NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068909

Metagenome / Metatranscriptome Family F068909

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068909
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 45 residues
Representative Sequence LSLSTKPAPPCPKCGSKKVTRLFSRINTEWLPSDVAWDRVGRSWD
Number of Associated Samples 116
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.61 %
% of genes near scaffold ends (potentially truncated) 98.39 %
% of genes from short scaffolds (< 2000 bps) 98.39 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.581 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(9.677 % of family members)
Environment Ontology (ENVO) Unclassified
(31.452 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.097 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.22%    β-sheet: 0.00%    Coil/Unstructured: 91.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF00561Abhydrolase_1 39.52
PF09723Zn-ribbon_8 4.84
PF12697Abhydrolase_6 4.03
PF01177Asp_Glu_race 4.03
PF00211Guanylate_cyc 2.42
PF01522Polysacc_deac_1 1.61
PF12802MarR_2 1.61
PF16697Yop-YscD_cpl 0.81
PF00206Lyase_1 0.81
PF00857Isochorismatase 0.81
PF13432TPR_16 0.81
PF02515CoA_transf_3 0.81
PF00296Bac_luciferase 0.81
PF12680SnoaL_2 0.81
PF12762DDE_Tnp_IS1595 0.81
PF13683rve_3 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 2.42
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 1.61
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.81
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.81
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.81
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.58 %
UnclassifiedrootN/A2.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100779712All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300000955|JGI1027J12803_108939604Not Available519Open in IMG/M
3300000956|JGI10216J12902_100335662All Organisms → cellular organisms → Bacteria → Proteobacteria1081Open in IMG/M
3300000956|JGI10216J12902_100438444All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300004156|Ga0062589_102189453All Organisms → cellular organisms → Bacteria → Proteobacteria566Open in IMG/M
3300004156|Ga0062589_102562435All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005174|Ga0066680_10579556All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300005329|Ga0070683_100575030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1078Open in IMG/M
3300005332|Ga0066388_108396201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300005340|Ga0070689_101627867All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300005344|Ga0070661_100447891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1027Open in IMG/M
3300005365|Ga0070688_100255293All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300005440|Ga0070705_101801825All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005444|Ga0070694_100917648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300005713|Ga0066905_100852877All Organisms → cellular organisms → Bacteria → Proteobacteria794Open in IMG/M
3300005764|Ga0066903_102279763All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300005764|Ga0066903_104925811All Organisms → cellular organisms → Bacteria → Proteobacteria709Open in IMG/M
3300006028|Ga0070717_12134846All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006057|Ga0075026_101048209All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300006354|Ga0075021_10410915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria850Open in IMG/M
