| Basic Information | |
|---|---|
| Family ID | F068426 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MNTWDFVVSELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVHYA |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 70.97 % |
| % of genes near scaffold ends (potentially truncated) | 17.74 % |
| % of genes from short scaffolds (< 2000 bps) | 58.06 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (54.032 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (33.065 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.258 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (95.161 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.77% β-sheet: 0.00% Coil/Unstructured: 66.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF07728 | AAA_5 | 4.03 |
| PF13392 | HNH_3 | 3.23 |
| PF00166 | Cpn10 | 2.42 |
| PF08406 | CbbQ_C | 1.61 |
| PF02945 | Endonuclease_7 | 1.61 |
| PF01521 | Fe-S_biosyn | 0.81 |
| PF10902 | WYL_2 | 0.81 |
| PF16075 | DUF4815 | 0.81 |
| PF01370 | Epimerase | 0.81 |
| PF01467 | CTP_transf_like | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 2.42 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 1.61 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.00 % |
| Unclassified | root | N/A | 25.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000162|TB03JUN2009H_c006949 | All Organisms → Viruses → Predicted Viral | 1811 | Open in IMG/M |
| 3300000162|TB03JUN2009H_c010731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia elongata | 1280 | Open in IMG/M |
| 3300000177|TB18AUG2009H_c011652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 918 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1023846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB20 | 2734 | Open in IMG/M |
| 3300001837|RCM39_1006544 | Not Available | 2327 | Open in IMG/M |
| 3300001837|RCM39_1056358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 556 | Open in IMG/M |
| 3300001842|RCM30_1019580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 660 | Open in IMG/M |
| 3300001844|RCM35_1124040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 546 | Open in IMG/M |
| 3300002091|JGI24028J26656_1006401 | All Organisms → Viruses → Predicted Viral | 1688 | Open in IMG/M |
| 3300002092|JGI24218J26658_1003881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3331 | Open in IMG/M |
| 3300002092|JGI24218J26658_1036312 | Not Available | 582 | Open in IMG/M |
| 3300002933|G310J44882_10002956 | Not Available | 6689 | Open in IMG/M |
| 3300002933|G310J44882_10029785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1319 | Open in IMG/M |
| 3300003375|JGI26470J50227_1058697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 646 | Open in IMG/M |
| 3300003783|Ga0007850_1004276 | Not Available | 1292 | Open in IMG/M |
| 3300003785|Ga0007851_100107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6674 | Open in IMG/M |
| 3300004095|Ga0007829_10007431 | All Organisms → Viruses → Predicted Viral | 2109 | Open in IMG/M |
| 3300004095|Ga0007829_10030512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1041 | Open in IMG/M |
| 3300004693|Ga0065167_1091813 | Not Available | 528 | Open in IMG/M |
| 3300004805|Ga0007792_10041277 | Not Available | 1397 | Open in IMG/M |
| 3300004806|Ga0007854_10062439 | Not Available | 1797 | Open in IMG/M |
| 3300004807|Ga0007809_10122574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 780 | Open in IMG/M |
| 3300005662|Ga0078894_10353608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1330 | Open in IMG/M |
