| Basic Information | |
|---|---|
| Family ID | F068909 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LSLSTKPAPPCPKCGSKKVTRLFSRINTEWLPSDVAWDRVGRSWD |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.61 % |
| % of genes near scaffold ends (potentially truncated) | 98.39 % |
| % of genes from short scaffolds (< 2000 bps) | 98.39 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.581 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.677 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.452 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.097 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.22% β-sheet: 0.00% Coil/Unstructured: 91.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00561 | Abhydrolase_1 | 39.52 |
| PF09723 | Zn-ribbon_8 | 4.84 |
| PF12697 | Abhydrolase_6 | 4.03 |
| PF01177 | Asp_Glu_race | 4.03 |
| PF00211 | Guanylate_cyc | 2.42 |
| PF01522 | Polysacc_deac_1 | 1.61 |
| PF12802 | MarR_2 | 1.61 |
| PF16697 | Yop-YscD_cpl | 0.81 |
| PF00206 | Lyase_1 | 0.81 |
| PF00857 | Isochorismatase | 0.81 |
| PF13432 | TPR_16 | 0.81 |
| PF02515 | CoA_transf_3 | 0.81 |
| PF00296 | Bac_luciferase | 0.81 |
| PF12680 | SnoaL_2 | 0.81 |
| PF12762 | DDE_Tnp_IS1595 | 0.81 |
| PF13683 | rve_3 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 2.42 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.81 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.81 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.58 % |
| Unclassified | root | N/A | 2.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100779712 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300000955|JGI1027J12803_108939604 | Not Available | 519 | Open in IMG/M |
| 3300000956|JGI10216J12902_100335662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300000956|JGI10216J12902_100438444 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300004156|Ga0062589_102189453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300004156|Ga0062589_102562435 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005174|Ga0066680_10579556 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005329|Ga0070683_100575030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1078 | Open in IMG/M |
| 3300005332|Ga0066388_108396201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300005340|Ga0070689_101627867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300005344|Ga0070661_100447891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1027 | Open in IMG/M |
| 3300005365|Ga0070688_100255293 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300005440|Ga0070705_101801825 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005444|Ga0070694_100917648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300005713|Ga0066905_100852877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300005764|Ga0066903_102279763 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300005764|Ga0066903_104925811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300006028|Ga0070717_12134846 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300006057|Ga0075026_101048209 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300006354|Ga0075021_10410915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300006796|Ga0066665_10790401 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300006847|Ga0075431_102030474 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006914|Ga0075436_100987176 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300006954|Ga0079219_12200223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300007076|Ga0075435_101925353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300009012|Ga0066710_101285341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1135 | Open in IMG/M |