3300006796|Ga0066665_10790401All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300006847|Ga0075431_102030474All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300006914|Ga0075436_100987176All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300006954|Ga0079219_12200223All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300007076|Ga0075435_101925353All Organisms → cellular organisms → Bacteria → Proteobacteria519Open in IMG/M
3300009012|Ga0066710_101285341All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1135Open in IMG/M
3300009090|Ga0099827_10032806All Organisms → cellular organisms → Bacteria3764Open in IMG/M
3300009093|Ga0105240_11059762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Aeromicrobium864Open in IMG/M
3300009094|Ga0111539_10613696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1267Open in IMG/M
3300009098|Ga0105245_10602890All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300009098|Ga0105245_12996658All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300009137|Ga0066709_104635401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300009148|Ga0105243_10207638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1722Open in IMG/M
3300009156|Ga0111538_12191028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria694Open in IMG/M
3300009174|Ga0105241_12443008All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300009177|Ga0105248_10891988All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300009177|Ga0105248_13289716All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300009553|Ga0105249_10324881All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300009792|Ga0126374_11771592All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300009814|Ga0105082_1085619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300009837|Ga0105058_1137114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300010359|Ga0126376_11817104All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300010398|Ga0126383_13045926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300010399|Ga0134127_12489970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300010938|Ga0137716_10228055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1084Open in IMG/M
3300011003|Ga0138514_100063532All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300012010|Ga0120118_1164200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300012014|Ga0120159_1196841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300012211|Ga0137377_10658927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis jejuensis982Open in IMG/M
3300012532|Ga0137373_10313147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1243Open in IMG/M
3300012912|Ga0157306_10033609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1192Open in IMG/M
3300012961|Ga0164302_10377756All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300012971|Ga0126369_12536646All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300012986|Ga0164304_11657412All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300013105|Ga0157369_11727625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300013297|Ga0157378_12461886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300013306|Ga0163162_12768108All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300013307|Ga0157372_11208729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300013764|Ga0120111_1072213All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300013772|Ga0120158_10427207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300014150|Ga0134081_10183155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300014260|Ga0075307_1049920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria798Open in IMG/M
