| Basic Information | |
|---|---|
| Family ID | F069331 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSKYFKEIEYNMDVDFLAKLDEAREYAGIPFVINSAYRSPE |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 12.90 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 88.71 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (49.194 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater (27.419 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.161 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (84.677 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.68% β-sheet: 0.00% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 12.10 |
| PF08291 | Peptidase_M15_3 | 8.06 |
| PF07460 | NUMOD3 | 0.81 |
| PF03382 | DUF285 | 0.81 |
| PF05105 | Phage_holin_4_1 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG4824 | Phage-related holin (Lysis protein) | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.81 % |
| Unclassified | root | N/A | 49.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876005|none_p094545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas → unclassified Halomonas → Halomonas sp. 707B3 | 542 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10056920 | All Organisms → Viruses → Predicted Viral | 1669 | Open in IMG/M |
| 3300000973|BBAY93_12095819 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 525 | Open in IMG/M |
| 3300001460|JGI24003J15210_10168829 | Not Available | 541 | Open in IMG/M |
| 3300002153|JGI24540J26637_10100707 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300004113|Ga0065183_10304376 | Not Available | 728 | Open in IMG/M |
| 3300004460|Ga0066222_1003182 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 689 | Open in IMG/M |
| 3300004460|Ga0066222_1134558 | All Organisms → cellular organisms → Bacteria | 3421 | Open in IMG/M |
| 3300004595|Ga0008278_1240360 | All Organisms → Viruses → environmental samples → uncultured marine virus | 689 | Open in IMG/M |
| 3300005920|Ga0070725_10142367 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
| 3300005941|Ga0070743_10025148 | Not Available | 2066 | Open in IMG/M |
| 3300006165|Ga0075443_10319578 | Not Available | 572 | Open in IMG/M |
| 3300006484|Ga0070744_10129934 | Not Available | 724 | Open in IMG/M |
| 3300006484|Ga0070744_10157055 | Not Available | 651 | Open in IMG/M |
| 3300006793|Ga0098055_1359478 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → environmental samples → Bacteroides uniformis CAG:3 | 541 | Open in IMG/M |
| 3300006810|Ga0070754_10111045 | Not Available | 1344 | Open in IMG/M |
| 3300006916|Ga0070750_10189991 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 914 | Open in IMG/M |
| 3300006920|Ga0070748_1110795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Inhavirus P12024S | 1041 | Open in IMG/M |
| 3300006920|Ga0070748_1298310 | Not Available | 573 | Open in IMG/M |
| 3300006924|Ga0098051_1129626 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300006925|Ga0098050_1093946 | Not Available | 769 | Open in IMG/M |
| 3300006990|Ga0098046_1029596 | Not Available | 1345 | Open in IMG/M |
| 3300007647|Ga0102855_1121203 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 700 | Open in IMG/M |
| 3300007718|Ga0102852_1017469 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1293 | Open in IMG/M |
| 3300007974|Ga0105747_1101734 | All Organisms → Viruses → environmental samples → uncultured marine virus | 897 | Open in IMG/M |
| 3300008221|Ga0114916_1051727 | All Organisms → cellular organisms → Bacteria → PVC group | 1143 | Open in IMG/M |
