | 563 | Open in IMG/M |
| 3300005204|Ga0068997_10049269 | Not Available | 805 | Open in IMG/M |
| 3300005330|Ga0070690_100678070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 790 | Open in IMG/M |
| 3300005332|Ga0066388_105391091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300005332|Ga0066388_106623231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 584 | Open in IMG/M |
| 3300005336|Ga0070680_100428475 | Not Available | 1129 | Open in IMG/M |
| 3300005336|Ga0070680_100610364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 936 | Open in IMG/M |
| 3300005341|Ga0070691_10101630 | Not Available | 1428 | Open in IMG/M |
| 3300005435|Ga0070714_100852475 | Not Available | 884 | Open in IMG/M |
| 3300005439|Ga0070711_101162453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 666 | Open in IMG/M |
| 3300005440|Ga0070705_100058686 | Not Available | 2275 | Open in IMG/M |
| 3300005458|Ga0070681_11665624 | Not Available | 564 | Open in IMG/M |
| 3300005459|Ga0068867_101774462 | Not Available | 580 | Open in IMG/M |
| 3300005466|Ga0070685_10263207 | Not Available | 1147 | Open in IMG/M |
| 3300005545|Ga0070695_100250218 | Not Available | 1289 | Open in IMG/M |
| 3300005549|Ga0070704_101021748 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005616|Ga0068852_101673938 | Not Available | 659 | Open in IMG/M |
| 3300005713|Ga0066905_101646091 | Not Available | 588 | Open in IMG/M |
| 3300005834|Ga0068851_10515525 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 719 | Open in IMG/M |
| 3300005842|Ga0068858_101006815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 817 | Open in IMG/M |
| 3300005949|Ga0066791_10036879 | Not Available | 966 | Open in IMG/M |
| 3300006041|Ga0075023_100592846 | Not Available | 514 | Open in IMG/M |
| 3300006579|Ga0074054_11954136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300006806|Ga0079220_10228833 | Not Available | 1096 | Open in IMG/M |
| 3300007076|Ga0075435_100379843 | Not Available | 1213 | Open in IMG/M |
| 3300007076|Ga0075435_100387800 | Not Available | 1200 | Open in IMG/M |
| 3300009093|Ga0105240_11934245 | Not Available | 613 | Open in IMG/M |
| 3300009551|Ga0105238_13007128 | Not Available | 506 | Open in IMG/M |
| 3300010046|Ga0126384_10241923 | Not Available | 1454 | Open in IMG/M |
| 3300010231|Ga0136216_1058706 | Not Available | 615 | Open in IMG/M |
| 3300010362|Ga0126377_12393440 | Not Available | 604 | Open in IMG/M |
| 3300010371|Ga0134125_13113104 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010375|Ga0105239_12694477 | Not Available | 580 | Open in IMG/M |
| 3300010396|Ga0134126_10183061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus | 2518 | Open in IMG/M |
| 3300010396|Ga0134126_10381966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1638 | Open in IMG/M |
| 3300010399|Ga0134127_10966532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 910 | Open in IMG/M |
| 3300010399|Ga0134127_11730004 | Not Available | 701 | Open in IMG/M |
| 3300010399|Ga0134127_12580044 | Not Available | 588 | Open in IMG/M |
| 3300010403|Ga0134123_10077226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2583 | Open in IMG/M |
| 3300011269|Ga0137392_10266130 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1413 | Open in IMG/M |
| 3300012004|Ga0120134_1036590 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012206|Ga0137380_11297541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300012948|Ga0126375_10797620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122 | 747 | Open in IMG/M |