3300014263|Ga0075324_1147939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300014272|Ga0075327_1160282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300014310|Ga0075331_1016179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1653Open in IMG/M
3300015245|Ga0137409_11003380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300016422|Ga0182039_10235844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1482Open in IMG/M
3300017659|Ga0134083_10349619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300017944|Ga0187786_10341173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae630Open in IMG/M
3300017993|Ga0187823_10391144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300018061|Ga0184619_10375961All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300018063|Ga0184637_10237356All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300018082|Ga0184639_10176294All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300018429|Ga0190272_11020124Not Available792Open in IMG/M
3300018431|Ga0066655_11008196All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300018433|Ga0066667_10858114All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300018466|Ga0190268_12290811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300018469|Ga0190270_12150789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300018476|Ga0190274_12282652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300019257|Ga0180115_1012880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300020195|Ga0163150_10273805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300021086|Ga0179596_10717798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
(restricted) 3300021518|Ga0224722_1226585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300023275|Ga0247776_10323220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300025319|Ga0209520_10120806All Organisms → cellular organisms → Bacteria1669Open in IMG/M
3300025795|Ga0210114_1058808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300025885|Ga0207653_10271901All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300025901|Ga0207688_10153365All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300025910|Ga0207684_10634302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria911Open in IMG/M
3300025920|Ga0207649_10454429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria967Open in IMG/M
3300025925|Ga0207650_11251978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300025932|Ga0207690_11230746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300025961|Ga0207712_10152170All Organisms → cellular organisms → Bacteria1788Open in IMG/M
3300025972|Ga0207668_11842622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300026033|Ga0208652_1036796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300026041|Ga0207639_11359870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300026041|Ga0207639_11913045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300026088|Ga0207641_10348102All Organisms → cellular organisms → Bacteria1412Open in IMG/M
3300026116|Ga0207674_10792503All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300026295|Ga0209234_1025657Not Available2237Open in IMG/M
3300027894|Ga0209068_10384161All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300027961|Ga0209853_1056791All Organisms → cellular organisms → Bacteria → Acidobacteria1069Open in IMG/M
3300028281|Ga0247689_1009969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1197Open in IMG/M
