| Basic Information | |
|---|---|
| Family ID | F068920 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 38 residues |
| Representative Sequence | CNKYARDAEERPLPKEETTPPVTNIYRAMELSYSE |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.77 % |
| % of genes from short scaffolds (< 2000 bps) | 90.32 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.742 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (20.968 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.065 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.92% β-sheet: 0.00% Coil/Unstructured: 65.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00121 | TIM | 48.39 |
| PF03840 | SecG | 43.55 |
| PF13624 | SurA_N_3 | 3.23 |
| PF04715 | Anth_synt_I_N | 1.61 |
| PF00133 | tRNA-synt_1 | 0.81 |
| PF06418 | CTP_synth_N | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0149 | Triosephosphate isomerase | Carbohydrate transport and metabolism [G] | 48.39 |
| COG1314 | Protein translocase subunit SecG | Intracellular trafficking, secretion, and vesicular transport [U] | 43.55 |
| COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 3.23 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0504 | CTP synthase (UTP-ammonia lyase) | Nucleotide transport and metabolism [F] | 0.81 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.74 % |
| Unclassified | root | N/A | 7.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000168|LPjun09P1210mDRAFT_c1004636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1221 | Open in IMG/M |
| 3300000257|LP_F_10_SI03_100DRAFT_1006436 | All Organisms → cellular organisms → Bacteria | 2715 | Open in IMG/M |
| 3300001832|ACM6_1026428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300001846|ACM22_1051386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → alpha proteobacterium SCGC AAA536-G10 | 2832 | Open in IMG/M |
| 3300001941|GOS2219_1031465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1002 | Open in IMG/M |
| 3300001947|GOS2218_1000422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1301 | Open in IMG/M |
| 3300001962|GOS2239_1009535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2973 | Open in IMG/M |
| 3300003596|JGI26255J51710_1004514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4109 | Open in IMG/M |
| 3300006339|Ga0068481_1518964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 875 | Open in IMG/M |
| 3300006902|Ga0066372_10362508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 831 | Open in IMG/M |
| 3300007074|Ga0075110_1119424 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300007229|Ga0075468_10248162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 505 | Open in IMG/M |
| 3300007972|Ga0105745_1206321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 620 | Open in IMG/M |
| 3300008097|Ga0111541_10425262 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300008961|Ga0102887_1235470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 554 | Open in IMG/M |
| 3300008996|Ga0102831_1010838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3211 | Open in IMG/M |
| 3300009071|Ga0115566_10285148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 978 | Open in IMG/M |
| 3300009071|Ga0115566_10501732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 688 | Open in IMG/M |
| 3300009071|Ga0115566_10674981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 574 | Open in IMG/M |
| 3300009172|Ga0114995_10349654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 812 | Open in IMG/M |
| 3300009193|Ga0115551_1446098 | Not Available | 554 | Open in IMG/M |