| 3300009090|Ga0099827_10032806 | All Organisms → cellular organisms → Bacteria | 3764 | Open in IMG/M |
| 3300009093|Ga0105240_11059762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Aeromicrobium | 864 | Open in IMG/M |
| 3300009094|Ga0111539_10613696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
| 3300009098|Ga0105245_10602890 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300009098|Ga0105245_12996658 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300009137|Ga0066709_104635401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300009148|Ga0105243_10207638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1722 | Open in IMG/M |
| 3300009156|Ga0111538_12191028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 694 | Open in IMG/M |
| 3300009174|Ga0105241_12443008 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009177|Ga0105248_10891988 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300009177|Ga0105248_13289716 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300009553|Ga0105249_10324881 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300009792|Ga0126374_11771592 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009814|Ga0105082_1085619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300009837|Ga0105058_1137114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300010359|Ga0126376_11817104 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300010398|Ga0126383_13045926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300010399|Ga0134127_12489970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300010938|Ga0137716_10228055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1084 | Open in IMG/M |
| 3300011003|Ga0138514_100063532 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300012010|Ga0120118_1164200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300012014|Ga0120159_1196841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300012211|Ga0137377_10658927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis jejuensis | 982 | Open in IMG/M |
| 3300012532|Ga0137373_10313147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1243 | Open in IMG/M |
| 3300012912|Ga0157306_10033609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
| 3300012961|Ga0164302_10377756 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300012971|Ga0126369_12536646 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300012986|Ga0164304_11657412 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300013105|Ga0157369_11727625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300013297|Ga0157378_12461886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300013306|Ga0163162_12768108 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300013307|Ga0157372_11208729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
| 3300013764|Ga0120111_1072213 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300013772|Ga0120158_10427207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300014150|Ga0134081_10183155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300014260|Ga0075307_1049920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 798 | Open in IMG/M |
| 3300014263|Ga0075324_1147939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300014272|Ga0075327_1160282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
| 3300014310|Ga0075331_1016179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1653 | Open in IMG/M |
| 3300015245|Ga0137409_11003380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300016422|Ga0182039_10235844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1482 | Open in IMG/M |