3300028381|Ga0268264_11996167All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300028592|Ga0247822_10298995All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300028597|Ga0247820_10625286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300028597|Ga0247820_11323891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300028714|Ga0307309_10180149All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031547|Ga0310887_10654128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300031564|Ga0318573_10772665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300031681|Ga0318572_10472986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria746Open in IMG/M
3300031736|Ga0318501_10514039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300031740|Ga0307468_100947283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Aeromicrobium752Open in IMG/M
3300031747|Ga0318502_10102033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1591Open in IMG/M
3300031747|Ga0318502_10962553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300031769|Ga0318526_10179489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300031771|Ga0318546_10821470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300032009|Ga0318563_10704592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300032010|Ga0318569_10112220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1238Open in IMG/M
3300032044|Ga0318558_10209858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria952Open in IMG/M
3300032066|Ga0318514_10301350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria847Open in IMG/M
3300032401|Ga0315275_10363023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1623Open in IMG/M
3300032516|Ga0315273_11185637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria963Open in IMG/M
3300033550|Ga0247829_10281230All Organisms → cellular organisms → Bacteria1346Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.03%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands4.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.03%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.23%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.23%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.23%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.42%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.42%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.42%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.42%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.61%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.81%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.81%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.81%
Hot Spring Fe-Si SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.81%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010938Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014260Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014310Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019257Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020195Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IBEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021518 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR1_MetaGEnvironmentalOpen in IMG/M
3300023275Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025795Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026033Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028281Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10077971223300000364SoilLSTSDKPAPPCPKCGGKKVERLWSSINTEWMPSDVAWDRVGRTWD*
JGI1027J12803_10893960413300000955SoilFEEYLSTSDKPAPPCPKCGGKKVERLWSKINTEWLPSDVAWDRVGRTWD*
JGI10216J12902_10033566233300000956SoilKCEERFEEYLSTSDKPVPPCPKCGGKRVERLWSRINTEWLPSDVAWDRVGRSWD*
JGI10216J12902_10043844423300000956SoilKCDERFEEYLSTSDKPAPPCPKCGGKKVERLWSSINTEWMPSDVAWDRVGRTWD*
Ga0062589_10218945323300004156SoilCQERFEEYLSTSDKPAPPCPKCGSGDVERLLSRINTEWLPSDVAWDRVGRSWD*