| 3300009420|Ga0114994_10971021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300009481|Ga0114932_10208169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1189 | Open in IMG/M |
| 3300009497|Ga0115569_10404743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300009498|Ga0115568_10326766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 674 | Open in IMG/M |
| 3300009505|Ga0115564_10166586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1171 | Open in IMG/M |
| 3300009550|Ga0115013_10828040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
| 3300009703|Ga0114933_10203199 | Not Available | 1342 | Open in IMG/M |
| 3300010883|Ga0133547_10720370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1973 | Open in IMG/M |
| 3300012415|Ga0138263_1448721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 502 | Open in IMG/M |
| 3300012919|Ga0160422_10191784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1235 | Open in IMG/M |
| 3300012919|Ga0160422_10824621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 596 | Open in IMG/M |
| 3300012920|Ga0160423_10268408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1178 | Open in IMG/M |
| 3300012928|Ga0163110_10347392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1098 | Open in IMG/M |
| 3300012928|Ga0163110_11350048 | Not Available | 576 | Open in IMG/M |
| 3300012936|Ga0163109_10853089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300012936|Ga0163109_11386178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 512 | Open in IMG/M |
| 3300012954|Ga0163111_10382826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1272 | Open in IMG/M |
| 3300012954|Ga0163111_10506610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1114 | Open in IMG/M |
| 3300012954|Ga0163111_12585894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 518 | Open in IMG/M |
| 3300014818|Ga0134300_1077734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 568 | Open in IMG/M |
| 3300017709|Ga0181387_1110361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 565 | Open in IMG/M |
| 3300017731|Ga0181416_1091243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 725 | Open in IMG/M |
| 3300017738|Ga0181428_1059583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300017765|Ga0181413_1041282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1438 | Open in IMG/M |
| 3300017956|Ga0181580_10200326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1402 | Open in IMG/M |
| 3300017969|Ga0181585_10717856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 652 | Open in IMG/M |
| 3300018039|Ga0181579_10179846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1256 | Open in IMG/M |
| 3300018421|Ga0181592_10886718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 581 | Open in IMG/M |
| 3300018876|Ga0181564_10670594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 547 | Open in IMG/M |
| 3300019459|Ga0181562_10547401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 546 | Open in IMG/M |
| 3300020174|Ga0181603_10053277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2075 | Open in IMG/M |
| 3300020194|Ga0181597_10437702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 539 | Open in IMG/M |
| 3300020238|Ga0211492_1054730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300020289|Ga0211621_1025341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 906 | Open in IMG/M |
| 3300020310|Ga0211515_1048063 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 805 | Open in IMG/M |
| 3300020341|Ga0211592_1091925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300020382|Ga0211686_10022362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2600 | Open in IMG/M |