| 3300012961|Ga0164302_10856917 | Not Available | 692 | Open in IMG/M |
| 3300012964|Ga0153916_12007408 | Not Available | 648 | Open in IMG/M |
| 3300012985|Ga0164308_10593527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 941 | Open in IMG/M |
| 3300013102|Ga0157371_10111714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1940 | Open in IMG/M |
| 3300013105|Ga0157369_10814272 | Not Available | 959 | Open in IMG/M |
| 3300013308|Ga0157375_13761902 | Not Available | 504 | Open in IMG/M |
| 3300014205|Ga0172380_10667918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300014314|Ga0075316_1126343 | Not Available | 629 | Open in IMG/M |
| 3300014325|Ga0163163_12233502 | Not Available | 606 | Open in IMG/M |
| 3300014838|Ga0182030_10559581 | Not Available | 1118 | Open in IMG/M |
| 3300014969|Ga0157376_10289784 | Not Available | 1545 | Open in IMG/M |
| 3300015372|Ga0132256_101724058 | Not Available | 735 | Open in IMG/M |
| 3300015374|Ga0132255_105670955 | Not Available | 528 | Open in IMG/M |
| 3300016294|Ga0182041_11789360 | Not Available | 569 | Open in IMG/M |
| 3300016341|Ga0182035_11531253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300016422|Ga0182039_10242397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1464 | Open in IMG/M |
| 3300017939|Ga0187775_10161853 | Not Available | 805 | Open in IMG/M |
| 3300017944|Ga0187786_10266082 | Not Available | 687 | Open in IMG/M |
| 3300017961|Ga0187778_10009872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5970 | Open in IMG/M |
| 3300018029|Ga0187787_10301415 | Not Available | 602 | Open in IMG/M |
| 3300018032|Ga0187788_10464075 | Not Available | 542 | Open in IMG/M |
| 3300018060|Ga0187765_11377577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense | 503 | Open in IMG/M |
| 3300018073|Ga0184624_10488037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300019879|Ga0193723_1118153 | Not Available | 737 | Open in IMG/M |
| 3300021078|Ga0210381_10334657 | Not Available | 551 | Open in IMG/M |
| 3300022892|Ga0247753_1001048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2672 | Open in IMG/M |
| 3300023067|Ga0247743_1034830 | Not Available | 695 | Open in IMG/M |
| 3300023102|Ga0247754_1001622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3944 | Open in IMG/M |
| 3300025321|Ga0207656_10666619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300025475|Ga0208478_1100868 | Not Available | 505 | Open in IMG/M |
| 3300025495|Ga0207932_1099509 | Not Available | 576 | Open in IMG/M |
| 3300025544|Ga0208078_1067353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 745 | Open in IMG/M |
| 3300025930|Ga0207701_11085282 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300025972|Ga0207668_10066164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2561 | Open in IMG/M |
| 3300026031|Ga0208909_1030628 | Not Available | 548 | Open in IMG/M |
| 3300026088|Ga0207641_10779170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 945 | Open in IMG/M |
| 3300026759|Ga0207527_100410 | Not Available | 1157 | Open in IMG/M |
| 3300026817|Ga0207775_118877 | Not Available | 518 | Open in IMG/M |
| 3300026824|Ga0207723_100427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4744 | Open in IMG/M |
| 3300026847|Ga0207802_1001501 | Not Available | 2188 | Open in IMG/M |
| 3300026858|Ga0207729_104064 | Not Available | 796 | Open in IMG/M |
| 3300026866|Ga0207786_100751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3326 | Open in IMG/M |