| 3300006071|Ga0007876_1032864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1431 | Open in IMG/M |
| 3300006072|Ga0007881_1012491 | All Organisms → Viruses → Predicted Viral | 2521 | Open in IMG/M |
| 3300006103|Ga0007813_1091931 | Not Available | 588 | Open in IMG/M |
| 3300006105|Ga0007819_1036996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → unclassified Acinetobacter → Acinetobacter sp. CIP 102529 | 1093 | Open in IMG/M |
| 3300006105|Ga0007819_1076530 | Not Available | 684 | Open in IMG/M |
| 3300006108|Ga0007862_1015636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1723 | Open in IMG/M |
| 3300006109|Ga0007870_1004838 | All Organisms → Viruses → Predicted Viral | 3034 | Open in IMG/M |
| 3300006109|Ga0007870_1100575 | Not Available | 564 | Open in IMG/M |
| 3300006114|Ga0007815_1077764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 661 | Open in IMG/M |
| 3300006119|Ga0007866_1023803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1249 | Open in IMG/M |
| 3300006123|Ga0007852_1002828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4240 | Open in IMG/M |
| 3300006128|Ga0007828_1003210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3620 | Open in IMG/M |
| 3300008107|Ga0114340_1189244 | Not Available | 707 | Open in IMG/M |
| 3300008259|Ga0114841_1119242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1107 | Open in IMG/M |
| 3300008267|Ga0114364_1003516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8505 | Open in IMG/M |
| 3300009082|Ga0105099_10055333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2098 | Open in IMG/M |
| 3300009151|Ga0114962_10022530 | All Organisms → Viruses → Predicted Viral | 4427 | Open in IMG/M |
| 3300009154|Ga0114963_10004631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9453 | Open in IMG/M |
| 3300009154|Ga0114963_10033029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3401 | Open in IMG/M |
| 3300009158|Ga0114977_10000145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 45461 | Open in IMG/M |
| 3300009158|Ga0114977_10011335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5652 | Open in IMG/M |
| 3300009158|Ga0114977_10035503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3120 | Open in IMG/M |
| 3300009159|Ga0114978_10009389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7604 | Open in IMG/M |
| 3300009164|Ga0114975_10034430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3026 | Open in IMG/M |
| 3300009164|Ga0114975_10065310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2127 | Open in IMG/M |
| 3300009180|Ga0114979_10112328 | Not Available | 1680 | Open in IMG/M |
| 3300009180|Ga0114979_10415105 | Not Available | 786 | Open in IMG/M |
| 3300009182|Ga0114959_10013086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5586 | Open in IMG/M |
| 3300009184|Ga0114976_10157258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1270 | Open in IMG/M |
| 3300009184|Ga0114976_10556075 | All Organisms → Viruses | 586 | Open in IMG/M |
| 3300009184|Ga0114976_10556078 | All Organisms → Viruses | 586 | Open in IMG/M |
| 3300009502|Ga0114951_10106926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1585 | Open in IMG/M |
| 3300009684|Ga0114958_10092267 | Not Available | 1568 | Open in IMG/M |
| 3300009684|Ga0114958_10185863 | Not Available | 1042 | Open in IMG/M |
| 3300010158|Ga0114960_10002606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13978 | Open in IMG/M |
| 3300010158|Ga0114960_10013315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5543 | Open in IMG/M |