| 3300020382|Ga0211686_10337565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 615 | Open in IMG/M |
| 3300020394|Ga0211497_10093615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1223 | Open in IMG/M |
| 3300020414|Ga0211523_10429152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 532 | Open in IMG/M |
| 3300020418|Ga0211557_10096064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1471 | Open in IMG/M |
| 3300020420|Ga0211580_10285736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 678 | Open in IMG/M |
| 3300020439|Ga0211558_10430153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 608 | Open in IMG/M |
| 3300020446|Ga0211574_10138883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1063 | Open in IMG/M |
| 3300020450|Ga0211641_10605193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 515 | Open in IMG/M |
| 3300020454|Ga0211548_10137287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1177 | Open in IMG/M |
| 3300020462|Ga0211546_10183103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1038 | Open in IMG/M |
| 3300020462|Ga0211546_10311312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 788 | Open in IMG/M |
| 3300020463|Ga0211676_10133615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1584 | Open in IMG/M |
| 3300020463|Ga0211676_10175527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1321 | Open in IMG/M |
| 3300020463|Ga0211676_10198901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1214 | Open in IMG/M |
| 3300020468|Ga0211475_10297062 | Not Available | 794 | Open in IMG/M |
| 3300020474|Ga0211547_10114396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1411 | Open in IMG/M |
| 3300020474|Ga0211547_10434530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 660 | Open in IMG/M |
| 3300020474|Ga0211547_10436670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 658 | Open in IMG/M |
| 3300020474|Ga0211547_10548013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300020475|Ga0211541_10227253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 915 | Open in IMG/M |
| 3300020810|Ga0181598_1342320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 518 | Open in IMG/M |
| 3300021371|Ga0213863_10309574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300021960|Ga0222715_10386372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 769 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10393132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 609 | Open in IMG/M |
| 3300023119|Ga0255762_10124796 | Not Available | 1508 | Open in IMG/M |
| 3300023176|Ga0255772_10274891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 907 | Open in IMG/M |
| 3300023706|Ga0232123_1071342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 669 | Open in IMG/M |
| (restricted) 3300024260|Ga0233441_1138402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 784 | Open in IMG/M |
| 3300025513|Ga0208413_1145076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 593 | Open in IMG/M |
| 3300025722|Ga0209660_1186815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 668 | Open in IMG/M |
| 3300025770|Ga0209362_1211729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 645 | Open in IMG/M |
| 3300025830|Ga0209832_1012155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3819 | Open in IMG/M |
| 3300025881|Ga0209309_10029320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3555 | Open in IMG/M |
| 3300025894|Ga0209335_10142758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1174 | Open in IMG/M |
| 3300026210|Ga0208642_1006660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. RS40 | 3799 | Open in IMG/M |
| 3300026210|Ga0208642_1077433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. RS40 | 736 | Open in IMG/M |