| 3300008961|Ga0102887_1253766 | Not Available | 531 | Open in IMG/M |
| 3300009026|Ga0102829_1146088 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 755 | Open in IMG/M |
| 3300009086|Ga0102812_10029801 | All Organisms → Viruses → environmental samples → uncultured marine virus | 3100 | Open in IMG/M |
| 3300009086|Ga0102812_10202014 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1084 | Open in IMG/M |
| 3300009142|Ga0102885_1120467 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 635 | Open in IMG/M |
| 3300009425|Ga0114997_10540552 | Not Available | 618 | Open in IMG/M |
| 3300009507|Ga0115572_10056793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2456 | Open in IMG/M |
| 3300009526|Ga0115004_10573787 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 668 | Open in IMG/M |
| 3300010150|Ga0098056_1019109 | All Organisms → Viruses → Predicted Viral | 2448 | Open in IMG/M |
| 3300010150|Ga0098056_1126181 | Not Available | 868 | Open in IMG/M |
| 3300011258|Ga0151677_1049547 | Not Available | 609 | Open in IMG/M |
| 3300013101|Ga0164313_11317022 | Not Available | 583 | Open in IMG/M |
| 3300017772|Ga0181430_1061616 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1150 | Open in IMG/M |
| 3300017783|Ga0181379_1155991 | Not Available | 812 | Open in IMG/M |
| 3300020051|Ga0181555_1216123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Inhavirus P12024S | 723 | Open in IMG/M |
| 3300020182|Ga0206129_10306417 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 637 | Open in IMG/M |
| 3300020382|Ga0211686_10277812 | Not Available | 687 | Open in IMG/M |
| 3300021185|Ga0206682_10020683 | Not Available | 4188 | Open in IMG/M |
| 3300021389|Ga0213868_10071364 | All Organisms → Viruses → Predicted Viral | 2322 | Open in IMG/M |
| 3300021389|Ga0213868_10175570 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium TMED67 | 1304 | Open in IMG/M |
| 3300021389|Ga0213868_10269120 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 988 | Open in IMG/M |
| 3300021957|Ga0222717_10036506 | All Organisms → Viruses → Predicted Viral | 3230 | Open in IMG/M |
| 3300021957|Ga0222717_10079199 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2080 | Open in IMG/M |
| 3300021957|Ga0222717_10399449 | Not Available | 760 | Open in IMG/M |
| 3300022072|Ga0196889_1048379 | Not Available | 828 | Open in IMG/M |
| 3300022159|Ga0196893_1007106 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 958 | Open in IMG/M |
| 3300022200|Ga0196901_1285927 | Not Available | 501 | Open in IMG/M |
| 3300022201|Ga0224503_10297994 | Not Available | 534 | Open in IMG/M |
| 3300022220|Ga0224513_10251204 | All Organisms → Viruses → environmental samples → uncultured marine virus | 699 | Open in IMG/M |
| 3300022221|Ga0224506_10214165 | Not Available | 885 | Open in IMG/M |
| 3300022833|Ga0222645_111568 | Not Available | 1546 | Open in IMG/M |
| (restricted) 3300023089|Ga0233408_10004890 | All Organisms → Viruses → Predicted Viral | 1495 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10402939 | Not Available | 598 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10007549 | All Organisms → Viruses → environmental samples → uncultured marine virus | 4528 | Open in IMG/M |
| 3300023242|Ga0222708_1019486 | Not Available | 1100 | Open in IMG/M |
| (restricted) 3300023271|Ga0233403_10248009 | Not Available | 516 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10005375 | All Organisms → Viruses → Predicted Viral | 3443 | Open in IMG/M |
| 3300023568|Ga0228696_1039413 | Not Available | 539 | Open in IMG/M |