| 3300017659|Ga0134083_10349619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300017944|Ga0187786_10341173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 630 | Open in IMG/M |
| 3300017993|Ga0187823_10391144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300018061|Ga0184619_10375961 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300018063|Ga0184637_10237356 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300018082|Ga0184639_10176294 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300018429|Ga0190272_11020124 | Not Available | 792 | Open in IMG/M |
| 3300018431|Ga0066655_11008196 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300018433|Ga0066667_10858114 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300018466|Ga0190268_12290811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300018469|Ga0190270_12150789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
| 3300018476|Ga0190274_12282652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300019257|Ga0180115_1012880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300020195|Ga0163150_10273805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
| 3300021086|Ga0179596_10717798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| (restricted) 3300021518|Ga0224722_1226585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300023275|Ga0247776_10323220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300025319|Ga0209520_10120806 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300025795|Ga0210114_1058808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
| 3300025885|Ga0207653_10271901 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300025901|Ga0207688_10153365 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300025910|Ga0207684_10634302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
| 3300025920|Ga0207649_10454429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
| 3300025925|Ga0207650_11251978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300025932|Ga0207690_11230746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300025961|Ga0207712_10152170 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300025972|Ga0207668_11842622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300026033|Ga0208652_1036796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300026041|Ga0207639_11359870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300026041|Ga0207639_11913045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300026088|Ga0207641_10348102 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300026116|Ga0207674_10792503 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300026295|Ga0209234_1025657 | Not Available | 2237 | Open in IMG/M |
| 3300027894|Ga0209068_10384161 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300027961|Ga0209853_1056791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300028281|Ga0247689_1009969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
| 3300028381|Ga0268264_11996167 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300028592|Ga0247822_10298995 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300028597|Ga0247820_10625286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300028597|Ga0247820_11323891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300028714|Ga0307309_10180149 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031547|Ga0310887_10654128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300031564|Ga0318573_10772665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300031681|Ga0318572_10472986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