| 3300026254|Ga0208522_1107381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 748 | Open in IMG/M |
| 3300026267|Ga0208278_1032664 | Not Available | 1339 | Open in IMG/M |
| 3300027191|Ga0208021_1033346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 779 | Open in IMG/M |
| 3300027686|Ga0209071_1231612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 511 | Open in IMG/M |
| 3300027687|Ga0209710_1123154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 982 | Open in IMG/M |
| 3300027752|Ga0209192_10171156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 845 | Open in IMG/M |
| 3300027779|Ga0209709_10136730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1223 | Open in IMG/M |
| 3300027791|Ga0209830_10432291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 553 | Open in IMG/M |
| 3300027813|Ga0209090_10137410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1299 | Open in IMG/M |
| 3300027838|Ga0209089_10731523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 504 | Open in IMG/M |
| 3300028192|Ga0257107_1058033 | Not Available | 1188 | Open in IMG/M |
| 3300028196|Ga0257114_1137271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 955 | Open in IMG/M |
| 3300028535|Ga0257111_1095471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 942 | Open in IMG/M |
| 3300031594|Ga0302131_1098949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1021 | Open in IMG/M |
| 3300031598|Ga0308019_10377765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 514 | Open in IMG/M |
| 3300031599|Ga0308007_10149117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 836 | Open in IMG/M |
| 3300031599|Ga0308007_10210176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 673 | Open in IMG/M |
| 3300031630|Ga0308004_10214250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 777 | Open in IMG/M |
| 3300031630|Ga0308004_10376728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 530 | Open in IMG/M |
| 3300031659|Ga0307986_10128190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1200 | Open in IMG/M |
| 3300031695|Ga0308016_10340591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 542 | Open in IMG/M |
| 3300031702|Ga0307998_1210561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 652 | Open in IMG/M |
| 3300031775|Ga0315326_10537611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 748 | Open in IMG/M |
| 3300031785|Ga0310343_10334009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. RS40 | 1082 | Open in IMG/M |
| 3300032006|Ga0310344_10578482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. RS40 | 962 | Open in IMG/M |
| 3300032011|Ga0315316_11292901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 582 | Open in IMG/M |
| 3300032073|Ga0315315_11033546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 735 | Open in IMG/M |
| 3300032820|Ga0310342_102841181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 578 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 20.97% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 14.52% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.26% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 6.45% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.45% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.03% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.03% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.42% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.42% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.42% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.42% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.61% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 