Ga0062589_10256243523300004156SoilPAPPCPKCKGKKIERLWSTINTEWMPSDVAWDRVGRSFE*
Ga0066680_1057955623300005174SoilTKPSPPCPECGSESVLRLMSRINTEWLPSDVNWHRTGSSWD*
Ga0070683_10057503023300005329Corn RhizosphereLSMSTNPAPPCPKCKSKSVERLFSRINTEWLPSDVNWHRVGSSWD*
Ga0066388_10839620113300005332Tropical Forest SoilSDKPAPPCPSCTSPKVERLLSRINTEWLPSDVAWDRVGRSWD*
Ga0070689_10162786723300005340Switchgrass RhizosphereKCEEKFEEYLSTSDKPAPPCPKCSAKKVERLWSSINTEWMPSDVAWDRVGRTF*
Ga0070661_10044789123300005344Corn RhizosphereEEFLSLSTKPAPPCPKCGSKKVTRAWSRINTEWLPSDVAWDRVGRSWD*
Ga0070688_10025529333300005365Switchgrass RhizosphereARCQERFEEYLSTSDKPAPPCPKCGSGDVERLLSRINTEWLPSDVAWDRVGRSWD*
Ga0070705_10180182523300005440Corn, Switchgrass And Miscanthus RhizosphereLSSSEKPSPPCPACGAEKVERLMSRISTEWMPSDVNWHRTESSWD*
Ga0070694_10091764813300005444Corn, Switchgrass And Miscanthus RhizosphereLSTSEKPAPPCPACGAADVERILSSFRTEWLPSDVNWHRTGSSWD*
Ga0066905_10085287723300005713Tropical Forest SoilCDEQFEEYLSTSDKPAPPCPKCGAKKVERLWSRINTEWLPSDVAWDRVGRTWD*
Ga0066903_10227976313300005764Tropical Forest SoilCPKCGSKKVTRLFSRINTEWMPSDVAWDRVGRTWD*
Ga0066903_10492581113300005764Tropical Forest SoilRFEEYLSTSDKPAPPCPKCGSGDVERLLSRINTEWLPSDVAWDRVGRSWD*
Ga0070717_1213484623300006028Corn, Switchgrass And Miscanthus RhizosphereCDTRFEEFLSLSTEPSPPCPSCGSETVERLMSTVSTEWLPSDVNWHRAGSSWD*
Ga0075026_10104820923300006057WatershedsHERFEEFLTLSTNPPPPCPTCGSAKVERKLSNINTEWLPSDVAWDRVGRSWD*
Ga0075021_1041091513300006354WatershedsFEEYLSTSDKPAPPCPKCGSAKVTRLWSTINTEWLPSDVAWDRVGRSWD*
Ga0066665_1079040113300006796SoilTKPAPPCPECGSKKVKRLWSQISTEWLPSDVDWDRVGRKWD*
Ga0075431_10203047423300006847Populus RhizosphereAPPCPKCGSENVTRLMSRISTEWMPSDVAWDRVGRQWD*
Ga0075436_10098717623300006914Populus RhizosphereKCDEQFEEFLSLSTKPAPPCPKCGNKKVTRVWSRINTEWLPSDVAWDRVGRSWD*
Ga0079219_1220022323300006954Agricultural SoilYLSTSDKPAPPCPKCGAKKVERLWSSINTEWMPSDVAWDRVGRSF*
Ga0075435_10192535313300007076Populus RhizosphereERFEEFLSSSTKPAPPCPKCGSENVTRLMSRISTEWMPSDVAWDRVGRKWD*
Ga0066710_10128534113300009012Grasslands SoilPCPECGAKKVTRLWSPIRTEWLPSDVAWDRVGRSWD
Ga0099827_1003280663300009090Vadose Zone SoilAPPCPKCGATVVEKLMSRINTEWLPSDVAWDRVGRSWD*
Ga0105240_1105976223300009093Corn RhizosphereFLSLSTKPAPPCPKCGAMKVKRLFSRINTEWLPSDVAWDRVGRSWD*
Ga0111539_1061369633300009094Populus RhizosphereFEEFLSTSDKPAPPCPTCGAAKVERLLSRINTEWLPSDVAWDRVGRSWD*
Ga0105245_1060289033300009098Miscanthus RhizosphereCPKCGNKKVTRMWSRINTEWLPSDVAWDRVGRSWD*
Ga0105245_1299665813300009098Miscanthus RhizosphereLSLSTKPAPPCPKCGAMKVKRLFSRINTEWLPSDVAWDRVGRSWD*
Ga0066709_10463540123300009137Grasslands SoilRGTGCEERYGEYRPQTTNPTPPCPKCGSKKVERLWSPIRTEWLPSDVAWDRVGRSWD*
Ga0105243_1020763813300009148Miscanthus RhizosphereLSLSTKPAPPCPKCGNKKVTRMWSRINTEWLPSDVAWDRVGRSWD*
Ga0111538_1219102813300009156Populus RhizosphereFEEYLSTSTKPSPPCPKCGAPDPARVWSTISTEWLPSDVAWDRVNRSWD*
Ga0105241_1244300813300009174Corn RhizosphereKPAPPCPKCGAKKVERLWSSINTEWMPSDVAWDRVGRSF*
Ga0105248_1089198823300009177Switchgrass RhizosphereKPAPPCPKCGSKKVTRLWSRINTEWMPSDVAWDRVGRTWD*
Ga0105248_1328971613300009177Switchgrass RhizosphereKCEEKFEEYLSTSDKPAPPCPQCGTKKVERLWSSINTEWMPSDVAWDRVGRTF*
Ga0105249_1032488113300009553Switchgrass RhizospherePCPKCGSKKVTRLWSRINTEWMPSDVAWDRVGRTWD*
Ga0126374_1177159213300009792Tropical Forest SoilLSLSTKPAPPCPKCGSKKVTRLFSRINTEWLPSDVAWDRVGRSWD*
Ga0105082_108561923300009814Groundwater SandFEEFLSTSDKPPPPCPKCGSEEVQRKLSSFSTEWLPSDVAWDRVGRSWD*
Ga0105058_113711413300009837Groundwater SandSDKPAPPCPECGSAEVARLMSTINTEWLPSDVAWDRVGRSWD*
Ga0126376_1181710423300010359Tropical Forest SoilSTSDKPTPPCPSCGSTEVARLWSTINTEWLPSDVAWDRVGRSWD*
Ga0126383_1304592623300010398Tropical Forest SoilSLSTKPAPPCPTCGGKKVERLWSPINTEWLPSDVNWHRTSSSWD*