| 3300031736|Ga0318501_10514039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300031740|Ga0307468_100947283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Aeromicrobium | 752 | Open in IMG/M |
| 3300031747|Ga0318502_10102033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1591 | Open in IMG/M |
| 3300031747|Ga0318502_10962553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300031769|Ga0318526_10179489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300031771|Ga0318546_10821470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300032009|Ga0318563_10704592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300032010|Ga0318569_10112220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1238 | Open in IMG/M |
| 3300032044|Ga0318558_10209858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 952 | Open in IMG/M |
| 3300032066|Ga0318514_10301350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 847 | Open in IMG/M |
| 3300032401|Ga0315275_10363023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1623 | Open in IMG/M |
| 3300032516|Ga0315273_11185637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| 3300033550|Ga0247829_10281230 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.03% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.23% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.42% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014260 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021518 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR1_MetaG | Environmental | Open in IMG/M |
| 3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026033 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1007797122 | 3300000364 | Soil | LSTSDKPAPPCPKCGGKKVERLWSSINTEWMPSDVAWDRVGRTWD* |
| JGI1027J12803_1089396041 | 3300000955 | Soil | FEEYLSTSDKPAPPCPKCGGKKVERLWSKINTEWLPSDVAWDRVGRTWD* |
| JGI10216J12902_1003356623 | 3300000956 | Soil | KCEERFEEYLSTSDKPVPPCPKCGGKRVERLWSRINTEWLPSDVAWDRVGRSWD* |
| JGI10216J12902_1004384442 | 3300000956 | Soil | KCDERFEEYLSTSDKPAPPCPKCGGKKVERLWSSINTEWMPSDVAWDRVGRTWD* |
| Ga0062589_1021894532 | 3300004156 | Soil | CQERFEEYLSTSDKPAPPCPKCGSGDVERLLSRINTEWLPSDVAWDRVGRSWD* |
| Ga0062589_1025624352 | 3300004156 | Soil | PAPPCPKCKGKKIERLWSTINTEWMPSDVAWDRVGRSFE* |
| Ga0066680_105795562 | 3300005174 | Soil | TKPSPPCPECGSESVLRLMSRINTEWLPSDVNWHRTGSSWD* |
| Ga0070683_1005750302 | 3300005329 | Corn Rhizosphere | LSMSTNPAPPCPKCKSKSVERLFSRINTEWLPSDVNWHRVGSSWD* |
| Ga0066388_1083962011 | 3300005332 | Tropical Forest Soil | SDKPAPPCPSCTSPKVERLLSRINTEWLPSDVAWDRVGRSWD* |
| Ga0070689_1016278672 | 3300005340 | Switchgrass Rhizosphere | KCEEKFEEYLSTSDKPAPPCPKCSAKKVERLWSSINTEWMPSDVAWDRVGRTF* |
| Ga0070661_1004478912 | 3300005344 | Corn Rhizosphere | EEFLSLSTKPAPPCPKCGSKKVTRAWSRINTEWLPSDVAWDRVGRSWD* |
| Ga0070688_1002552933 | 3300005365 | Switchgrass Rhizosphere | ARCQERFEEYLSTSDKPAPPCPKCGSGDVERLLSRINTEWLPSDVAWDRVGRSWD* |
| Ga0070705_1018018252 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LSSSEKPSPPCPACGAEKVERLMSRISTEWMPSDVNWHRTESSWD* |
| Ga0070694_1009176481 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LSTSEKPAPPCPACGAADVERILSSFRTEWLPSDVNWHRTGSSWD* |
| Ga0066905_1008528772 | 3300005713 | Tropical Forest Soil | CDEQFEEYLSTSDKPAPPCPKCGAKKVERLWSRINTEWLPSDVAWDRVGRTWD* |
| Ga0066903_1022797631 | 3300005764 | Tropical Forest Soil | CPKCGSKKVTRLFSRINTEWMPSDVAWDRVGRTWD* |
| Ga0066903_1049258111 | 3300005764 | Tropical Forest Soil | RFEEYLSTSDKPAPPCPKCGSGDVERLLSRINTEWLPSDVAWDRVGRSWD* |
| Ga0070717_121348462 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | CDTRFEEFLSLSTEPSPPCPSCGSETVERLMSTVSTEWLPSDVNWHRAGSSWD* |