1.61% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 1.61% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.61% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.61% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.61% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.81% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.81% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.81% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.81% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000168 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m | Environmental | Open in IMG/M |
| 3300000257 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_F_10_SI03_100 | Environmental | Open in IMG/M |
| 3300001832 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM6, ROCA_DNA131_0.2um_27b | Environmental | Open in IMG/M |
| 3300001846 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25b | Environmental | Open in IMG/M |
| 3300001941 | Marine microbial communities from Browns Bank, Gulf of Maine - GS003 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300001962 | Marine microbial communities from Cocos Island, Costa Rica - GS023 | Environmental | Open in IMG/M |
| 3300003596 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI073_LV_135m_DNA | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012415 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300014818 | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0152 : 8 days incubation | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020238 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068) | Environmental | Open in IMG/M |
| 3300020289 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556122-ERR599019) | Environmental | Open in IMG/M |
| 3300020310 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX556067-ERR598950) | Environmental | Open in IMG/M |
| 3300020341 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555908-ERR599066) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023706 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024260 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MG | Environmental | Open in IMG/M |
| 3300025222 | Marine microbial communities from the Deep Pacific Ocean - MP2253 (SPAdes) | Environmental | Open in IMG/M |
| 3300025513 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD (SPAdes) | Environmental | Open in IMG/M |
| 3300025722 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300026210 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV251 (SPAdes) | Environmental | Open in IMG/M |
| 3300026254 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 (SPAdes) | Environmental | Open in IMG/M |
| 3300026267 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV259 (SPAdes) | Environmental | Open in IMG/M |
| 3300027191 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes) | Environmental | Open in IMG/M |
| 3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028535 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500m | Environmental | Open in IMG/M |
| 3300031594 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_20m | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPjun09P1210mDRAFT_10046361 | 3300000168 | Marine | DCNKYAREAEERPFPNEETTPPVTKIYRAMVLSYSD* |
| LP_F_10_SI03_100DRAFT_10064364 | 3300000257 | Marine | CNKYANEAEERPLPREETTPPVTNIYRAMELSYSE* |
| ACM6_10264283 | 3300001832 | Marine Plankton | YASDADDNPFPSDDTTPPVTNIYRAMELSYRLIILK* |
| ACM22_10513865 | 3300001846 | Marine Plankton | SKYASDAEDRPLPSDETTPPVTNIYRAMEVSYRLKI* |
| GOS2219_10314653 | 3300001941 | Marine | SNFLKRTLKPLDCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD* |