Ga0134127_1248997013300010399Terrestrial SoilCDERFEEYLSTSTKPKPPCPKCGAKSVERQWSSINTEWLPSDVAWDRVGRTWD*
Ga0137716_1022805523300010938Hot Spring Fe-Si SedimentPAPPCPRCGKEGVERLWSPISTEWLPGDVAWDRVGRKWD*
Ga0138514_10006353213300011003SoilDKPTPPCPKCKSKSVERLWSSINTEWLPSDVAWDRVGRSWD*
Ga0120118_116420023300012010PermafrostLMSSTKPSPPCPKCGAKAIERLMSRINTEWLPSDVAWDRVGRSWD*
Ga0120159_119684123300012014PermafrostTSERPTPPCPKCKSADVTRLMSSINTEWLPSDVNWHRMSSSWD*
Ga0137377_1065892723300012211Vadose Zone SoilTKPSPPCPKCGTKAVERLMSRINTEWLPSDVAWDRVGRSWD*
Ga0137373_1031314743300012532Vadose Zone SoilDQCQERFEELLSSSTKPAPSCPKCGAENPTRLFSRINTEWLPSDVAWDRVGRSWD*
Ga0157306_1003360933300012912SoilKFEEFLSTSDKPAPPCPTCGSAKVERLLSRINTEWLPSDVAWDRVGRSWD*
Ga0164302_1037775623300012961SoilEYLSTSDKAAPPCPKCGAKKVERLWSSINTEWLPSDVAWDRVGRSF*
Ga0126369_1253664613300012971Tropical Forest SoilLALSTKPAPPCPKCGSKKVTRMWSRINTEWLPSDVAWDRVGRTWD*
Ga0164304_1165741213300012986SoilAPPCPKCGAKKVERLWSSINTEWMPSDVAWDRVGRSF*
Ga0157369_1172762523300013105Corn RhizosphereEFLSLSTKPAPPCPKCGNKKVTRVWSRINTEWLPSDVAWDRVGRSWD*
Ga0157378_1246188623300013297Miscanthus RhizosphereCDERFEEYLSTSTKPKPPCPKCGAKTVERQWSSINTEWLPSDVAWDRVGRTWD*
Ga0163162_1276810823300013306Switchgrass RhizospherePRCGSKKVTRLWSRINTEWMPSDVAWDRVGRTWD*
Ga0157372_1120872913300013307Corn RhizosphereTKPAPPCPKCGNKKVTRVWSRINTEWLPSDVAWARVGRSWD*
Ga0120111_107221313300013764PermafrostSPPCPKCGAKAIERLMSRINTEWLPSDVAWDRVGRSWD*
Ga0120158_1042720723300013772PermafrostEEYLATSERPAPPCPKCKSADVTRLMSSINTEWLPSDVNWHRMSSSWD*
Ga0134081_1018315513300014150Grasslands SoilPKCGAKKVERLWSRINTDWLPSDVAWDRVGRTWD*
Ga0075307_104992013300014260Natural And Restored WetlandsTLSTNDAPPCPKCGSEDVTRLFSPITTEWLPSDVAWDRVGRSWD*
Ga0075324_114793913300014263Natural And Restored WetlandsPKCGGDKVERLLSKINSEWLPSDVAWDRVGRSWD*
Ga0075327_116028223300014272Natural And Restored WetlandsSTKPAPPCPKCGSQRVERLLSQINTEWLPSDVAWDRVGRSWD*
Ga0075331_101617933300014310Natural And Restored WetlandsRFEEYLATSTKPAPPCPKCGGDRVERLLSKINTEWLPSDVAWDRVGRSWD*
Ga0137409_1100338013300015245Vadose Zone SoilTSDKPAPPCPKCGSADVTRLMSSINTEWLPSDVAWDRVGRSWD*
Ga0182039_1023584443300016422SoilPPCPRCGSADVTRLWSTINTEWLPSDVAWDRVGRSWD
Ga0134083_1034961913300017659Grasslands SoilSPPCPACGSEKVERLMSRISTEWLPSDVNWHRTGSSWD
Ga0187786_1034117323300017944Tropical PeatlandPCPKCGAKKVERLFSRINTEWLPSDIAWDRVGRSWD
Ga0187823_1039114423300017993Freshwater SedimentCNERFEEYLSSSEKPSPPCPACGAEKVERLMSRISTEWLPSDVNWHRAGSSWD
Ga0184619_1037596123300018061Groundwater SedimentFEEFLSSSTKPDPPCPKCSAKAVERLVSRINTEWLPSDVAWDRVGRSWD
Ga0184637_1023735633300018063Groundwater SedimentCPKCGSAEVARLFSTINTEWLPSDVAWDRVGRSWD
Ga0184639_1017629423300018082Groundwater SedimentAPPCPKCGSADVERLLSTINTEWLPSDVAWDRVGRSWD
Ga0190272_1102012413300018429SoilERFEELLSTTDKPAPPCPQCGSVNVTRLLSQINTEWLPSDVAWDRVGRSWD
Ga0066655_1100819613300018431Grasslands SoilQCETRFEEFLSSSTKPAPACPNCGASEAKRLMSTISTEWLPSDVAWDRVGRSFD
Ga0066667_1085811413300018433Grasslands SoilEYLSGSTKPSPPCPACGSPAVERLMSMVSTEWLPSDVNWHRAGSSWD
Ga0190268_1229081123300018466SoilTLSTNPAPPCPKCGSEKVERKLSRINTEWLPGDVAWDRVGRSWD
Ga0190270_1215078913300018469SoilKPAPACPSCKSPKVERLISKINTEWLPSDVAWDRVGRSWE
Ga0190274_1228265213300018476SoilCGERFEEFLTVSTKPAPPCPKCGGAKVERLLSRINTEWLPSDVAWDRVGRSWD
Ga0180115_101288023300019257Groundwater SedimentEYLSTSDKPAPPCPKCGSAEVARLFSTINTEWLPSDVAWDRVGRSWD
Ga0163150_1027380513300020195Freshwater Microbial MatEYLKSSTAEAPPCPKCASTEVTRLWSRINTEWLPSDVSWDRVGRSWD
Ga0179596_1071779823300021086Vadose Zone SoilFEEFLSLSTKPSPPCPSCGSETVERLMSTVSTEWLPSDVNWHRAGSSWD
(restricted) Ga0224722_122658513300021518Freshwater SedimentSPKPPCPKCGRAEVERLWSTINTEWLPSDVAWDRVGRTWD