| 3300010334|Ga0136644_10008688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7151 | Open in IMG/M |
| 3300012663|Ga0157203_1007958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1855 | Open in IMG/M |
| 3300012663|Ga0157203_1022904 | All Organisms → Viruses | 903 | Open in IMG/M |
| 3300012663|Ga0157203_1033529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 716 | Open in IMG/M |
| 3300012664|Ga0157497_1000038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 30612 | Open in IMG/M |
| 3300012665|Ga0157210_1000510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15915 | Open in IMG/M |
| 3300013093|Ga0164296_1051004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1991 | Open in IMG/M |
| 3300013093|Ga0164296_1282950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300013094|Ga0164297_10174420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 848 | Open in IMG/M |
| 3300018815|Ga0187845_1167160 | Not Available | 713 | Open in IMG/M |
| 3300020711|Ga0214237_1032572 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300020711|Ga0214237_1037734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 530 | Open in IMG/M |
| 3300020712|Ga0214255_1011336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia elongata | 1185 | Open in IMG/M |
| 3300020714|Ga0214182_1040818 | Not Available | 611 | Open in IMG/M |
| 3300020715|Ga0214254_1047960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 518 | Open in IMG/M |
| 3300020724|Ga0214244_1061705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 510 | Open in IMG/M |
| 3300020731|Ga0214170_1003911 | All Organisms → Viruses | 3541 | Open in IMG/M |
| 3300020733|Ga0214172_1011589 | All Organisms → Viruses | 1645 | Open in IMG/M |
| 3300021074|Ga0194044_10235411 | Not Available | 705 | Open in IMG/M |
| 3300021131|Ga0214206_1014835 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 3300021136|Ga0214167_1023145 | Not Available | 1501 | Open in IMG/M |
| 3300021142|Ga0214192_1103659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia elongata | 777 | Open in IMG/M |
| 3300021519|Ga0194048_10029152 | All Organisms → Viruses → Predicted Viral | 2332 | Open in IMG/M |
| 3300022555|Ga0212088_10089683 | All Organisms → Viruses → Predicted Viral | 2900 | Open in IMG/M |
| 3300022555|Ga0212088_10683458 | Not Available | 615 | Open in IMG/M |
| 3300022602|Ga0248169_100454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 64723 | Open in IMG/M |
| 3300025353|Ga0208255_100002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 56201 | Open in IMG/M |
| 3300025353|Ga0208255_102460 | Not Available | 2018 | Open in IMG/M |
| 3300025353|Ga0208255_113293 | Not Available | 750 | Open in IMG/M |
| 3300025358|Ga0208504_1001573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4531 | Open in IMG/M |
| 3300025372|Ga0207957_1000473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9288 | Open in IMG/M |
| 3300025381|Ga0208871_1030591 | Not Available | 768 | Open in IMG/M |
| 3300025383|Ga0208250_1000273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17023 | Open in IMG/M |
| 3300025389|Ga0208257_1027066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 860 | Open in IMG/M |
| 3300025390|Ga0208743_1016261 | Not Available | 1145 | Open in IMG/M |
| 3300025390|Ga0208743_1038249 | Not Available | 679 | Open in IMG/M |
| 3300025391|Ga0208740_1039101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 673 | Open in IMG/M |
| 3300025391|Ga0208740_1056931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300025400|Ga0208387_1071251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 515 | Open in IMG/M |