| 3300023685|Ga0228686_1000674 | All Organisms → Viruses → Predicted Viral | 3495 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10138630 | Not Available | 972 | Open in IMG/M |
| 3300024180|Ga0228668_1051590 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 814 | Open in IMG/M |
| 3300024185|Ga0228669_1080520 | Not Available | 625 | Open in IMG/M |
| 3300024185|Ga0228669_1098588 | Not Available | 545 | Open in IMG/M |
| 3300024191|Ga0228636_1091588 | Not Available | 694 | Open in IMG/M |
| 3300024221|Ga0228666_1026135 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
| 3300024235|Ga0228665_1062582 | Not Available | 767 | Open in IMG/M |
| 3300024236|Ga0228655_1021742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Inhavirus P12024S | 1595 | Open in IMG/M |
| 3300024291|Ga0228660_1024306 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
| 3300024291|Ga0228660_1103145 | Not Available | 561 | Open in IMG/M |
| 3300024301|Ga0233451_10361725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Inhavirus P12024S | 536 | Open in IMG/M |
| 3300024314|Ga0228657_1056625 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 835 | Open in IMG/M |
| 3300024314|Ga0228657_1083077 | Not Available | 654 | Open in IMG/M |
| 3300024319|Ga0228670_1057092 | Not Available | 864 | Open in IMG/M |
| 3300024320|Ga0233398_1091961 | Not Available | 722 | Open in IMG/M |
| 3300024320|Ga0233398_1103571 | Not Available | 666 | Open in IMG/M |
| 3300024326|Ga0228652_1020520 | Not Available | 1928 | Open in IMG/M |
| 3300024343|Ga0244777_10144746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium HS_08 | 1535 | Open in IMG/M |
| 3300024346|Ga0244775_11325090 | All Organisms → Viruses → environmental samples → uncultured marine virus | 556 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10226488 | Not Available | 910 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10445085 | Not Available | 627 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10490084 | Not Available | 589 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10392140 | Not Available | 700 | Open in IMG/M |
| 3300025083|Ga0208791_1076586 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 546 | Open in IMG/M |
| 3300025266|Ga0208032_1061518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium HS_08 | 837 | Open in IMG/M |
| 3300025276|Ga0208814_1037746 | Not Available | 1484 | Open in IMG/M |
| 3300025276|Ga0208814_1074720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium HS_08 | 915 | Open in IMG/M |
| 3300025594|Ga0209094_1095173 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 684 | Open in IMG/M |
| 3300025608|Ga0209654_1155658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Inhavirus P12024S | 549 | Open in IMG/M |
| 3300025621|Ga0209504_1017397 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium TMED67 | 2886 | Open in IMG/M |
| 3300025621|Ga0209504_1138152 | Not Available | 594 | Open in IMG/M |
| 3300025652|Ga0208134_1071664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Inhavirus P12024S | 1028 | Open in IMG/M |
| 3300025652|Ga0208134_1153927 | Not Available | 576 | Open in IMG/M |
| 3300025701|Ga0209771_1133845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Inhavirus P12024S | 782 | Open in IMG/M |
| 3300025806|Ga0208545_1148413 | Not Available | 562 | Open in IMG/M |
| 3300025860|Ga0209119_1137356 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300025860|Ga0209119_1191143 | Not Available | 803 | Open in IMG/M |
| 3300026460|Ga0247604_1149932 | Not Available | 506 | Open in IMG/M |