| 3300026867|Ga0207475_1000713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1535 | Open in IMG/M |
| 3300026910|Ga0207840_1008143 | Not Available | 1141 | Open in IMG/M |
| 3300027435|Ga0207553_1009477 | Not Available | 521 | Open in IMG/M |
| 3300027560|Ga0207981_1059230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300027680|Ga0207826_1006384 | Not Available | 3194 | Open in IMG/M |
| 3300027703|Ga0207862_1016934 | Not Available | 2161 | Open in IMG/M |
| 3300027775|Ga0209177_10020494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1627 | Open in IMG/M |
| 3300027819|Ga0209514_10403527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300027910|Ga0209583_10757282 | Not Available | 512 | Open in IMG/M |
| 3300028556|Ga0265337_1193774 | Not Available | 552 | Open in IMG/M |
| 3300028589|Ga0247818_10224719 | Not Available | 1237 | Open in IMG/M |
| 3300028715|Ga0307313_10117749 | Not Available | 812 | Open in IMG/M |
| 3300028876|Ga0307286_10327048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300029913|Ga0311362_10534957 | Not Available | 1072 | Open in IMG/M |
| 3300031595|Ga0265313_10025817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3106 | Open in IMG/M |
| 3300031653|Ga0315550_1144261 | Not Available | 958 | Open in IMG/M |
| 3300031770|Ga0318521_10452477 | Not Available | 769 | Open in IMG/M |
| 3300031779|Ga0318566_10537671 | Not Available | 571 | Open in IMG/M |
| 3300031792|Ga0318529_10348671 | Not Available | 689 | Open in IMG/M |
| 3300031847|Ga0310907_10500038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 650 | Open in IMG/M |
| 3300031913|Ga0310891_10089446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300031913|Ga0310891_10238184 | Not Available | 624 | Open in IMG/M |
| 3300031946|Ga0310910_10247536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122 | 1393 | Open in IMG/M |
| 3300032001|Ga0306922_10179345 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300032076|Ga0306924_11131472 | Not Available | 851 | Open in IMG/M |
| 3300032770|Ga0335085_10422595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1541 | Open in IMG/M |
| 3300032828|Ga0335080_10962275 | Not Available | 872 | Open in IMG/M |
| 3300033433|Ga0326726_10929071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 844 | Open in IMG/M |
| 3300033760|Ga0314870_021249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300034817|Ga0373948_0044229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.23% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.61% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.81% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.81% |
| Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908028 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300000734 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 | Environmental | Open in IMG/M |
| 3300001417 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 | Environmental | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005949 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010231 | Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week5, replicate 1 | Engineered | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
| 3300023067 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026031 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026759 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026817 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes) | Environmental | Open in IMG/M |