| 3300025407|Ga0208378_1005209 | Not Available | 3053 | Open in IMG/M |
| 3300025417|Ga0208616_1003508 | All Organisms → Viruses → Predicted Viral | 2885 | Open in IMG/M |
| 3300025616|Ga0208613_1013317 | All Organisms → Viruses → Predicted Viral | 2135 | Open in IMG/M |
| 3300025777|Ga0208110_1021174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 689 | Open in IMG/M |
| 3300025779|Ga0208869_1039693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 556 | Open in IMG/M |
| 3300025789|Ga0208499_1001487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7021 | Open in IMG/M |
| 3300025789|Ga0208499_1011505 | All Organisms → Viruses → Predicted Viral | 1792 | Open in IMG/M |
| 3300027708|Ga0209188_1000612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33423 | Open in IMG/M |
| 3300027708|Ga0209188_1010313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5343 | Open in IMG/M |
| 3300027712|Ga0209499_1012728 | Not Available | 4184 | Open in IMG/M |
| 3300027712|Ga0209499_1107662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1052 | Open in IMG/M |
| 3300027733|Ga0209297_1000023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 169326 | Open in IMG/M |
| 3300027733|Ga0209297_1010122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4628 | Open in IMG/M |
| 3300027733|Ga0209297_1023254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2930 | Open in IMG/M |
| 3300027741|Ga0209085_1023800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2934 | Open in IMG/M |
| 3300027763|Ga0209088_10130253 | Not Available | 1127 | Open in IMG/M |
| 3300027777|Ga0209829_10019403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4042 | Open in IMG/M |
| 3300027896|Ga0209777_10749295 | Not Available | 690 | Open in IMG/M |
| 3300027969|Ga0209191_1026534 | All Organisms → Viruses → Predicted Viral | 2818 | Open in IMG/M |
| 3300027969|Ga0209191_1140621 | Not Available | 992 | Open in IMG/M |
| 3300028393|Ga0304728_1054124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1651 | Open in IMG/M |
| 3300031759|Ga0316219_1025364 | All Organisms → Viruses → Predicted Viral | 2734 | Open in IMG/M |
| 3300031786|Ga0315908_10116206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2163 | Open in IMG/M |
| 3300032560|Ga0316223_1086821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1130 | Open in IMG/M |
| 3300032753|Ga0316224_1222851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 612 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 33.06% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 26.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 11.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 4.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.23% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 3.23% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 2.42% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.42% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.61% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.81% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000162 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300000177 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300001837 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a | Environmental | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300001844 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