| Ga0075026_1010482092 | 3300006057 | Watersheds | HERFEEFLTLSTNPPPPCPTCGSAKVERKLSNINTEWLPSDVAWDRVGRSWD* |
| Ga0075021_104109151 | 3300006354 | Watersheds | FEEYLSTSDKPAPPCPKCGSAKVTRLWSTINTEWLPSDVAWDRVGRSWD* |
| Ga0066665_107904011 | 3300006796 | Soil | TKPAPPCPECGSKKVKRLWSQISTEWLPSDVDWDRVGRKWD* |
| Ga0075431_1020304742 | 3300006847 | Populus Rhizosphere | APPCPKCGSENVTRLMSRISTEWMPSDVAWDRVGRQWD* |
| Ga0075436_1009871762 | 3300006914 | Populus Rhizosphere | KCDEQFEEFLSLSTKPAPPCPKCGNKKVTRVWSRINTEWLPSDVAWDRVGRSWD* |
| Ga0079219_122002232 | 3300006954 | Agricultural Soil | YLSTSDKPAPPCPKCGAKKVERLWSSINTEWMPSDVAWDRVGRSF* |
| Ga0075435_1019253531 | 3300007076 | Populus Rhizosphere | ERFEEFLSSSTKPAPPCPKCGSENVTRLMSRISTEWMPSDVAWDRVGRKWD* |
| Ga0066710_1012853411 | 3300009012 | Grasslands Soil | PCPECGAKKVTRLWSPIRTEWLPSDVAWDRVGRSWD |
| Ga0099827_100328066 | 3300009090 | Vadose Zone Soil | APPCPKCGATVVEKLMSRINTEWLPSDVAWDRVGRSWD* |
| Ga0105240_110597622 | 3300009093 | Corn Rhizosphere | FLSLSTKPAPPCPKCGAMKVKRLFSRINTEWLPSDVAWDRVGRSWD* |
| Ga0111539_106136963 | 3300009094 | Populus Rhizosphere | FEEFLSTSDKPAPPCPTCGAAKVERLLSRINTEWLPSDVAWDRVGRSWD* |
| Ga0105245_106028903 | 3300009098 | Miscanthus Rhizosphere | CPKCGNKKVTRMWSRINTEWLPSDVAWDRVGRSWD* |
| Ga0105245_129966581 | 3300009098 | Miscanthus Rhizosphere | LSLSTKPAPPCPKCGAMKVKRLFSRINTEWLPSDVAWDRVGRSWD* |
| Ga0066709_1046354012 | 3300009137 | Grasslands Soil | RGTGCEERYGEYRPQTTNPTPPCPKCGSKKVERLWSPIRTEWLPSDVAWDRVGRSWD* |
| Ga0105243_102076381 | 3300009148 | Miscanthus Rhizosphere | LSLSTKPAPPCPKCGNKKVTRMWSRINTEWLPSDVAWDRVGRSWD* |
| Ga0111538_121910281 | 3300009156 | Populus Rhizosphere | FEEYLSTSTKPSPPCPKCGAPDPARVWSTISTEWLPSDVAWDRVNRSWD* |
| Ga0105241_124430081 | 3300009174 | Corn Rhizosphere | KPAPPCPKCGAKKVERLWSSINTEWMPSDVAWDRVGRSF* |
| Ga0105248_108919882 | 3300009177 | Switchgrass Rhizosphere | KPAPPCPKCGSKKVTRLWSRINTEWMPSDVAWDRVGRTWD* |
| Ga0105248_132897161 | 3300009177 | Switchgrass Rhizosphere | KCEEKFEEYLSTSDKPAPPCPQCGTKKVERLWSSINTEWMPSDVAWDRVGRTF* |
| Ga0105249_103248811 | 3300009553 | Switchgrass Rhizosphere | PCPKCGSKKVTRLWSRINTEWMPSDVAWDRVGRTWD* |
| Ga0126374_117715921 | 3300009792 | Tropical Forest Soil | LSLSTKPAPPCPKCGSKKVTRLFSRINTEWLPSDVAWDRVGRSWD* |
| Ga0105082_10856192 | 3300009814 | Groundwater Sand | FEEFLSTSDKPPPPCPKCGSEEVQRKLSSFSTEWLPSDVAWDRVGRSWD* |
| Ga0105058_11371141 | 3300009837 | Groundwater Sand | SDKPAPPCPECGSAEVARLMSTINTEWLPSDVAWDRVGRSWD* |
| Ga0126376_118171042 | 3300010359 | Tropical Forest Soil | STSDKPTPPCPSCGSTEVARLWSTINTEWLPSDVAWDRVGRSWD* |
| Ga0126383_130459262 | 3300010398 | Tropical Forest Soil | SLSTKPAPPCPTCGGKKVERLWSPINTEWLPSDVNWHRTSSSWD* |
| Ga0134127_124899701 | 3300010399 | Terrestrial Soil | CDERFEEYLSTSTKPKPPCPKCGAKSVERQWSSINTEWLPSDVAWDRVGRTWD* |
| Ga0137716_102280552 | 3300010938 | Hot Spring Fe-Si Sediment | PAPPCPRCGKEGVERLWSPISTEWLPGDVAWDRVGRKWD* |
| Ga0138514_1000635321 | 3300011003 | Soil | DKPTPPCPKCKSKSVERLWSSINTEWLPSDVAWDRVGRSWD* |
| Ga0120118_11642002 | 3300012010 | Permafrost | LMSSTKPSPPCPKCGAKAIERLMSRINTEWLPSDVAWDRVGRSWD* |
| Ga0120159_11968412 | 3300012014 | Permafrost | TSERPTPPCPKCKSADVTRLMSSINTEWLPSDVNWHRMSSSWD* |
| Ga0137377_106589272 | 3300012211 | Vadose Zone Soil | TKPSPPCPKCGTKAVERLMSRINTEWLPSDVAWDRVGRSWD* |
| Ga0137373_103131474 | 3300012532 | Vadose Zone Soil | DQCQERFEELLSSSTKPAPSCPKCGAENPTRLFSRINTEWLPSDVAWDRVGRSWD* |
| Ga0157306_100336093 | 3300012912 | Soil | KFEEFLSTSDKPAPPCPTCGSAKVERLLSRINTEWLPSDVAWDRVGRSWD* |
| Ga0164302_103777562 | 3300012961 | Soil | EYLSTSDKAAPPCPKCGAKKVERLWSSINTEWLPSDVAWDRVGRSF* |