| 3300026466|Ga0247598_1006109 | All Organisms → Viruses → Predicted Viral | 2721 | Open in IMG/M |
| 3300026470|Ga0247599_1087825 | Not Available | 652 | Open in IMG/M |
| 3300026503|Ga0247605_1170494 | Not Available | 520 | Open in IMG/M |
| 3300026504|Ga0247587_1090405 | Not Available | 755 | Open in IMG/M |
| 3300026505|Ga0228647_1096536 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 707 | Open in IMG/M |
| 3300026511|Ga0233395_1169262 | Not Available | 500 | Open in IMG/M |
| 3300027159|Ga0208020_1042916 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 856 | Open in IMG/M |
| 3300027779|Ga0209709_10301139 | Not Available | 682 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10241832 | Not Available | 643 | Open in IMG/M |
| 3300027844|Ga0209501_10292670 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
| 3300028110|Ga0247584_1079781 | Not Available | 827 | Open in IMG/M |
| 3300028126|Ga0228648_1080523 | Not Available | 620 | Open in IMG/M |
| 3300028129|Ga0228634_1058237 | Not Available | 954 | Open in IMG/M |
| 3300028135|Ga0228606_1038856 | Not Available | 1288 | Open in IMG/M |
| 3300028135|Ga0228606_1070439 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 917 | Open in IMG/M |
| 3300028338|Ga0247567_1126479 | Not Available | 545 | Open in IMG/M |
| 3300028418|Ga0228615_1058693 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300028600|Ga0265303_10284796 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1287 | Open in IMG/M |
| 3300031519|Ga0307488_10159294 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1572 | Open in IMG/M |
| 3300031589|Ga0307996_1105341 | Not Available | 747 | Open in IMG/M |
| 3300031774|Ga0315331_10579553 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 805 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 27.42% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.29% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.06% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.26% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 6.45% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.03% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.23% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.23% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.23% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.42% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.42% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 2.42% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.61% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.61% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.61% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.61% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.61% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.61% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.81% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.81% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.81% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.81% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.81% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.81% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876005 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15m | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300002153 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Metagenome | Environmental | Open in IMG/M |