| 3300003785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006123 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012664 | Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
| 3300020711 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020712 | Freshwater microbial communities from Trout Bog Lake, WI - 03AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020714 | Freshwater microbial communities from Trout Bog Lake, WI - 14NOV2007 epilimnion | Environmental | Open in IMG/M |
| 3300020715 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUL2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020724 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021074 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17m | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021136 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300025353 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025390 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025399 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
| 3300025777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH13Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025779 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300032560 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009 | Environmental | Open in IMG/M |
| 3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009H_0069492 | 3300000162 | Freshwater | MNKWEFVVSELKSLQQGFEDHQAITELFVEQKLLFGYNIIKNKDQVYRA* |
| TB03JUN2009H_0107314 | 3300000162 | Freshwater | MNTWEFVIKELKSLQQVFADEQPIVELYVEQILLKGYKIIK* |
| TB18AUG2009H_0116522 | 3300000177 | Freshwater | MNTWDFVVSELKSLQQGFEDHQAITELFVEQKLLFGYNIIKNKDQVYRA* |
| TBL_comb48_EPIDRAFT_10238461 | 3300000439 | Freshwater | MEKWSFVISELKSLQQEFADDQPIVELFVEQKLLYGYNIIKSKDQVYKR* |
| RCM39_10065443 | 3300001837 | Marine Plankton | MNTWDFVVSELKSLQQEFKDHQAIAELFVEQKLLYGYNITKSKDQVYRLQNDKMLVVWSGTCIMVV* |
| RCM39_10563582 | 3300001837 | Marine Plankton | MNTWDFVVSELKSLQQEFNDDQPIVELFVEQKLLCGYNIIKSKDQVYRLQNAITLAV* |
| RCM30_10195802 | 3300001842 | Marine Plankton | MNTWDFVVSELKSLQQGFNDHQAIVELFVEQKLLYGYNIIKSKDQVYRLQNAKMLEV* |
| RCM35_11240401 | 3300001844 | Marine Plankton | VRMNTWDFVVSELKSLQQEFNDHQAIVELFVEQKLLYGYNIIKSKDQVYRLQNANPLEV* |
| JGI24028J26656_10064011 | 3300002091 | Lentic | LKSLQQGFEDHQAIAELFVEQKLLFGYNILKSKDQVYCS* |
| JGI24218J26658_10038811 | 3300002092 | Lentic | MNTWDFVVSELKSLQQGFEDHQAIAELFVEQKLLFGYNILKSKDQVYCS* |
| JGI24218J26658_10363121 | 3300002092 | Lentic | MSKWDFVIEELKSLQQGFEDNQAIAELFVEQKLLFGYNILKSKDQVYCS* |
| G310J44882_1000295612 | 3300002933 | Freshwater | MNTWDFVIKELKSLQQGFEDSQPIVELYVEQILLKGYKIIK* |
| G310J44882_100297852 | 3300002933 | Freshwater | MNTWQFVVSELKSLQQGFEDHQAITELFVEQKLLFGYNIIKNKDQVYRA* |
| JGI26470J50227_10586973 | 3300003375 | Freshwater | SELKSLQQGFQDHQAIAELFVEQKLLYGYNITKSKDQVYKR* |
| Ga0007850_10042766 | 3300003783 | Freshwater | MNTWDFVVSELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVHYA* |
| Ga0007851_1001079 | 3300003785 | Freshwater | MNTWDFVIKELKSLQQGFEDTQPIVELYVEQILLKGYKVIK* |
| Ga0007829_100074315 | 3300004095 | Freshwater | MNTWDFVIKELKSLQQGFADEQPIVELYVEQILLKGYKIIK* |
| Ga0007829_100305122 | 3300004095 | Freshwater | MNKWEFVVSELKSLQQGFQDHQAIAELFVEQKLLYGYNITKSKDQVYKR* |
| Ga0065167_10918131 | 3300004693 | Freshwater | MMFNRKNNMTTWDFVIKELKSLQQGFEDPQPIVELYVEQYLL |
| Ga0007792_100412773 | 3300004805 | Freshwater | MMFNRKNNMTTWDFVIKELKSLQQGFEDPQPIVELYVEQYLLRGYKITK* |
| Ga0007854_100624392 | 3300004806 | Freshwater | MMFNRKNNMNTWDFVIKELKSLQQGFEDPQPIVELYVEQYLLRGYKITK* |
| Ga0007809_101225743 | 3300004807 | Freshwater | MVCLIKENMEKWSFVISELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVHYA* |