| 3300026824 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300026858 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026866 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 76 (SPAdes) | Environmental | Open in IMG/M |
| 3300026867 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
| 3300027435 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K3-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031653 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033760 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_C | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| beta3_all_00485830 | 2124908028 | Soil | IVLNSAAVERLVVAARPLIAKLNDEQKQAAGQLAQEMGLGSVVMAALN |
| E41_04515590 | 2170459005 | Grass Soil | VVTIVLNSAAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR |
| 2222003664 | 2209111022 | Grass Soil | AVSARPLMAMLDADQMRAAHGLAREMGLGPVVAALK |
| JGI12535J11911_10190143 | 3300000734 | Tropical Forest Soil | VSIALNSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN* |
| JGI20196J14858_10026591 | 3300001417 | Arctic Peat Soil | SRRVISIVLNSAAVERLVVAARPLIAKLNDEQKQAAGQLAQEMGLGSVVMAALN* |
| JGI24742J22300_101072841 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | AAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK* |
| Ga0055438_102534901 | 3300003995 | Natural And Restored Wetlands | NSATIQKLAAAARPLIGVLDAEQMRTAHGLAQEMGLGPVVATLR* |
| Ga0055439_102870881 | 3300004019 | Natural And Restored Wetlands | RVVSIALNSATIQKLAAAARPLIGVLDAEQMRTAHGLAQEMGLGPVVATLR* |
| Ga0066809_101069671 | 3300005168 | Soil | QRLAVAARPLIGTLDPEQMRAAQGLAQEMGLGPVVAALR* |
| Ga0066676_109804601 | 3300005186 | Soil | VVLNSAAVQRLAVAARPLIAMLDDEQRRAAHGLAQEMGLGPVVAALR* |
| Ga0068997_100492691 | 3300005204 | Natural And Restored Wetlands | VSIALNSATIQKLAAAARPLIGVLDAEQMRTAHGLAQEMGLGPVVAALR* |
| Ga0070690_1006780702 | 3300005330 | Switchgrass Rhizosphere | VHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK* |
| Ga0066388_1053910912 | 3300005332 | Tropical Forest Soil | VTVVLNSSAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR* |
| Ga0066388_1066232311 | 3300005332 | Tropical Forest Soil | AAVQRLAVAARPLVASLDQEQMRAAQGLAQEMGLGPVVAALR* |
| Ga0070680_1004284752 | 3300005336 | Corn Rhizosphere | HRVVSIVLNSAAVQRLAVAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK* |
| Ga0070680_1006103641 | 3300005336 | Corn Rhizosphere | QVALNSATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK* |
| Ga0070691_101016301 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | ATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK* |
| Ga0070714_1008524752 | 3300005435 | Agricultural Soil | SIVLNSAAVQRLAVAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK* |
| Ga0070711_1011624532 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TSAAVQRLASAARPLIAALSDEQKRSAQSLAQEMGLGPVVAALN* |
| Ga0070705_1000586862 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RVSKRAVQIALNSATIHRLAAAARPLVKTFDEHQMQTAQGLAQQMGLGPVVAALK* |
| Ga0070681_116656241 | 3300005458 | Corn Rhizosphere | SIQRVASAARPLIAVLDFQQLQAASGLCNQMGLGPVVAALR* |
| Ga0068867_1017744622 | 3300005459 | Miscanthus Rhizosphere | RVVSIVLNSAAVQRLAVAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK* |
| Ga0070685_102632071 | 3300005466 | Switchgrass Rhizosphere | HRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK* |
| Ga0070695_1002502182 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LNSAAVQRLAVAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK* |
| Ga0070704_1010217481 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RAVQIALNSATIHRLAAAARPLVKTFDEHQMQTAQGLAQQMGLGPVVAALK* |