| 3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004595 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009142 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022833 | Saline water microbial communities from Ace Lake, Antarctica - #292 | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023242 | Saline water microbial communities from Ace Lake, Antarctica - #1576 | Environmental | Open in IMG/M |
| 3300023271 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_1_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300023568 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023685 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024180 | Seawater microbial communities from Monterey Bay, California, United States - 82D | Environmental | Open in IMG/M |
| 3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300024221 | Seawater microbial communities from Monterey Bay, California, United States - 80D | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024291 | Seawater microbial communities from Monterey Bay, California, United States - 74D | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
| 3300024320 | Seawater microbial communities from Monterey Bay, California, United States - 38D | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300026460 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026466 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026470 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026504 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026505 | Seawater microbial communities from Monterey Bay, California, United States - 59D | Environmental | Open in IMG/M |
| 3300026511 | Seawater microbial communities from Monterey Bay, California, United States - 27D | Environmental | Open in IMG/M |
| 3300027159 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300028110 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028126 | Seawater microbial communities from Monterey Bay, California, United States - 60D | Environmental | Open in IMG/M |
| 3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
| 3300028135 | Seawater microbial communities from Monterey Bay, California, United States - 7D | Environmental | Open in IMG/M |
| 3300028338 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 15R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_0945452 | 2236876005 | Marine Estuarine | RMSKYFKEIEYNMDADFLAKLDKARELANIPFTINSAYRSPETKCKSRWKT |
| DelMOSpr2010_100569201 | 3300000116 | Marine | MTKYFKEVEYKMDTDFLAKLDKAREFAKVPFVINSAYRSPEHPESIKNPT |
| BBAY93_120958191 | 3300000973 | Macroalgal Surface | MSKYFREIEYMMDKDFLEKLDEAREFAGFPFFINSAYRSEDHPLSI |
| JGI24003J15210_101688291 | 3300001460 | Marine | MSKFFKEIEDNMDEEFLERLDQARAFADIPFIINSAYRS |
| JGI24540J26637_101007071 | 3300002153 | Marine | MSKYFKDKEENMNVDFLAKLDEAREYANIPFIINSAYR |
| Ga0065183_103043761 | 3300004113 | Pelagic Marine | MTKYFKEVEYKMDVDFLVKLDKAREFAKVPFVINSAYRSPEHKESIKNP |
| Ga0066222_10031821 | 3300004460 | Marine | MSKYFNEIENNMNKDFLFVLDEAREFAGIPFVINSAYRSPEHPLSIKNPSSSH |
| Ga0066222_11345581 | 3300004460 | Marine | MSKYFKKIEDNMDVDFLAKLDEAREYANIPFIINSAYRSPEHSLSIKNP |
| Ga0008278_12403601 | 3300004595 | Marine | MSRYFKEIEENMDANFLHKLDKARSIAGLPFKINSAYRSPEHPLSIKNPSSSHIK |
| Ga0070725_101423671 | 3300005920 | Marine Sediment | MTKYFKEVEYKMDVDFLAKLDKAREFAKVPFVINSAYRSPEHAESIKNPTSS |
| Ga0070743_100251481 | 3300005941 | Estuarine | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSPEHPESIKN |
| Ga0075443_103195781 | 3300006165 | Marine | MSKYFKEIEDNMNKEFLFVLDEAREIAQIPFFINSAYRSPTHPESIKNPTSSH |
| Ga0070744_101299344 | 3300006484 | Estuarine | MSKYFKEIEYNMDVDFLAKLDEAREYAGIPFVINSAYR |