| Ga0078894_103536084 | 3300005662 | Freshwater Lake | MNTWEFVVSELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVYKR* |
| Ga0007876_10328644 | 3300006071 | Freshwater | MVCLIKGNMNTWDFVVSELKSLQQEFADDQPIVELFVEQKLLCGYNIIKSKDQVHYA* |
| Ga0007881_10124914 | 3300006072 | Freshwater | MNTWDFVVSELKSLQQEFADDQPIVELFVEQKLLCGYNIIKSKDQVHYA* |
| Ga0007813_10919313 | 3300006103 | Freshwater | MNKWDFVVSELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVHYA* |
| Ga0007819_10369961 | 3300006105 | Freshwater | MNKWDFVVSELKSLQQGFEDHQAITELFVEQKLLYGYKIVDKKVYKA* |
| Ga0007819_10765304 | 3300006105 | Freshwater | MNKWEFVVSELKSLQQGFQDHQAIAELFVEQKLLYGYNITKSKDQV |
| Ga0007862_10156362 | 3300006108 | Freshwater | MNTWDFVVSELKSLQQGFDDHQAIVELFVEQKLLCGYNIIKSKDQVYHA* |
| Ga0007870_10048382 | 3300006109 | Freshwater | MMFNRKNNMNTWDFVIKELKSLQQGFEDPQPIVELYVEQILLRGYKVTK* |
| Ga0007870_11005752 | 3300006109 | Freshwater | MSTWDFVIKELKSLQQGFEDTQPIVELYVEQILLKGYKVDK* |
| Ga0007815_10777642 | 3300006114 | Freshwater | MVCLIKENMNTWDFVVSELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVHYA* |
| Ga0007866_10238031 | 3300006119 | Freshwater | WDFVVSELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVHYA* |
| Ga0007852_10028284 | 3300006123 | Freshwater | MEKWSFVISELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVHYA* |
| Ga0007828_100321012 | 3300006128 | Freshwater | MNKWEFVVSELKSLQQGFQDHQAIAELFVEQKLLYGYNIIKSKDQVYKR* |
| Ga0114340_11892442 | 3300008107 | Freshwater, Plankton | MNTWDFVVSELKSLQQGFEDHQAITELFVEQKLLRGYNIVKSKTK* |
| Ga0114841_11192423 | 3300008259 | Freshwater, Plankton | MNTWDFVISELKSLQQGFEDHQAITELFVEQKLLRGYNIVKSKTK* |
| Ga0114364_10035162 | 3300008267 | Freshwater, Plankton | MNTWEFVISELKSLQQGFEDHQAITELFVEQKLLRGYNIVKSKTK* |
| Ga0105099_100553332 | 3300009082 | Freshwater Sediment | MSKWDFVIKELKSLQQGFEDAQPIVELYVEQILLKGYKVNK* |
| Ga0114962_100225308 | 3300009151 | Freshwater Lake | MSKWNFVIKELKSLQQGFEDHQAIVELFVEQILLKHYKVNK* |
| Ga0114963_1000463121 | 3300009154 | Freshwater Lake | MSKWDFVVSELKSLQQGFEDHQAITELFVEQKLLCGYKIVDKKVYKA* |
| Ga0114963_100330292 | 3300009154 | Freshwater Lake | MSKWDFVIKELKSLQQGFEDHQAIVELYVEQILLKHYKVNK* |
| Ga0114977_1000014568 | 3300009158 | Freshwater Lake | MNTWQFVVSELKSLQQGFNDDQAIAELFVEQKLLRGYNITKSKDQVYHA* |
| Ga0114977_1001133512 | 3300009158 | Freshwater Lake | VNDRNRWKFVITELTALQRGFEDPQPIAELYVERILLCGYNITKSKDQVYHA* |
| Ga0114977_100355039 | 3300009158 | Freshwater Lake | VNTWEFVISELKSLQQGFEDNQAIAELFVEQKLLSGYNITKSKDQVYRF* |
| Ga0114978_1000938911 | 3300009159 | Freshwater Lake | MNTWDFVIKELKSLQQEYPDPQPIVELYVEQILLKGYKVIK* |
| Ga0114975_100344301 | 3300009164 | Freshwater Lake | MNKWDFVVSELKSLQQGIEDNQAIAELFVEQKLLYGYNITQSKDQVYRF* |
| Ga0114975_100653108 | 3300009164 | Freshwater Lake | MSKWDFVVLELKSLQKGFEDYQPITELFVEQKLLCGYNIIKSKDQVYTA* |
| Ga0114979_101123286 | 3300009180 | Freshwater Lake | MDTWQFVVNELKSLQQGFEDHQAITELFVEQKLLYGYNIIKSKDQVYTA* |
| Ga0114979_104151052 | 3300009180 | Freshwater Lake | MNKWDFVVSELKSLQQGFSDDQPIVELFVEQKLLCGYNIIKSKDQVYTA* |
| Ga0114959_1001308620 | 3300009182 | Freshwater Lake | MNTWEFVIKELKSLQQVFADEQPIVELFVEQILLKGYKIIK* |
| Ga0114976_101572585 | 3300009184 | Freshwater Lake | NDRNRWKFVITELTALQRGFEDPQPIAELYVERILLCGYNITKSKDQVYHA* |
| Ga0114976_105560754 | 3300009184 | Freshwater Lake | MNDRNRWKFVITELTALQRGFEDPQPIAELYVERILLCGYN |
| Ga0114976_105560783 | 3300009184 | Freshwater Lake | VNDRNRWKFVITELTALQRGFEDPQPIAELYVERILLCGYN |