| GOS2218_10004223 | 3300001947 | Marine | CNKYARDAEERPFPNEETTPPVTKINRAMVLSYSD* |
| GOS2239_10095355 | 3300001962 | Marine | FNKYASDAEDNPFPSDETTPPVTKIYRAMEVSYRLKT* |
| JGI26255J51710_10045141 | 3300003596 | Marine | GSNFLKRTLKPLDCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD* |
| Ga0068481_15189641 | 3300006339 | Marine | IEEDMLEAEESPLPNDETTPPVTNIYRAMELLYKHK* |
| Ga0066372_103625081 | 3300006902 | Marine | ANDAEERPFPKDETTPPVTNIYRAMELTYNHLFLN* |
| Ga0075110_11194241 | 3300007074 | Saline Lake | GSSFLKRTLKPLDCSKYAREAEERPFPKDETTPPVTKINRAMVLSYSD* |
| Ga0075468_102481622 | 3300007229 | Aqueous | FLKRTLKPLDCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD* |
| Ga0105745_12063213 | 3300007972 | Estuary Water | DCNRYARDAEERPFPNEETTPPVTKINRAMVLSYSD* |
| Ga0111541_104252623 | 3300008097 | Marine | SDADDKPFPSDDTTPPVTKIYRAMELCYSELFLK* |
| Ga0102887_12354703 | 3300008961 | Estuarine | LDCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD* |
| Ga0102831_10108381 | 3300008996 | Estuarine | DCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD* |
| Ga0115566_102851483 | 3300009071 | Pelagic Marine | NKYAREAEERPFPNEETTPPVTKINRAMVLSYSD* |
| Ga0115566_105017321 | 3300009071 | Pelagic Marine | YANDADESPFPKDETTPPVTNIYRAMELPYSDIYLN* |
| Ga0115566_106749813 | 3300009071 | Pelagic Marine | KRTLKPLDCSKYASEAEDKPFPKEDTTPPVTKINRAMELSYSDYLIK* |
| Ga0114995_103496541 | 3300009172 | Marine | KPLDCNKYAREAEERPFPKDETTPPVTKINRAMVISYSD* |
| Ga0115551_14460983 | 3300009193 | Pelagic Marine | TLKPLDCNRYAKEAEERPFPREETTPPVTNIYRAMELPYNDLLLD* |
| Ga0114994_109710213 | 3300009420 | Marine | RYANEAEESPLPKDETTPPVTKIYRAMELSYNDK* |
| Ga0114932_102081693 | 3300009481 | Deep Subsurface | NKYANDADDNPLPNDETTPPVTNIYRAMELLYNHKY* |
| Ga0115569_104047431 | 3300009497 | Pelagic Marine | PLDCKRYANEADERPLPNDDTTPPVTNIYRAMELSYSDK* |
| Ga0115568_103267663 | 3300009498 | Pelagic Marine | CNKYAKEAEESPFPNDETTPPVTNIYRAMVLSYSDKLSD* |
| Ga0115564_101665863 | 3300009505 | Pelagic Marine | PLDCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD* |
| Ga0115013_108280403 | 3300009550 | Marine | LYPLDWSKYAKDADERPLPKDETTPPVTNIYRAMEESYSE* |
| Ga0114933_102031994 | 3300009703 | Deep Subsurface | NKYARDADDKPLPSEETTPPVTNIYRAMELLYSDKLLK* |
| Ga0133547_107203701 | 3300010883 | Marine | KPLSCNKAASEADDSPFPKDDTTPPVTNIYRAME* |
| Ga0138263_14487211 | 3300012415 | Polar Marine | LDCRKYAREADERPFPNEETTPPVTKINRAMVLSYND* |
| Ga0160422_101917843 | 3300012919 | Seawater | FNKYASEADESPFPKDETTPPVTNIYRAMEVSYN* |
| Ga0160422_108246213 | 3300012919 | Seawater | NKYARDAEERPLPKDDTTPPVTNIYRAMEVSYSE* |
| Ga0160423_102684081 | 3300012920 | Surface Seawater | SKYARDAEERPLPRDETTPPVTKIYRAMEVSYSE* |
| Ga0163110_103473923 | 3300012928 | Surface Seawater | NFLSLTLYPLDCNRYASDAEERPFPSEETTPPVTKIYRAMELSYSE* |
| Ga0163110_113500481 | 3300012928 | Surface Seawater | NCNNEANDAEVNPFPKDETTPPVTKIYRAMELCYSL* |
| Ga0163109_108530893 | 3300012936 | Surface Seawater | FNKYASEAEERPLPNDETTPPVTKINRAMEVSYSE* |
| Ga0163109_113861783 | 3300012936 | Surface Seawater | KYPSEADDNPFPSEETTPPVTKMNRAMELCYSSY* |
| Ga0163111_103828263 | 3300012954 | Surface Seawater | NEADDKPFPKDETTPPVTNMYRAMEDCYTLDIYY* |
| Ga0163111_105066103 | 3300012954 | Surface Seawater | CNKYARDAEERPLPKEETTPPVTNIYRAMEVSYSE* |
| Ga0163111_125858943 | 3300012954 | Surface Seawater | CNKYAKDAEDRPLPREETTPPVTNIYRAMEVSYSE* |
| Ga0134300_10777341 | 3300014818 | Marine | RSEGEADDNPLPKDETTPPVTNIYRAMEVCYTLYI* |
| Ga0181387_11103613 | 3300017709 | Seawater | ARDAEERPLPKEETTPPVTNIYRAMELSYSELRMN |
| Ga0181383_11019163 | 3300017720 | Seawater | LTLKPLDCKRYASEAEDKPLPNDETTPPVTNIYRAMELSYSE |