Ga0247776_1032322023300023275Plant LitterLSTSDKPAPPCPTCGSAKVERLLSRINTEWLPSDVAWDRVGRSWD
Ga0209520_1012080613300025319SoilSDKPAPPCPKCGSAVVVRLFSSINTEWLPSDVAWDRVGRSWD
Ga0210114_105880823300025795Natural And Restored WetlandsMPIQDLTTPCPKCGGEKVERLLSKINTEWLPSDVAWDRVGRSWD
Ga0207653_1027190113300025885Corn, Switchgrass And Miscanthus RhizosphereFLSLSTKPAPPCPKCGSKKVTRLWSRINTEWMPSDVAWDRVGRSWD
Ga0207688_1015336513300025901Corn, Switchgrass And Miscanthus RhizosphereFLSLSTKPAPPCPKCGSKKVTRLWSRINTEWMPSDVAWDRVGRTWD
Ga0207684_1063430233300025910Corn, Switchgrass And Miscanthus RhizosphereSDKPAPPCPKCGARKVTRLFSTINTEWLPSDVAWDRVGRSWE
Ga0207649_1045442923300025920Corn RhizosphereTKPAPPCPKCGSKKVTRAWSRINTEWLPSDVAWDRVGRSWD
Ga0207650_1125197813300025925Switchgrass RhizosphereLATSTKPAPPCPACGAKKVERLLSRINTEWLPSDVNWHRVGSSWD
Ga0207690_1123074613300025932Corn RhizosphereCDEKFEEYLATSTKPAPPCPACGAKKVERLLSRINTEWLPSDVNWHRVGSSWD
Ga0207712_1015217013300025961Switchgrass RhizosphereAPPCPKCGNKKVTRMWSRINTEWLPSDVAWDRVGRSWD
Ga0207668_1184262213300025972Switchgrass RhizosphereTKPAPPCPKCGGGNVERLLSKINTEWLPSDVAWDRVGRSWD
Ga0208652_103679623300026033Natural And Restored WetlandsSTKPAPPCPKCGSDEVTRLLSRINTEWLPSDVAWDRVGRSWD
Ga0207639_1135987023300026041Corn RhizosphereFEEFLSTSDKPAPPCPTCGSAKVERLLSRINTEWLPSDVAWDRVGRSWD
Ga0207639_1191304523300026041Corn RhizosphereVGVCEEKFEEYLSTSDKPAPPCPKCGAKKVERLWSSINTEWMPSDVAWDRVGRTF
Ga0207641_1034810213300026088Switchgrass RhizospherePCPNCGAKKVERLWSSINTEWMPSDVAWDRVGRSF
Ga0207674_1079250313300026116Corn RhizosphereEEFLSLSTKPAPPCPKCGSKKVTRLWSRINTEWMPSDVAWDRVGRTWD
Ga0209234_102565713300026295Grasslands SoilCPSCGSETVERLMSTVSTEWLPSDVNWHRAGSSWD
Ga0209068_1038416113300027894WatershedsEEYLSTSDKPAPPCPKCGSGDVIRLLSSINTEWLPSDVAWDRVGRSWD
Ga0209853_105679113300027961Groundwater SandRFEEFLSNSTKPAPPCPKCGAGNPTRLLSSINTEWQPSDVAWDRVGRSWD
Ga0247689_100996913300028281SoilTKPAPPCPKCGSKKVTRMWSRINTEWLPSDVAWDRVGRSWD
Ga0268264_1199616723300028381Switchgrass RhizosphereSLSTKPAPPCPKCGSKKVTRMWSRINTEWLPSDVAWDRVGRSWD
Ga0247822_1029899533300028592SoilPPCPKCGAKKPERLWSSINTEWLPSDVAWDRVGRSWD
Ga0247820_1062528613300028597SoilRFEEYLSTSDKPAPACPKCGSEKVQRRLSQINTEWLPSDVAWDRVGRSWD
Ga0247820_1132389113300028597SoilRFEEYLSTSTKPSPPCPKCGGAKVERLLSKINTEWLPSDVAWDRVGRSWD
Ga0307309_1018014923300028714SoilSDKPAPPCPKCKAKKVERLWSTINTEWLPSDVAWDRVGRSFE
Ga0310887_1065412823300031547SoilSTSTKPAPPCPKCGGDKSERLLSRINTEWLPSDVAWDRVGRSWD
Ga0318573_1077266513300031564SoilSDKPAPPCPKCGSTDVERLWSTINTEWLPSDVAWDRVGRSWD
Ga0318572_1047298633300031681SoilSTSDKPTPPCPRCGSADVTRLWSTINTEWLPSDVAWDRVGRSWD
Ga0318501_1051403923300031736SoilDKPTPPCPKCGSAGVTRLWSRINTEWLPSDVAWDRVGRSWD
Ga0307468_10094728313300031740Hardwood Forest SoilASCEARFEEYLSTSDKPAPPCPQCGGAEVARVYSAFATEWQPSDVNWHRAGSSWDR
Ga0318502_1010203313300031747SoilDKPKPPCPKCGSAGVTRLWSRINTEWLPSDVAWDRVGRSWD
Ga0318502_1096255323300031747SoilEFEEYLSTSDKPTPPCPKCGSAGVTRLWSRINTEWLPSDVAWDRVGRSWD
Ga0318526_1017948913300031769SoilCGACEEKYEEYLSTSDKPAPPCPKCGSTDVERLWSTINTEWLPSDVAWDRVGRSWD
Ga0318546_1082147023300031771SoilSTSDKPTPPCPKCGSTDVERLWSTINTEWLPSDVAWDRVGRSWD
Ga0318563_1070459223300032009SoilCDKCETEFEEYLSTSDKPTPPCPKCGSAGVTRLWSRINTEWLPSDVAWDRVGRSWD
Ga0318569_1011222043300032010SoilEYLSTSDKPTPPCPRCGSADVTRLWSTINTEWLPSDVAWDRVGRSWD
Ga0318558_1020985813300032044SoilDKPTPPCPRCGSADVTRLWSTINTEWLPSDVAWDRVGRSWD
Ga0318514_1030135013300032066SoilYLSTSDKPTPPCPRCGSADVTRLWSTINTEWLPSDVAWDRVGRSWD
Ga0315275_1036302333300032401SedimentATCKERFEEYLAMSTSPKPPCPSCGSTAVERKLSRINTEWLPSDVAWDRVGRSWD
Ga0315273_1118563713300032516SedimentEYLAMSTSPEPPCPSCGSTAVERKLSRINTEWLPSDVAWDRVGRSWD
Ga0247829_1028123033300033550SoilSLTERGGAKVERLLSRINTEWLPSDVAWDRVGRSWD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.