| Ga0126369_125366461 | 3300012971 | Tropical Forest Soil | LALSTKPAPPCPKCGSKKVTRMWSRINTEWLPSDVAWDRVGRTWD* |
| Ga0164304_116574121 | 3300012986 | Soil | APPCPKCGAKKVERLWSSINTEWMPSDVAWDRVGRSF* |
| Ga0157369_117276252 | 3300013105 | Corn Rhizosphere | EFLSLSTKPAPPCPKCGNKKVTRVWSRINTEWLPSDVAWDRVGRSWD* |
| Ga0157378_124618862 | 3300013297 | Miscanthus Rhizosphere | CDERFEEYLSTSTKPKPPCPKCGAKTVERQWSSINTEWLPSDVAWDRVGRTWD* |
| Ga0163162_127681082 | 3300013306 | Switchgrass Rhizosphere | PRCGSKKVTRLWSRINTEWMPSDVAWDRVGRTWD* |
| Ga0157372_112087291 | 3300013307 | Corn Rhizosphere | TKPAPPCPKCGNKKVTRVWSRINTEWLPSDVAWARVGRSWD* |
| Ga0120111_10722131 | 3300013764 | Permafrost | SPPCPKCGAKAIERLMSRINTEWLPSDVAWDRVGRSWD* |
| Ga0120158_104272072 | 3300013772 | Permafrost | EEYLATSERPAPPCPKCKSADVTRLMSSINTEWLPSDVNWHRMSSSWD* |
| Ga0134081_101831551 | 3300014150 | Grasslands Soil | PKCGAKKVERLWSRINTDWLPSDVAWDRVGRTWD* |
| Ga0075307_10499201 | 3300014260 | Natural And Restored Wetlands | TLSTNDAPPCPKCGSEDVTRLFSPITTEWLPSDVAWDRVGRSWD* |
| Ga0075324_11479391 | 3300014263 | Natural And Restored Wetlands | PKCGGDKVERLLSKINSEWLPSDVAWDRVGRSWD* |
| Ga0075327_11602822 | 3300014272 | Natural And Restored Wetlands | STKPAPPCPKCGSQRVERLLSQINTEWLPSDVAWDRVGRSWD* |
| Ga0075331_10161793 | 3300014310 | Natural And Restored Wetlands | RFEEYLATSTKPAPPCPKCGGDRVERLLSKINTEWLPSDVAWDRVGRSWD* |
| Ga0137409_110033801 | 3300015245 | Vadose Zone Soil | TSDKPAPPCPKCGSADVTRLMSSINTEWLPSDVAWDRVGRSWD* |
| Ga0182039_102358444 | 3300016422 | Soil | PPCPRCGSADVTRLWSTINTEWLPSDVAWDRVGRSWD |
| Ga0134083_103496191 | 3300017659 | Grasslands Soil | SPPCPACGSEKVERLMSRISTEWLPSDVNWHRTGSSWD |
| Ga0187786_103411732 | 3300017944 | Tropical Peatland | PCPKCGAKKVERLFSRINTEWLPSDIAWDRVGRSWD |
| Ga0187823_103911442 | 3300017993 | Freshwater Sediment | CNERFEEYLSSSEKPSPPCPACGAEKVERLMSRISTEWLPSDVNWHRAGSSWD |
| Ga0184619_103759612 | 3300018061 | Groundwater Sediment | FEEFLSSSTKPDPPCPKCSAKAVERLVSRINTEWLPSDVAWDRVGRSWD |
| Ga0184637_102373563 | 3300018063 | Groundwater Sediment | CPKCGSAEVARLFSTINTEWLPSDVAWDRVGRSWD |
| Ga0184639_101762942 | 3300018082 | Groundwater Sediment | APPCPKCGSADVERLLSTINTEWLPSDVAWDRVGRSWD |
| Ga0190272_110201241 | 3300018429 | Soil | ERFEELLSTTDKPAPPCPQCGSVNVTRLLSQINTEWLPSDVAWDRVGRSWD |
| Ga0066655_110081961 | 3300018431 | Grasslands Soil | QCETRFEEFLSSSTKPAPACPNCGASEAKRLMSTISTEWLPSDVAWDRVGRSFD |
| Ga0066667_108581141 | 3300018433 | Grasslands Soil | EYLSGSTKPSPPCPACGSPAVERLMSMVSTEWLPSDVNWHRAGSSWD |
| Ga0190268_122908112 | 3300018466 | Soil | TLSTNPAPPCPKCGSEKVERKLSRINTEWLPGDVAWDRVGRSWD |
| Ga0190270_121507891 | 3300018469 | Soil | KPAPACPSCKSPKVERLISKINTEWLPSDVAWDRVGRSWE |
| Ga0190274_122826521 | 3300018476 | Soil | CGERFEEFLTVSTKPAPPCPKCGGAKVERLLSRINTEWLPSDVAWDRVGRSWD |
| Ga0180115_10128802 | 3300019257 | Groundwater Sediment | EYLSTSDKPAPPCPKCGSAEVARLFSTINTEWLPSDVAWDRVGRSWD |
| Ga0163150_102738051 | 3300020195 | Freshwater Microbial Mat | EYLKSSTAEAPPCPKCASTEVTRLWSRINTEWLPSDVSWDRVGRSWD |
| Ga0179596_107177982 | 3300021086 | Vadose Zone Soil | FEEFLSLSTKPSPPCPSCGSETVERLMSTVSTEWLPSDVNWHRAGSSWD |
| (restricted) Ga0224722_12265851 | 3300021518 | Freshwater Sediment | SPKPPCPKCGRAEVERLWSTINTEWLPSDVAWDRVGRTWD |
| Ga0247776_103232202 | 3300023275 | Plant Litter | LSTSDKPAPPCPTCGSAKVERLLSRINTEWLPSDVAWDRVGRSWD |
| Ga0209520_101208061 | 3300025319 | Soil | SDKPAPPCPKCGSAVVVRLFSSINTEWLPSDVAWDRVGRSWD |
| Ga0210114_10588082 | 3300025795 | Natural And Restored Wetlands | MPIQDLTTPCPKCGGEKVERLLSKINTEWLPSDVAWDRVGRSWD |
| Ga0207653_102719011 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | FLSLSTKPAPPCPKCGSKKVTRLWSRINTEWMPSDVAWDRVGRSWD |
| Ga0207688_101533651 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | FLSLSTKPAPPCPKCGSKKVTRLWSRINTEWMPSDVAWDRVGRTWD |