| Ga0114951_101069262 | 3300009502 | Freshwater | MNKWQFVVSELKSLQQGFEDHQAIAELFVEQKLLFGYNILKSKDQVYCS* |
| Ga0114958_100922672 | 3300009684 | Freshwater Lake | MNKWDFVVSELKSLQQGFSDDQPIVELFVEQKLLFGYKILNKEIKRF* |
| Ga0114958_101858632 | 3300009684 | Freshwater Lake | MSKWDFVVLELKSLQKGFEDYQPITELFVEQKLLCGYNIIKNKDQVYTA* |
| Ga0114960_1000260637 | 3300010158 | Freshwater Lake | MNTWEFVIKELKSLQQGFADKQPIVELFVEQILLKGYKIIK* |
| Ga0114960_1001331513 | 3300010158 | Freshwater Lake | MNTWDFVVSELKSLQQEFQDNQPIIELFVEQKLLCGYNISKSKDQVYHV* |
| Ga0136644_1000868810 | 3300010334 | Freshwater Lake | MNTWDFVVSELKSLQQEFQDNQPIIELFVEQKLLCGYNIFKNKDQVYTA* |
| Ga0157203_10079581 | 3300012663 | Freshwater | MNTWDFVISELKSLQQEFNDDQPIVELFVEQKLLSGYNITKSKDQVYRF* |
| Ga0157203_10229041 | 3300012663 | Freshwater | MNTWDFVVSELKSLQQGFEDNQAIAELFVEQKLLCGYNIIKSKDQVYTA* |
| Ga0157203_10335291 | 3300012663 | Freshwater | MNTWDFVVSELKSLQQGFEDNQAIAELFVEQKLLCGYNIIKSK |
| Ga0157497_100003844 | 3300012664 | Freshwater | MNTWDFVVSELKSLQQEFQDDQPIVELFVEQKLLCGYNIIKSKDQVYKR* |
| Ga0157210_100051027 | 3300012665 | Freshwater | MNTWDFVISELKSLQQGFEDNQAIAELFVEQKLLCGYNIIKSKDQVYTA* |
| Ga0164296_10510047 | 3300013093 | Freshwater | MSKWDFVVSELKSLQQGFEDHQAITELFVEQKLLSGYNIIKSKDQVYSA* |
| Ga0164296_12829501 | 3300013093 | Freshwater | MVCLIKENMEKWSFVISELKSLQQGFEDHQAITELFVEQKLLYGYKIVDKKVYKA* |
| Ga0164297_101744202 | 3300013094 | Freshwater | MVCLIKENMEKWSFVISELKSLQQEFADDQPIVELFVEQKLLYGYNIIKSKDQVYKR* |
| Ga0187845_11671603 | 3300018815 | Freshwater | MSKWNFVIKELKSLQQGFEDHQAIVELFVEQILLKHYKVNK |
| Ga0214237_10325722 | 3300020711 | Freshwater | MNTWDFVIKELKSLQQGFEDSQPIVELYVEQILLKGYKIIK |
| Ga0214237_10377342 | 3300020711 | Freshwater | ENMEKWSFVISELKSLQQEFADDQPIVELFVEQKLLYGYNIIKSKDQVYKR |
| Ga0214255_10113363 | 3300020712 | Freshwater | MNTWEFVIKELKSLQQVFADEQPIVELYVEQILLKGYKIIK |
| Ga0214182_10408181 | 3300020714 | Freshwater | MVCLIKENMEKWSFVIRELKSLQQEFADDQPIVELFVEQKLLYGYNI |
| Ga0214254_10479601 | 3300020715 | Freshwater | MNKWEFVVSELKSLQQGFEDHQAITELFLEQKLLFGYNIIKNKDQVYRA |
| Ga0214244_10617052 | 3300020724 | Freshwater | MNKWDFVVSELKSLQQGFEDHQAITELFVEQKLLFGYNIIKNKDQVYRA |
| Ga0214170_100391112 | 3300020731 | Freshwater | MNKWEFVVSELKSLQQGFEDHQAITELFVEQKLLFGYNIIKSKDQVYKR |
| Ga0214172_10115892 | 3300020733 | Freshwater | MNKWEFVVSELKSLQQGFQDHQAIAELFVEQKLLFGYNITKSKDQVYTA |
| Ga0194044_102354112 | 3300021074 | Anoxic Zone Freshwater | MNTWDFVIKELKSLQQGFEDSQPIVELYVEQILLKGYKVTK |
| Ga0214206_10148352 | 3300021131 | Freshwater | MSKWDFVIKELKSLQQGFEDAQPIVELYVEQILLKGYKVDK |
| Ga0214167_10231455 | 3300021136 | Freshwater | MMFNRKNNMNTWDFVIKELKSLQQGFEDPQPIVELYVEQILLRGYKVTK |
| Ga0214192_11036593 | 3300021142 | Freshwater | MNTWEFVIKELKSLHQGFEDSQPIVELYVEQILLKGYKIIK |
| Ga0194048_100291525 | 3300021519 | Anoxic Zone Freshwater | MNKWDFVIKELKSLQQGFEDAQPIVELYVEQILLKGYKVTK |
| Ga0212088_100896834 | 3300022555 | Freshwater Lake Hypolimnion | MNKWQFVVSELKSLQQGFEDHQAIAELFVEQKLLFGYNILKSKDQVYCS |
| Ga0212088_106834582 | 3300022555 | Freshwater Lake Hypolimnion | MMFNNKGNMSMWEFTIKELKALQQGFEDHQAIVELYVEQILLKGYKVTK |
| Ga0248169_100454100 | 3300022602 | Freshwater | MVCLIKENMEKWSFVISELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVHYA |
| Ga0208255_10000211 | 3300025353 | Freshwater | MNTWDFVIKELKSLQQGFEDTQPIVELYVEQILLKGYKVIK |
| Ga0208255_1024602 | 3300025353 | Freshwater | MMFNRKNNMNTWDFVIKELKSLQQGFEDPQPIVELYVEQYLLRGYKITK |
| Ga0208255_1132933 | 3300025353 | Freshwater | VVSELKSLQQEFEDHQAITELFVEQILLKGYKVTK |
| Ga0208504_100157313 | 3300025358 | Freshwater | MNTWDFVVSELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVHYA |
| Ga0207957_100047315 | 3300025372 | Freshwater | MVCLIKENMNTWDFVVSELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVHYA |
| Ga0208871_10305912 | 3300025381 | Freshwater | MNKWDFVVSELKSLQQGFEDHQAITELFVEQKLLYGYKIVDKKVYKA |
| Ga0208250_100027331 | 3300025383 | Freshwater | MVCLIKGNMNTWDFVVSELKSLQQEFADDQPIVELFVEQKLLCGYNIIKSKDQVHYA |
| Ga0208257_10270662 | 3300025389 | Freshwater | MNTWDFVVLELKSLQKGFDDHQAIVELFVEQKLLCGYNIIKSKDQVYHA |
| Ga0208743_10162612 | 3300025390 | Freshwater | MNTWDFVIKELKSLQQGFEDPQPIVELYVEQILLRGYKVTK |
| Ga0208743_10382493 | 3300025390 | Freshwater | MSTWDFVIKELKSLQQGFEDTQPIVELYVEQILLKGYKVDK |
| Ga0208740_10391013 | 3300025391 | Freshwater | MNKWEFVVSELKSLQQGFQDHQAIAELFVEQKLLYGYNITKSKDQVYKR |
| Ga0208740_10569312 | 3300025391 | Freshwater | MNTWDFVIKELKSLQQGFADEQPIVELYVEQILLKGYKIIK |
| Ga0208107_10142331 | 3300025399 | Freshwater | MNKWEFVVSELKSLQQGFQDHQAIAELFVEQKLLYGYNI |
| Ga0208387_10712511 | 3300025400 | Freshwater | KSLQQEFADDQPIVELFVEQKLLCGYNIIKSKDQVHYA |
| Ga0208378_10052095 | 3300025407 | Freshwater | MNTWDFVVSELKSLQQEFADDQPIVELFVEQKLLCGYNIIKSKDQVHYA |
| Ga0208616_10035083 | 3300025417 | Freshwater | MNKWEFVVSELKSLQQGFQDHQAIAELFVEQKLLYGYNIIKSKDQVYKR |
| Ga0208613_10133172 | 3300025616 | Freshwater | MTTWDFVIKELKSLQQGFEDPQPIVELYVEQYLLRGYKITK |
| Ga0208110_10211741 | 3300025777 | Freshwater | VSELKSLQQGFEDHQAITELFVEQQLLCGYNIIKSKDQVYHG |
| Ga0208869_10396932 | 3300025779 | Freshwater | MNKWEFVVSELKSLQQGFEDHQAITELFVEQKLLFGYNIIKNKDQVYRA |
| Ga0208499_100148722 | 3300025789 | Freshwater | ISELKSLQQGFEDHQAITELFVEQKLLCGYNIIKSKDQVHYA |
| Ga0208499_10115057 | 3300025789 | Freshwater | MNKWDFVVSELKSLQQGFEDHQAITELFVEQKLLYGYDIIKSKDQVYTA |
| Ga0209188_100061257 | 3300027708 | Freshwater Lake | MNTWEFVIKELKSLQQGFADKQPIVELFVEQILLKGYKIIK |
| Ga0209188_101031313 | 3300027708 | Freshwater Lake | MNTWDFVVSELKSLQQEFQDNQPIIELFVEQKLLCGYNIFKNKDQVYTA |
| Ga0209499_101272813 | 3300027712 | Freshwater Lake | MNKWDFVVSELKSLQQGFSDDQPIVELFVEQKLLFGYKILNKEIKRF |
| Ga0209499_11076624 | 3300027712 | Freshwater Lake | MSKWDFVVLELKSLQKGFEDYQPITELFVEQKLLCGYNIIKNKDQVYTA |
| Ga0209297_1000023138 | 3300027733 | Freshwater Lake | MNTWQFVVSELKSLQQGFNDDQAIAELFVEQKLLRGYNITKSKDQVYHA |
| Ga0209297_101012213 | 3300027733 | Freshwater Lake | VNDRNRWKFVITELTALQRGFEDPQPIAELYVERILLCGYNITKSKDQVYHA |
| Ga0209297_10232543 | 3300027733 | Freshwater Lake | VNTWEFVISELKSLQQGFEDNQAIAELFVEQKLLSGYNITKSKDQVYRF |
| Ga0209085_10238003 | 3300027741 | Freshwater Lake | MSKWDFVVSELKSLQQGFEDHQAITELFVEQKLLCGYKIVDKKVYKA |
| Ga0209088_101302535 | 3300027763 | Freshwater Lake | MNTWDFVIKELKSLQQEYPDPQPIVELYVEQILLKGYKVIK |
| Ga0209829_100194039 | 3300027777 | Freshwater Lake | MSKWDFVIKELKSLRQGFEDHQAIVELFVEQILLKHYKVNK |
| Ga0209777_107492952 | 3300027896 | Freshwater Lake Sediment | MNTWDFVIKELKSLQQGFEDAQPIVELYVEQILLKGYKVTK |
| Ga0209191_102653410 | 3300027969 | Freshwater Lake | LKSLQKGFEDYQPITELFVEQKLLCGYNIIKSKDQVYTA |
| Ga0209191_11406216 | 3300027969 | Freshwater Lake | MNKWDFVVSELKSLQQGFSDDQPIVELFVEQKLLCG |
| Ga0304728_10541245 | 3300028393 | Freshwater Lake | MNTWDFVVSELKSLQQEFQDDQPIVELFVEQKLLCGYNISKSKDQVYHV |
| Ga0316219_10253645 | 3300031759 | Freshwater | MSKWDFVVSELKSLQQGFEDHQAITELFVEQKLLSGYNIIKSKDQVYSA |
| Ga0315908_101162064 | 3300031786 | Freshwater | MNTWEFVISELKSLQQGFEDHQAITELFVEQKLLRGYNIVKSKTK |
| Ga0316223_10868211 | 3300032560 | Freshwater | ELKSLQQGFEDHQAITELFVEQKLLSGYNIIKSKDQVYSA |
| Ga0316224_12228512 | 3300032753 | Freshwater | MSKWDFVVSVLKLLQQGFEDHQAITELFVEQKLLSGYNIIKSKDQVYSA |
| ⦗Top⦘ |