| Ga0070744_101570554 | 3300006484 | Estuarine | MSKYFKEIEYNMDVDFLAKLDEAREYAGIPFVINSAYRSPE |
| Ga0098055_13594782 | 3300006793 | Marine | MSKYFKEIEYNMDVDFLAKLDEAREYAGIPFVINSAYRSP |
| Ga0070754_101110454 | 3300006810 | Aqueous | MSKYFKEIEANMDKRFLFVLDEAREFAGIPFIINSAYRSP |
| Ga0070750_101899911 | 3300006916 | Aqueous | MSKYFKEIEANMDKKFLFVLDEAREFAGIPFIINSAYRSPDHPESIKNPTSSHIKGL |
| Ga0070748_11107953 | 3300006920 | Aqueous | MTKYFKELDNLDKMDKTFLLKLDEARERAGIPFVINSAYRSPEH |
| Ga0070748_12983103 | 3300006920 | Aqueous | MSKYFNEIENNMNKDFLFVLDEAREFAGIPFVINSAYRSPEHPL |
| Ga0098051_11296261 | 3300006924 | Marine | MSKYFKEIEYNMDLDFLSKLDKAREYAGIPFVINSAYRSPDHPESI |
| Ga0098050_10939461 | 3300006925 | Marine | MSKYFKEIEYNMDLDFLSKLDKAREYAGIPFVINSA |
| Ga0098046_10295963 | 3300006990 | Marine | MTKYFKEIEYKMDKDFLAKLDKAREFAKVPFVINSAYRSPEHPESIK |
| Ga0102855_11212032 | 3300007647 | Estuarine | MSKYFKEIEYGMCPNFLEKLDEAREFAGFPFFINSAYRSAD |
| Ga0102852_10174694 | 3300007718 | Estuarine | MSKYFKEIEYKMDRDFLAKLDDAREFAGIPFFINSAYRSPE |
| Ga0105747_11017344 | 3300007974 | Estuary Water | MSKYFKEIEYNMDADFLAKLDKARELANIPFTINSAYRSTEQ |
| Ga0114916_10517274 | 3300008221 | Deep Ocean | MSKFFKEIEDNMDEEFLQRLDQARAFADIPFIINSAYRSP |
| Ga0102887_12537663 | 3300008961 | Estuarine | MSKYFKEIEANMNKDFLFVLDEAREFAGIPFVINSAYRSP |
| Ga0102829_11460882 | 3300009026 | Estuarine | MSKYFKEIEYKMDEDFLAKLDDAREFAGFPFFINSAYRSPDH |
| Ga0102812_100298015 | 3300009086 | Estuarine | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRTP |
| Ga0102812_102020144 | 3300009086 | Estuarine | MSKYFKEIEYNMDADFLAKLDEARELANIPFTINSAY |
| Ga0102885_11204671 | 3300009142 | Estuarine | MSKYFNEIENNMNKNFLFVLDEAREFAGIPFVINSAYRSPEHPLSIKNPSSSHIK |
| Ga0114997_105405521 | 3300009425 | Marine | MSKYFKEIEDGNMDLDFLAKLDKAREIADIPFKINSAFRTPE |
| Ga0115572_100567935 | 3300009507 | Pelagic Marine | MSKYFKKIEENMDVNFLAKLDEAREYAGIPFVINSAYRSPDHPLSIKNPTS |
| Ga0115004_105737872 | 3300009526 | Marine | MSKYFKDKEENMDVDFLAKLDEAREYANIPFIINSAYR |
| Ga0098056_10191094 | 3300010150 | Marine | VSKYFKEIEYKMDADFLAKLDKARELANIPFTINSAYRNADQN |
| Ga0098056_11261811 | 3300010150 | Marine | MSKYFKEIEDNMSKEFLFVLDEAREFAGIPFIINSAYRSPEHPLSIKNP |
| Ga0151677_10495472 | 3300011258 | Marine | MSKYFKEIEYKMDKSFLEKLDQAREFAGFPFFINSAYRSPDHP |
| Ga0164313_113170222 | 3300013101 | Marine Sediment | VSKYFKEIEYKMDTDFLAKLDKARELANIPFTINSAYRNADQNAR |
| Ga0181430_10616161 | 3300017772 | Seawater | MSKYFKEIEYKMDEDFLAKLDDAREFAGFPFFINSAYRSPDHPES |
| Ga0181379_11559911 | 3300017783 | Seawater | VSKYFKEIEYKMDADFLAKLDKARELANIPFTINSAYRNPDQNARV |
| Ga0181555_12161233 | 3300020051 | Salt Marsh | MSKYFKELDNLDKMDKTFLLKLDEARERAGIPFVINSAYRSPEH |
| Ga0206129_103064171 | 3300020182 | Seawater | MSKYFKEIEYKMDKDFLAKLDDAREFAGFPFFINSAYRSP |
| Ga0211686_102778121 | 3300020382 | Marine | MSKYFKEIEYNMNEDFLALLDEAREFAEIPFVINSAYRSVEDNKRV |
| Ga0206682_100206831 | 3300021185 | Seawater | MTKYFKEIEYKMDKDFLAKLDKAREFAKVPFVINSA |
| Ga0213868_100713645 | 3300021389 | Seawater | MSKYFKEIEYKMDKSFLEKLDRAREFAGFPFFINSA |
| Ga0213868_101755701 | 3300021389 | Seawater | MSKYFKEIETNMSKEFLFVLDEAREIAGIPFVINS |
| Ga0213868_102691201 | 3300021389 | Seawater | MSKYFKEIEANMDKRFLFVLDEAREFAGIPFIINSAYRSPDHPESIKN |
| Ga0222717_100365062 | 3300021957 | Estuarine Water | MSKYFKEIEQNMDTDFLDKLDEAREFAGIPFIINSAYRSP |
| Ga0222717_100791995 | 3300021957 | Estuarine Water | MSKYFKDKEENMNVDFLAKLDEAREYANIPFIINSAYRS |
| Ga0222717_103994491 | 3300021957 | Estuarine Water | MSKYFKNIEENMNVDFLAKLDEAREYANIPFIINSAY |
| Ga0196889_10483791 | 3300022072 | Aqueous | MSKYFNEIENNMNKDFLFVLDEAREFAGIPFVINSAYRSPEHP |