| Ga0068852_1016739382 | 3300005616 | Corn Rhizosphere | IARVAAAARPLAAVLDQEQMQAASGLASEMGLGPVVAALR* |
| Ga0066905_1016460911 | 3300005713 | Tropical Forest Soil | VQRLAVAARPLVASLDHEQMRAAQGLAQEMGLGPVVAALR* |
| Ga0068851_105155252 | 3300005834 | Corn Rhizosphere | AAARPLAAVLDQEQMQAASGLASEMGLGPVVAALR* |
| Ga0068858_1010068153 | 3300005842 | Switchgrass Rhizosphere | ALNSATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK* |
| Ga0066791_100368791 | 3300005949 | Soil | VERLVVAARPLIAKLDDQQKQAAGQLAQEMGLGSVVMAALN* |
| Ga0075023_1005928462 | 3300006041 | Watersheds | NSAAVQRLAVAARPLIAKLDEDQMRAAHGLAAEMGLGPVVAALR* |
| Ga0074054_119541361 | 3300006579 | Soil | VSVVLNSAAVQRLAVSARPLIAMLDADQMRAAHGLAREMGLGPVVAALK* |
| Ga0079220_102288331 | 3300006806 | Agricultural Soil | KLAVAARPLIGVLNDQQIQTAHGLAQEMGLGPVVAALR* |
| Ga0075435_1003798432 | 3300007076 | Populus Rhizosphere | RVSKRVVQIALNSATVHRLVAAARPLVKTFDEHQMQTAHGLAQEMGLGPVVAALK* |
| Ga0075435_1003878001 | 3300007076 | Populus Rhizosphere | VVLNSSAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR* |
| Ga0105240_119342452 | 3300009093 | Corn Rhizosphere | VAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR* |
| Ga0105238_130071281 | 3300009551 | Corn Rhizosphere | ALNSATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK* |
| Ga0126384_102419231 | 3300010046 | Tropical Forest Soil | AVQRLAVAARPLIAMLDAEQMRAAHSLAQEMGLGPVVAALR* |
| Ga0136216_10587061 | 3300010231 | Soil | XXXNAAIARVAAAARPLAAVLDQEQMQAASGLANEMGLGPVVAALR* |
| Ga0126377_123934402 | 3300010362 | Tropical Forest Soil | ISNRVVTVVLNSSAIQRLAVAARPLVASLDHDQMRAAQGLAQEIGLGPVVAALR* |
| Ga0134125_131131041 | 3300010371 | Terrestrial Soil | IVLDNAAIARLAAAARPLIAVLDQEQMQAASGLASEMGLGPVVAAMR* |
| Ga0105239_126944772 | 3300010375 | Corn Rhizosphere | NSATVHRLVAAARPLVKTFDEQQMQTAHGLAQEMGLGPVVAAMK* |
| Ga0134126_101830611 | 3300010396 | Terrestrial Soil | VSIVLDNAAIARLAAAARPLIAVLDQEQMQAASGLASEMGLGPVVAAMR* |
| Ga0134126_103819661 | 3300010396 | Terrestrial Soil | IARLAAAARPLIAVLDQEQMQAASGLAGEMGLGPVVAALR* |
| Ga0134127_109665321 | 3300010399 | Terrestrial Soil | IAARPLVKTFDDQQMQTAHGLAQEMGLGSVVAALK* |
| Ga0134127_117300042 | 3300010399 | Terrestrial Soil | NSATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK* |
| Ga0134127_125800441 | 3300010399 | Terrestrial Soil | RLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK* |
| Ga0134123_100772261 | 3300010403 | Terrestrial Soil | VQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR* |
| Ga0137392_102661301 | 3300011269 | Vadose Zone Soil | VVLNSAAVQRLAVAARPLVAMLNEEQMRAAHGLAREMGLGPVVAALK* |
| Ga0120134_10365903 | 3300012004 | Permafrost | VERLAVAARPLIARLDDGQKQAAGQLAQEMGLGPVVMAALN* |
| Ga0137380_112975412 | 3300012206 | Vadose Zone Soil | RVVSVVLNSAAVQRLAVAARPLVAMLNEEQMRAAHGLAREMGLGPVVAALK* |
| Ga0126375_107976202 | 3300012948 | Tropical Forest Soil | SAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR* |
| Ga0164302_108569172 | 3300012961 | Soil | GAIHRIASAARPLMATLDLGQLQAANGLASEMGLGAVVAALR* |
| Ga0153916_120074082 | 3300012964 | Freshwater Wetlands | SIVLNSAAVERLAVAARPLIAVLDDEQKRAASGLAQEMGLGAVVVAALK* |
| Ga0164308_105935272 | 3300012985 | Soil | AVSIVLTSAAVQRLASAARPLIAALSDEQKRSAQSLAQEMGLGPVVAALN* |
| Ga0157371_101117141 | 3300013102 | Corn Rhizosphere | AARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK* |
| Ga0157369_108142721 | 3300013105 | Corn Rhizosphere | RLALAARPLVEKLDYQQMQTANGLAQEMGLGPVVAALR* |