| Ga0181416_10912431 | 3300017731 | Seawater | RDCSKYASDADDRPLPREETTPPVTNIYRAMELSYSE |
| Ga0181428_10595831 | 3300017738 | Seawater | KYAKEADDNPLPNDETTPPVTNIYRAMELSYSELKKN |
| Ga0181413_10412824 | 3300017765 | Seawater | RYANDADDNPLPKDETTPPVTNIYRAMEVCYTLYI |
| Ga0181580_102003264 | 3300017956 | Salt Marsh | LDCNKYARDAEERPLPREETTPPVTKIYRAMEVSYSE |
| Ga0181585_107178563 | 3300017969 | Salt Marsh | DCRRYASDADDRPFPSDETTPPVTNIYRAMELSYSQ |
| Ga0181579_101798461 | 3300018039 | Salt Marsh | TLYPRDCRRYASDADDRPFPSDETTPPVTNIYRAMALSYS |
| Ga0181592_108867181 | 3300018421 | Salt Marsh | TLYPLDCNKYANDAEERPLPREETTPPVTNIYRAMEVSYSE |
| Ga0181564_106705941 | 3300018876 | Salt Marsh | PLDCNKYARDAEERPLPNDETTPPVTNINRAMELSYSE |
| Ga0181562_105474011 | 3300019459 | Salt Marsh | YANDAEDKPLPKDETTPPVTNINRAMEVPYSGKSYK |
| Ga0181603_100532774 | 3300020174 | Salt Marsh | ASDAEERPLPREETTPPVTKIYRAMELPYSDNYSN |
| Ga0181597_104377021 | 3300020194 | Salt Marsh | GSNFLNLTLYPLDCNKYARDAEERPLPKEETTPPVTNIYRAMELSYSE |
| Ga0211492_10547303 | 3300020238 | Marine | LDCNRYASEAEERPLPKDETTPPVTNINRAMDLFYILL |
| Ga0211621_10253413 | 3300020289 | Marine | CNKYASEAEERPLPKDETTPPVTNINRAMELSYRP |
| Ga0211515_10480631 | 3300020310 | Marine | CNKYARDADDKPLPSDETTPPVTKIYRAMELSYSG |
| Ga0211592_10919251 | 3300020341 | Marine | CNKYAREAEERPLPRDETTPPVTNINRAMELSYSE |
| Ga0211686_100223624 | 3300020382 | Marine | RRTLKPLDCSKYAREAEERPFPKEETTPPVTNINRAMELVYNS |
| Ga0211686_103375653 | 3300020382 | Marine | LNLTLKPLDCSKYAREAEERPFPREETTPPVTKIYRAMELSYSDKFMN |
| Ga0211497_100936151 | 3300020394 | Marine | DLNKYPNDADDKPLPSDETTPPVTNIYRAMELCYSQ |
| Ga0211523_104291523 | 3300020414 | Marine | DCSKYASDAEDRPLPRDETTPPVTNINRAMELPYSDIF |
| Ga0211557_100960641 | 3300020418 | Marine | KRYAREAEDKPLPNDETTPPVTNIYRAMELLYIDT |
| Ga0211580_102857363 | 3300020420 | Marine | PCDFNKYAKEAEDNPLPSDETTPPVTNIYRAMELSYSE |
| Ga0211558_104301531 | 3300020439 | Marine | LYPLDCNKYANDADDNPFPKDETTPPVTNMYRAMEVCYTLKLC |
| Ga0211574_101388831 | 3300020446 | Marine | FLNLTLYPLDCNKYAKDAEDKPLPKDETTPPVTNIYRAMEVSYSA |
| Ga0211641_106051931 | 3300020450 | Marine | LDCSKYAKEAEERPFPNDETTPPVTNINRAMELSYSE |
| Ga0211548_101372873 | 3300020454 | Marine | DFNRYASDADDNPLPREDTTPPVTKMNRAMELSYSSYL |
| Ga0211546_101831031 | 3300020462 | Marine | ANEAEDRPLPKDETTPPVTKINRAMELSYSEKKSN |
| Ga0211546_103113121 | 3300020462 | Marine | PWDFNRYASDADDNPLPREDTTPPVTNIYRAMELSYRPKT |
| Ga0211676_101336154 | 3300020463 | Marine | DCNKYARDAEESPFPKEETTPPVTNIYRAMEVSYSE |
| Ga0211676_101755273 | 3300020463 | Marine | DFSKYANDAEDKPFPSDETTPPVTKINRAMEVTYSE |
| Ga0211676_101989011 | 3300020463 | Marine | LYPLDCNKYASDAEDRPLPKEETTPPVTNIYRAMELSYSE |
| Ga0211475_102970623 | 3300020468 | Marine | ARDADDKPFPSEDTTPPVTNIYRAMESCYSELFLK |
| Ga0211547_101143961 | 3300020474 | Marine | PLDWSKYASDAEDSPLPNEETTPPVTKIKRAMELSYSE |
| Ga0211547_104345301 | 3300020474 | Marine | CNKYASDADDNPLPKDETTPPVTKMYRAMEVCYTS |
| Ga0211547_104366701 | 3300020474 | Marine | PLDCNKYASEADDNPFPKDETTPPVTKMYRAMEVCYTLFLN |
| Ga0211547_105480131 | 3300020474 | Marine | NFLNLTLYPLDWRRYARDAEESPLPNDETTPPVTKINRAMDLSYSE |
| Ga0211541_102272533 | 3300020475 | Marine | KPLDCKRYANEADERPFPKDETTPPVTNIYRAMELCYTQ |
| Ga0181598_13423203 | 3300020810 | Salt Marsh | CNKYARDAEERPLPKEETTPPVTNIYRAMELSYSE |
| Ga0213863_103095741 | 3300021371 | Seawater | LSKYASEAEERPLPKDETTPPVTKIYRAMEVSYSEKKSN |
| Ga0222715_103863723 | 3300021960 | Estuarine Water | CNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD |
| (restricted) Ga0233432_103931323 | 3300023109 | Seawater | LDCSRYAKEAEERPLPKDETTPPVTNIYRAMELSYID |
| Ga0255762_101247964 | 3300023119 | Salt Marsh | DCKRYASDAEDNPFPSDDTTPPVTKIYRAMELRYSD |