| Ga0196893_10071061 | 3300022159 | Aqueous | MSKYFKEIEANMDKRFLFVLDEAREFAGIPFIINSAYRSPEHPLS |
| Ga0196901_12859271 | 3300022200 | Aqueous | MSKYFKEIEANMDKKFLFVLDEAREFAGIPFIINSAYRSPDHPESIKN |
| Ga0224503_102979943 | 3300022201 | Sediment | MTKYFKEIEYKMDKDFLAKLDKAREFAKVPFVINSAYRSPEHPESIKN |
| Ga0224513_102512043 | 3300022220 | Sediment | VSKYFKEIEYKMDADFLAKLDKARELANIPFTINSAYRNADQNA |
| Ga0224506_102141654 | 3300022221 | Sediment | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSPEHEESIKN |
| Ga0222645_1115684 | 3300022833 | Saline Water | MSKYFKNIEENMDVCFLEKLDAAREYAGIPFNINSAYRSPEHPESI |
| (restricted) Ga0233408_100048905 | 3300023089 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSPEHAE |
| (restricted) Ga0233432_104029393 | 3300023109 | Seawater | MTKYFKEVEYKMDTDFLAKLDKAREFAKVPFVINSAYRS |
| (restricted) Ga0233412_100075497 | 3300023210 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINS |
| Ga0222708_10194861 | 3300023242 | Saline Water | MSKYFKSNEKNMDVNFLAKLDQAREHAGIPFIINS |
| (restricted) Ga0233403_102480092 | 3300023271 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSPEHPESIKNP |
| (restricted) Ga0233410_100053756 | 3300023276 | Seawater | MSKYFKEIEYNMDADFLAKLDKARELANIPFTINSA |
| Ga0228696_10394132 | 3300023568 | Seawater | MSKYFKEIEDNMNKEFLFVLDEAREFAGIPFIINSAYRSPDHPLSIKNPSS |
| Ga0228686_10006747 | 3300023685 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSPEHPESIKNPTSS |
| (restricted) Ga0255040_101386305 | 3300024059 | Seawater | MTKYFKEVEYKMDTDFLAKLDKAREFAKVPFVINS |
| Ga0228668_10515901 | 3300024180 | Seawater | MSKYFKDKEENMNVDFLAKLDEAREYANIPFIINSAYRSPE |
| Ga0228669_10805201 | 3300024185 | Seawater | MTKYFKEVEYKMDVDFLAKLDKAREFAKVPFVINSAYRSPEHPESIKNPT |
| Ga0228669_10985883 | 3300024185 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYR |
| Ga0228636_10915881 | 3300024191 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSP |
| Ga0228666_10261351 | 3300024221 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSPEHEESIK |
| Ga0228665_10625821 | 3300024235 | Seawater | MSKYFKNIEENMNVDFLAKLDQAREYANIPFIINSAYRGTEHPL |
| Ga0228655_10217426 | 3300024236 | Seawater | MTRYFKELDNLDKMDKTFLLRLDEARERAGIPFIINS |
| Ga0228660_10243065 | 3300024291 | Seawater | MTKYFKEVEYKMNADFLAKLDKAREFAKVPFVINSAYRSPEH |
| Ga0228660_11031451 | 3300024291 | Seawater | MTRYFKELDNLDKMDKTFLLRLDEARERAGIPFVINSAYRTPEHNA |
| Ga0233451_103617251 | 3300024301 | Salt Marsh | MTKYFKELDNLDKMDKTFLLKLDEARERAGIPFVINSGYRSPEH |
| Ga0228657_10566252 | 3300024314 | Seawater | MSKYFKEIEYKMDKSFLDKLDQAREFAGFPFFINSAYRSPDHPESI |
| Ga0228657_10830771 | 3300024314 | Seawater | MTKYFKEVEYKMDVDFLAKLDKAREFAKVPFVINSAYRSPEHPESIKNPTSSQI |
| Ga0228670_10570924 | 3300024319 | Seawater | MTKYFKEVEYKMDIDFLAKLDKAREFAKVPFVINSAYRSTEHPES |
| Ga0233398_10919611 | 3300024320 | Seawater | MTKYFKEVEYKMDTDFLAKLDKAREFAKVPFVINSAYRSPEHVESIKNPTSSHIK |
| Ga0233398_11035713 | 3300024320 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSPE |
| Ga0228652_10205201 | 3300024326 | Seawater | MSKYFKEIEYKMDEDFLAKLDDAREFAGFPFFINSAYRSPEHPESIKNP |
| Ga0244777_101447461 | 3300024343 | Estuarine | MSKYFKGIEANMNKDFLFVLDAAREFAGIPFVINSAY |
| Ga0244775_113250901 | 3300024346 | Estuarine | MSKYFKEIEYNMDADFLAKLDKARELANIPFTINSAYRSPE |
| (restricted) Ga0255048_102264884 | 3300024518 | Seawater | MSRYFKKIEENMNVDFLAKLDEAREYGNIPFIINSA |
| (restricted) Ga0255048_104450853 | 3300024518 | Seawater | MSKYFKEIEYKMDVDFLAKLDDAREFAGFPFFINSAYRSPDHPESIKNPAS |
| (restricted) Ga0255046_104900841 | 3300024519 | Seawater | MSKYFKNIEENMNVDFLSKLDEAREYANIPFIINSAYRS |