| Ga0157375_137619021 | 3300013308 | Miscanthus Rhizosphere | AARPLVKTFDEQQMQTAHGLAQEMGLGPVVAAMK* |
| Ga0172380_106679181 | 3300014205 | Landfill Leachate | ISNRVIQIVLTSAAVERLAVAARPLIAVLDDNQKRAASGLAQEMGLGPVVMAALK* |
| Ga0075316_11263431 | 3300014314 | Natural And Restored Wetlands | IRRLAVAARPLLAALTDEQKQTAFGVAQEMGLGPVLAALN* |
| Ga0163163_122335021 | 3300014325 | Switchgrass Rhizosphere | TVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK* |
| Ga0182030_105595812 | 3300014838 | Bog | VVSIVLNSAAVERLAVAARPLIVRLDDGQKQAAGQLAQEMGLGPVVMAALN* |
| Ga0157376_102897841 | 3300014969 | Miscanthus Rhizosphere | QRLAVAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK* |
| Ga0132256_1017240581 | 3300015372 | Arabidopsis Rhizosphere | VAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK* |
| Ga0132255_1056709551 | 3300015374 | Arabidopsis Rhizosphere | QRVASAARPLIAVLDFRQLQAASGLANQMGLGPVVAALR* |
| Ga0182041_117893601 | 3300016294 | Soil | SQRVVSIALNSATIARLASAARPLVAVLDEQQKRPAGQLAQEMGLGEVVMAVLN |
| Ga0182035_115312532 | 3300016341 | Soil | VLNSAAVHRLAVAARPLIATLDADQLRAAHGLAQEMGLGPVVAALK |
| Ga0182039_102423973 | 3300016422 | Soil | SIALNSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN |
| Ga0187775_101618531 | 3300017939 | Tropical Peatland | KLAVAARPLIGVLDAEQMRTAHGLAQEMGLGPVVAALR |
| Ga0187786_102660822 | 3300017944 | Tropical Peatland | AAVQRLAASARPLISKLDEDQMRAAHGLAAEMGLGPVVAALK |
| Ga0187778_100098729 | 3300017961 | Tropical Peatland | AAAARPLIGVLDAQQMQTAHGLAQEMGLGPVVAALR |
| Ga0187787_103014151 | 3300018029 | Tropical Peatland | ISQRVVSIALNSAAVARLAAAARPLVAVLDDDQKRAAGQLAQEMGLSEVVMAALN |
| Ga0187788_104640752 | 3300018032 | Tropical Peatland | DGAAVQRLAFAARPLVAVLDDEQKRTALALAQQIGLGPVLAALN |
| Ga0187765_113775771 | 3300018060 | Tropical Peatland | RRLVQIVLDSAAVERLAVAARPLIARLTDRQKQAAGELAQEMGLGPVVMAALN |
| Ga0184624_104880371 | 3300018073 | Groundwater Sediment | SAAVHRLAAAARPLIGTLDADQMRAAHGLAQEMGLGPVVAALR |
| Ga0193723_11181532 | 3300019879 | Soil | LAVSARPLIAMLDADQMRAAHGLAREMGLGPVVAALK |
| Ga0210381_103346571 | 3300021078 | Groundwater Sediment | LAIAARPLVASLDHEQMRAAQGLAQEMGLGPVVAALR |
| Ga0247753_10010481 | 3300022892 | Soil | VAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK |
| Ga0247743_10348301 | 3300023067 | Soil | TVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK |
| Ga0247754_10016225 | 3300023102 | Soil | ATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK |
| Ga0207656_106666191 | 3300025321 | Corn Rhizosphere | AAARPLAAVLDQEQMQAASGLASEMGLGPVVAALR |
| Ga0208478_11008681 | 3300025475 | Arctic Peat Soil | SIVLNSAAVERLVVAARPLIAKLDDQQKQAAGQLAQEMGLGSVVMAALN |
| Ga0207932_10995091 | 3300025495 | Arctic Peat Soil | ISIVLNSAAVERLVVAARPLIAKLNDEQKQAAGQLAQEMGLGSVVMAALN |
| Ga0208078_10673532 | 3300025544 | Arctic Peat Soil | NSAAVERLAVAARPLIARLDDGQKQAAGQLAQEMGLGPVVMAALN |
| Ga0207701_110852822 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRVSKRAVQIALNSATIHRLAAAARPLVKTFDEHQMQTAQGLAQQMGLGPVVAALK |
| Ga0207668_100661644 | 3300025972 | Switchgrass Rhizosphere | VLNSSAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR |
| Ga0208909_10306282 | 3300026031 | Natural And Restored Wetlands | AIAARPLIAALRDDQKQMALGLAQEMGLGPVLAALN |
| Ga0207641_107791701 | 3300026088 | Switchgrass Rhizosphere | RVVQIALNSATVHRLVAAARPLVKTFDEQQMQTAHGLAQEMGLGPVVAAMK |
| Ga0207527_1004101 | 3300026759 | Soil | SKRVVQIALNSATVHRLVAAARPLVKTFDEHQMQTAHGLAQEMGLGPVVAALK |
| Ga0207775_1188771 | 3300026817 | Tropical Forest Soil | LASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN |
| Ga0207723_1004271 | 3300026824 | Tropical Forest Soil | SATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN |
| Ga0207802_10015011 | 3300026847 | Tropical Forest Soil | AARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN |
| Ga0207729_1040641 | 3300026858 | Tropical Forest Soil | VSQRVVSIALNSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN |
| Ga0207786_1007513 | 3300026866 | Tropical Forest Soil | VSIALNSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN |
| Ga0207475_10007132 | 3300026867 | Soil | KRVVQIALNSATVHRLVAAARPLVKTFDEHQMQTAHGLAQEMGLGPVVAALK |
| Ga0207840_10081431 | 3300026910 | Tropical Forest Soil | RLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN |
| Ga0207553_10094771 | 3300027435 | Soil | LVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK |
| Ga0207981_10592302 | 3300027560 | Soil | QRLAVAARPLIGTLDPEQMRAAQGLAQEMGLGPVVAALR |
| Ga0207826_10063845 | 3300027680 | Tropical Forest Soil | SATVARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN |
| Ga0207862_10169341 | 3300027703 | Tropical Forest Soil | FVHRVSQRVVSIALNSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN |
| Ga0209177_100204941 | 3300027775 | Agricultural Soil | AVAARPLIAILDPEQMRAAHSLAQEMGLGPVVAALK |
| Ga0209514_104035271 | 3300027819 | Groundwater | AVAARPLIAVLDDDQKRVASGLAQEMGLGAVVTAALK |
| Ga0209583_107572822 | 3300027910 | Watersheds | NSAAVQRLAVAARPLIAKLDEDQMRAAHGLAAEMGLGPVVAALR |
| Ga0265337_11937742 | 3300028556 | Rhizosphere | QVVSVVLNSAAVERLAVAARPLIAKLDQEQIRAASGLAQEMGLGPVVMAALR |
| Ga0247818_102247191 | 3300028589 | Soil | HRLVAAARPLVKTFDEHQMQTAHGLAQEMGLGPVVAALK |
| Ga0307313_101177492 | 3300028715 | Soil | NSAAVHRLAAAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR |
| Ga0307286_103270481 | 3300028876 | Soil | AAAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR |
| Ga0311362_105349571 | 3300029913 | Bog | VLNSAAVERLAVAARPLVAMLNDEQMHSASGLAQEMGLGPVVLAALR |
| Ga0265313_100258174 | 3300031595 | Rhizosphere | VAARPLIAKLDDEQMRAAHGLAAEMGLGPVVAALR |
| Ga0315550_11442612 | 3300031653 | Salt Marsh Sediment | HRVVSVVLDSVAIKRLVAAARPLVATLRDDQKQTALGLAQEMGLGPVLAALN |
| Ga0318521_104524772 | 3300031770 | Soil | VLVVLNSAAVQRLAVAARPLIGMLDAEQMRAAHGLAQEMGLGPVVAALK |
| Ga0318566_105376712 | 3300031779 | Soil | AKPCAARPLIGMLDAEQMRAAHGLAQEMGLGPVVAALK |
| Ga0318529_103486711 | 3300031792 | Soil | VSVVLNSAAVQRLAVAARPLIGMLDAEQMRAAHGLAQEMGLGPVVAALK |
| Ga0310907_105000381 | 3300031847 | Soil | VVQVALNSATIHRLTAAVRPLVKTFDEHQMQTAHGLAQEMGLGPVVAALK |
| Ga0310891_100894461 | 3300031913 | Soil | VAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK |
| Ga0310891_102381842 | 3300031913 | Soil | SSAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR |
| Ga0310910_102475361 | 3300031946 | Soil | SVVLNSAAVQRLAVAARPLIGMLDAEQMRAAHGLAQEMGLGPVVAALK |
| Ga0306922_101793451 | 3300032001 | Soil | TIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN |
| Ga0306924_111314722 | 3300032076 | Soil | NSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN |
| Ga0335085_104225951 | 3300032770 | Soil | LDGAAVHRLAVAARPLIAVLRDDQKQSALALAQEMGLAPVLAALN |
| Ga0335080_109622751 | 3300032828 | Soil | AVVLDSAAVERLAVSARPLVAVLDDDQKRTAMAMAQQMGLGPVLAALN |
| Ga0326726_109290711 | 3300033433 | Peat Soil | TQRVVSIVLNSAAVERLAVAARPLIARLDDGQKQAAGQLAQEMGLGPVVMAALN |
| Ga0314870_021249_2_136 | 3300033760 | Peatland | SSSAVQRLAVAARPLIAKLDEDQVRAAHGLAQEMGLGPVVAALR |
| Ga0373948_0044229_1_123 | 3300034817 | Rhizosphere Soil | VHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK |
| ⦗Top⦘ |