| Ga0255772_102748911 | 3300023176 | Salt Marsh | DCRRYASDADDRPFPRDETTPPVTNIYRAMELSYS |
| Ga0232123_10713421 | 3300023706 | Salt Marsh | ASEAEERPLPREETTPPVTKIYRAMELPYSDKYRN |
| (restricted) Ga0233441_11384021 | 3300024260 | Seawater | LDCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD |
| Ga0208831_10149983 | 3300025222 | Deep Ocean | LNCNKDANEAEVRPFPNDETTPPVTNIYRAMEVQYSKF |
| Ga0208413_11450763 | 3300025513 | Saline Lake | LDCSKYAREAEERPFPKEETTPPVTKIYRAMVLSYSD |
| Ga0209660_11868153 | 3300025722 | Marine | SNFLKRTLKPLDCNKYARDAEERPFPNEETTPPVTKINRAMVLSYSD |
| Ga0209362_12117291 | 3300025770 | Marine | LKPLDCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD |
| Ga0209832_10121555 | 3300025830 | Pelagic Marine | NKYANEAEERPFPRDETTPPVTNIYRAMELSYSDK |
| Ga0209309_100293201 | 3300025881 | Pelagic Marine | DCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD |
| Ga0209335_101427583 | 3300025894 | Pelagic Marine | RSKYANDADDSPLPKEETTPPVTNIYRAMELSYSE |
| Ga0208642_10066605 | 3300026210 | Marine | NKYPNDADDKPLPSEETTPPVTNIYRAMELCYNHII |
| Ga0208642_10774331 | 3300026210 | Marine | NKYPNDADDKPLPSEETTPPVTNIYRAMELCYSYII |
| Ga0208522_11073813 | 3300026254 | Marine | KPLDFNKYANEADDKPLPNDETTPPVTNIYRAMELLYNHKY |
| Ga0208278_10326641 | 3300026267 | Marine | NCNNAAKDAEDNPFPRDETTPPVTNIYRAMEDHYKQ |
| Ga0208021_10333461 | 3300027191 | Estuarine | DCNKYARDAEERPFPNEETTPPVTKINRAMVLSYSD |
| Ga0209071_12316122 | 3300027686 | Marine | KRTLKPLDCSKYAREAEERPFPSEETTPPVTKINRAMVLSYND |
| Ga0209710_11231541 | 3300027687 | Marine | PLDCSRYAREAEERPFPNEETTPPVTKINRAMVLSYND |
| Ga0209192_101711563 | 3300027752 | Marine | LRRTLKPLDCSKYAREAEERPFPKEETTPPVTNINRAMELVYNG |
| Ga0209709_101367301 | 3300027779 | Marine | YANDAEERPLPKDETTPPVTNIYRAMELSYSEKKLN |
| Ga0209830_104322911 | 3300027791 | Marine | PLDCSKYAREAEERPFPKEETTPPVTKIYRAMELSYSD |
| Ga0209090_101374101 | 3300027813 | Marine | RTLKPLDCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD |
| Ga0209089_107315232 | 3300027838 | Marine | FLRRTLKPLDWSKYASDADERPFPKEETTPPVTNIYRAMELLYSDIFLN |
| Ga0257107_10580331 | 3300028192 | Marine | CDFKRYASDADDNPFPSDETTPPVTKIYRAMELFYSH |
| Ga0257114_11372711 | 3300028196 | Marine | FLKRTLKPLDCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD |
| Ga0257111_10954713 | 3300028535 | Marine | DFNKYASDADDNPLPSDETTPPVTKIYRAMELFYSH |
| Ga0302131_10989491 | 3300031594 | Marine | TLKPLDCNKYAREAEERPFPKDETTPPVTKINRAMVLSYSD |
| Ga0308019_103777653 | 3300031598 | Marine | ASDADERPFPKEETTPPVTNINRAMELPYRYICVN |
| Ga0308007_101491171 | 3300031599 | Marine | CNRYAREAEERPFPNEETTPPVTKINRAMVLSYSD |
| Ga0308007_102101761 | 3300031599 | Marine | KPLDCSKYAREAEERPFPKDETTPPVTKINRAMVLSYSD |
| Ga0308004_102142503 | 3300031630 | Marine | GSNFLKRTLKPLDCNRYAREAEERPFPNEETTPPVTKINRAMVLSYSD |
| Ga0308004_103767282 | 3300031630 | Marine | LKRTLKPLDCSKYAREAEERPFPSEETTPPVTKINRAMVLSYSD |
| Ga0307986_101281903 | 3300031659 | Marine | KRTLKPLDCNKYAREAEERPFPNEETTPPVTKINRAMVLSYSD |
| Ga0308016_103405911 | 3300031695 | Marine | GSNFLKRTLKPLDCNKYARDAEERPFPKEETTPPVTKINRAMVLSYSD |
| Ga0307998_12105611 | 3300031702 | Marine | LKPLDCSKYAREAEERPFPKDETTPPVTKINRAMVLSYSD |
| Ga0315326_105376111 | 3300031775 | Seawater | DCKRYASEADDNPFPKDETTPPVTKMYRAMEVCYTL |
| Ga0310343_103340091 | 3300031785 | Seawater | TLKPLDCNKYANDAEERPFPNDETTPPVTNINRAMELCYRPI |
| Ga0310344_105784821 | 3300032006 | Seawater | YARDADDKPLPSDETTPPVTNIYRAMELLYSDKLLK |
| Ga0315316_112929013 | 3300032011 | Seawater | FNKYARDADDRPFPKDETTPPVTNIYRAMELFYSCSC |
| Ga0315315_110335463 | 3300032073 | Seawater | DCNKNASDAEDRPFPKDETTPPVTNIYRAMELSYSE |
| Ga0310342_1028411813 | 3300032820 | Seawater | CNKYAKDAEERPLPREETTPPVTNIYRAMEVSYSE |
| ⦗Top⦘ |