| (restricted) Ga0255047_103921403 | 3300024520 | Seawater | MSKYFKEIEYKMDVDFLAKLDDAREFAGFPFFINSAYRSPDHPESIKNPASS |
| Ga0208791_10765861 | 3300025083 | Marine | MSKYFKEIEDNMNKEFLFVLDEAREFAGIPFIINSAYRSPDHPLSIKNPNSSHI |
| Ga0208032_10615181 | 3300025266 | Deep Ocean | MSKYFKEIETNMNNEFLFVLDEAREFAGIPFFINSAYRSPTHP |
| Ga0208814_10377464 | 3300025276 | Deep Ocean | MSKYFKEIETNMNKNLLFVLDEAREFAGIPFVINSAYRS |
| Ga0208814_10747201 | 3300025276 | Deep Ocean | MSKYFKEIETNMNNEFLFVLDEAREFAGIPFFINSAYRSPT |
| Ga0209094_10951733 | 3300025594 | Pelagic Marine | MSKYFKEIETNMSKEFLFVLDEAREIAGIPFVINSAYRS |
| Ga0209654_11556582 | 3300025608 | Marine | MTKYFKELDNLDKMDKTFLLRLDEARERAGIPFIINSAYRTPEHN |
| Ga0209504_10173971 | 3300025621 | Pelagic Marine | MSKYFKEIETNMSKEFLFVLDEAREIAGIPFIINSA |
| Ga0209504_11381523 | 3300025621 | Pelagic Marine | MTKYFKEVEYKMDADFLVKLDKAREFAKVPFVINSAYRSPEHPESIKNP |
| Ga0208134_10716643 | 3300025652 | Aqueous | MTKYFKELDNLDKMDKTFLLKLDEARERAGIPFVINS |
| Ga0208134_11539271 | 3300025652 | Aqueous | MSKYFKEIENNMNKEFLFVLDEAREIAGIPFVINSAYRSPEHPL |
| Ga0209771_11338452 | 3300025701 | Marine | MTRYFKELDNLDKMDKTFLLRLDEARERAGIPFVINSAYRTPEH |
| Ga0208545_11484131 | 3300025806 | Aqueous | MSRYFKEIEENMDANFLHKLDKARALAGMPFIINSAYRSPEHP |
| Ga0209119_11373561 | 3300025860 | Pelagic Marine | MSKYFKEIEYKMDKDFLAKLDDAREFAGFPFFINSAYRSPDHP |
| Ga0209119_11911431 | 3300025860 | Pelagic Marine | MSRFFKEIEYNMDKKFLSRLDEARDYAGIPFIINS |
| Ga0247604_11499323 | 3300026460 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRS |
| Ga0247598_10061094 | 3300026466 | Seawater | MSKYFNEIENNMNKDFLFVLDEAREFAGIPFIINSAYRSPDHPLSIKNPSS |
| Ga0247599_10878251 | 3300026470 | Seawater | MTKYFKEVEYKMDTDFLAKLDKAREFAKVPFVINSAYRSPEH |
| Ga0247605_11704941 | 3300026503 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSPEH |
| Ga0247587_10904051 | 3300026504 | Seawater | MTKYFKEVEYKMDVDFLAKLDKAREFAKVPFVINSAYRSPEHPESIKNPTSS |
| Ga0228647_10965361 | 3300026505 | Seawater | MSRYFKEIEYKMDKSFLEKLDQAREFAGFPFFINSAYRSPEHPE |
| Ga0233395_11692623 | 3300026511 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSPEHPQSIKN |
| Ga0208020_10429161 | 3300027159 | Estuarine | MSKYFKEIEYKMDEDFLAKLDDAREFAGFPFFINSAYRS |
| Ga0209709_103011391 | 3300027779 | Marine | MSKYFKDIEYKMDVDFLAKLDEAREYAEIPFIINSAYRSPEHKESIKNPTSSHIK |
| (restricted) Ga0255041_102418323 | 3300027837 | Seawater | MSKYFNEIENNMNKNFLFVLDEAREFAGIPFVINSAY |
| Ga0209501_102926705 | 3300027844 | Marine | MSKYFKDIEYKMDVDFLAKLDEAREYAEIPFIINSAYRNPEHKES |
| Ga0247584_10797813 | 3300028110 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSPEHE |
| Ga0228648_10805231 | 3300028126 | Seawater | MSKYFKEIEGNMDTYFLAKLDEAREYANIPFVINSAYRSPEHN |
| Ga0228634_10582374 | 3300028129 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFVINSAYRSPEHPES |
| Ga0228606_10388564 | 3300028135 | Seawater | MSKYFKEIEDNMNKEFLFVLDEAREFAGIPFIINSAYRSPDHH |
| Ga0228606_10704391 | 3300028135 | Seawater | MSKYFKEIEYKMDEDFLAKLDDAREFAGFPFFINSAYRSPE |
| Ga0247567_11264793 | 3300028338 | Seawater | MTKYFKEVEYKMDADFLAKLDKAREFAKVPFIINSAYRSPE |
| Ga0228615_10586931 | 3300028418 | Seawater | MTKYFKEVEYKMDTDFLAKLDKAREFAKVPFVINSAYRSPEHAESIKNPTSSH |
| Ga0265303_102847965 | 3300028600 | Sediment | MTKYFKEVEYKMDVDFLIKLDKAREFAKVPFVINSAYRSPEHK |
| Ga0307488_101592941 | 3300031519 | Sackhole Brine | MSRFFKEIEYKMDADFLAKLDKAREFAKVPFVINSAYRSPEHPESIKNP |
| Ga0307996_11053411 | 3300031589 | Marine | MTKYFKKIEENMDVDFLAKLDEAREYANIPFIINSAYRSPTHPESIKNP |
| Ga0315331_105795531 | 3300031774 | Seawater | MSKYFKEIEYGMNPKFLEKLDEAREFAGFPFFINSAYRSPDHPLSIQNPTS |
| ⦗Top⦘ |