| Ga0207684_106343023 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SDKPAPPCPKCGARKVTRLFSTINTEWLPSDVAWDRVGRSWE |
| Ga0207649_104544292 | 3300025920 | Corn Rhizosphere | TKPAPPCPKCGSKKVTRAWSRINTEWLPSDVAWDRVGRSWD |
| Ga0207650_112519781 | 3300025925 | Switchgrass Rhizosphere | LATSTKPAPPCPACGAKKVERLLSRINTEWLPSDVNWHRVGSSWD |
| Ga0207690_112307461 | 3300025932 | Corn Rhizosphere | CDEKFEEYLATSTKPAPPCPACGAKKVERLLSRINTEWLPSDVNWHRVGSSWD |
| Ga0207712_101521701 | 3300025961 | Switchgrass Rhizosphere | APPCPKCGNKKVTRMWSRINTEWLPSDVAWDRVGRSWD |
| Ga0207668_118426221 | 3300025972 | Switchgrass Rhizosphere | TKPAPPCPKCGGGNVERLLSKINTEWLPSDVAWDRVGRSWD |
| Ga0208652_10367962 | 3300026033 | Natural And Restored Wetlands | STKPAPPCPKCGSDEVTRLLSRINTEWLPSDVAWDRVGRSWD |
| Ga0207639_113598702 | 3300026041 | Corn Rhizosphere | FEEFLSTSDKPAPPCPTCGSAKVERLLSRINTEWLPSDVAWDRVGRSWD |
| Ga0207639_119130452 | 3300026041 | Corn Rhizosphere | VGVCEEKFEEYLSTSDKPAPPCPKCGAKKVERLWSSINTEWMPSDVAWDRVGRTF |
| Ga0207641_103481021 | 3300026088 | Switchgrass Rhizosphere | PCPNCGAKKVERLWSSINTEWMPSDVAWDRVGRSF |
| Ga0207674_107925031 | 3300026116 | Corn Rhizosphere | EEFLSLSTKPAPPCPKCGSKKVTRLWSRINTEWMPSDVAWDRVGRTWD |
| Ga0209234_10256571 | 3300026295 | Grasslands Soil | CPSCGSETVERLMSTVSTEWLPSDVNWHRAGSSWD |
| Ga0209068_103841611 | 3300027894 | Watersheds | EEYLSTSDKPAPPCPKCGSGDVIRLLSSINTEWLPSDVAWDRVGRSWD |
| Ga0209853_10567911 | 3300027961 | Groundwater Sand | RFEEFLSNSTKPAPPCPKCGAGNPTRLLSSINTEWQPSDVAWDRVGRSWD |
| Ga0247689_10099691 | 3300028281 | Soil | TKPAPPCPKCGSKKVTRMWSRINTEWLPSDVAWDRVGRSWD |
| Ga0268264_119961672 | 3300028381 | Switchgrass Rhizosphere | SLSTKPAPPCPKCGSKKVTRMWSRINTEWLPSDVAWDRVGRSWD |
| Ga0247822_102989953 | 3300028592 | Soil | PPCPKCGAKKPERLWSSINTEWLPSDVAWDRVGRSWD |
| Ga0247820_106252861 | 3300028597 | Soil | RFEEYLSTSDKPAPACPKCGSEKVQRRLSQINTEWLPSDVAWDRVGRSWD |
| Ga0247820_113238911 | 3300028597 | Soil | RFEEYLSTSTKPSPPCPKCGGAKVERLLSKINTEWLPSDVAWDRVGRSWD |
| Ga0307309_101801492 | 3300028714 | Soil | SDKPAPPCPKCKAKKVERLWSTINTEWLPSDVAWDRVGRSFE |
| Ga0310887_106541282 | 3300031547 | Soil | STSTKPAPPCPKCGGDKSERLLSRINTEWLPSDVAWDRVGRSWD |
| Ga0318573_107726651 | 3300031564 | Soil | SDKPAPPCPKCGSTDVERLWSTINTEWLPSDVAWDRVGRSWD |
| Ga0318572_104729863 | 3300031681 | Soil | STSDKPTPPCPRCGSADVTRLWSTINTEWLPSDVAWDRVGRSWD |
| Ga0318501_105140392 | 3300031736 | Soil | DKPTPPCPKCGSAGVTRLWSRINTEWLPSDVAWDRVGRSWD |
| Ga0307468_1009472831 | 3300031740 | Hardwood Forest Soil | ASCEARFEEYLSTSDKPAPPCPQCGGAEVARVYSAFATEWQPSDVNWHRAGSSWDR |
| Ga0318502_101020331 | 3300031747 | Soil | DKPKPPCPKCGSAGVTRLWSRINTEWLPSDVAWDRVGRSWD |
| Ga0318502_109625532 | 3300031747 | Soil | EFEEYLSTSDKPTPPCPKCGSAGVTRLWSRINTEWLPSDVAWDRVGRSWD |
| Ga0318526_101794891 | 3300031769 | Soil | CGACEEKYEEYLSTSDKPAPPCPKCGSTDVERLWSTINTEWLPSDVAWDRVGRSWD |
| Ga0318546_108214702 | 3300031771 | Soil | STSDKPTPPCPKCGSTDVERLWSTINTEWLPSDVAWDRVGRSWD |
| Ga0318563_107045922 | 3300032009 | Soil | CDKCETEFEEYLSTSDKPTPPCPKCGSAGVTRLWSRINTEWLPSDVAWDRVGRSWD |
| Ga0318569_101122204 | 3300032010 | Soil | EYLSTSDKPTPPCPRCGSADVTRLWSTINTEWLPSDVAWDRVGRSWD |
| Ga0318558_102098581 | 3300032044 | Soil | DKPTPPCPRCGSADVTRLWSTINTEWLPSDVAWDRVGRSWD |
| Ga0318514_103013501 | 3300032066 | Soil | YLSTSDKPTPPCPRCGSADVTRLWSTINTEWLPSDVAWDRVGRSWD |
| Ga0315275_103630233 | 3300032401 | Sediment | ATCKERFEEYLAMSTSPKPPCPSCGSTAVERKLSRINTEWLPSDVAWDRVGRSWD |
| Ga0315273_111856371 | 3300032516 | Sediment | EYLAMSTSPEPPCPSCGSTAVERKLSRINTEWLPSDVAWDRVGRSWD |
| Ga0247829_102812303 | 3300033550 | Soil | SLTERGGAKVERLLSRINTEWLPSDVAWDRVGRSWD |
| ⦗Top⦘ |