Basic Information | |
---|---|
Family ID | F068310 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 40 residues |
Representative Sequence | MSNPNMEAKVKELMELKRMKEELEAEIAAAEDEIKAVMGE |
Number of Associated Samples | 29 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.58 % |
% of genes near scaffold ends (potentially truncated) | 98.39 % |
% of genes from short scaffolds (< 2000 bps) | 83.87 % |
Associated GOLD sequencing projects | 13 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.484 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces (96.774 % of family members) |
Environment Ontology (ENVO) | Unclassified (99.194 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut (98.387 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF13443 | HTH_26 | 45.16 |
PF01381 | HTH_3 | 3.23 |
PF13744 | HTH_37 | 2.42 |
PF13280 | WYL | 1.61 |
PF09195 | Endonuc-BglII | 1.61 |
PF05534 | HicB | 0.81 |
PF02661 | Fic | 0.81 |
PF04221 | RelB | 0.81 |
PF08769 | Spo0A_C | 0.81 |
PF02920 | Integrase_DNA | 0.81 |
PF03466 | LysR_substrate | 0.81 |
PF12715 | Abhydrolase_7 | 0.81 |
PF14088 | DUF4268 | 0.81 |
PF00005 | ABC_tran | 0.81 |
PF13306 | LRR_5 | 0.81 |
PF01402 | RHH_1 | 0.81 |
PF14659 | Phage_int_SAM_3 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG1598 | Antitoxin component HicB of the HicAB toxin-antitoxin system | Defense mechanisms [V] | 0.81 |
COG3077 | Antitoxin component of the RelBE or YafQ-DinJ toxin-antitoxin module | Defense mechanisms [V] | 0.81 |
COG4226 | Predicted nuclease of the RNAse H fold, HicB family | General function prediction only [R] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.48 % |
Unclassified | root | N/A | 39.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300012979|Ga0123348_10856197 | Not Available | 514 | Open in IMG/M |
3300012983|Ga0123349_10357774 | Not Available | 1009 | Open in IMG/M |
3300018427|Ga0187903_10636515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 823 | Open in IMG/M |
3300018427|Ga0187903_10903094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 652 | Open in IMG/M |
3300018430|Ga0187902_10348222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1307 | Open in IMG/M |
3300018430|Ga0187902_10839238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 738 | Open in IMG/M |
3300018430|Ga0187902_11185556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 593 | Open in IMG/M |
3300018475|Ga0187907_10406991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1621 | Open in IMG/M |
3300018475|Ga0187907_10631175 | Not Available | 1200 | Open in IMG/M |
3300018475|Ga0187907_10903284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 940 | Open in IMG/M |
3300018475|Ga0187907_11331229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 720 | Open in IMG/M |
3300018475|Ga0187907_11526123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 656 | Open in IMG/M |
3300018475|Ga0187907_11764005 | Not Available | 594 | Open in IMG/M |
3300018475|Ga0187907_12201983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 512 | Open in IMG/M |
3300018493|Ga0187909_10155511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2834 | Open in IMG/M |
3300018493|Ga0187909_10206756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2331 | Open in IMG/M |
3300018493|Ga0187909_10424637 | Not Available | 1433 | Open in IMG/M |
3300018493|Ga0187909_10552587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1202 | Open in IMG/M |
3300018493|Ga0187909_10810560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 931 | Open in IMG/M |
3300018493|Ga0187909_11352703 | Not Available | 661 | Open in IMG/M |
3300018493|Ga0187909_11413015 | Not Available | 642 | Open in IMG/M |
3300018493|Ga0187909_11436940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp. Marseille-P2415 | 635 | Open in IMG/M |
3300018493|Ga0187909_11837857 | Not Available | 540 | Open in IMG/M |
3300018493|Ga0187909_11940076 | Not Available | 521 | Open in IMG/M |
3300018494|Ga0187911_10064079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 5688 | Open in IMG/M |
3300018494|Ga0187911_10624215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 1200 | Open in IMG/M |
3300018494|Ga0187911_11041238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 855 | Open in IMG/M |
3300018494|Ga0187911_11179170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 787 | Open in IMG/M |
3300018495|Ga0187908_10052631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 6769 | Open in IMG/M |
3300018495|Ga0187908_10173077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2829 | Open in IMG/M |
3300018495|Ga0187908_10255090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Pseudoflavonifractor → Pseudoflavonifractor phocaeensis | 2158 | Open in IMG/M |
3300018495|Ga0187908_10985101 | Not Available | 861 | Open in IMG/M |
3300018495|Ga0187908_11511141 | Not Available | 645 | Open in IMG/M |
3300018495|Ga0187908_11636198 | Not Available | 611 | Open in IMG/M |
3300018495|Ga0187908_11639747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 610 | Open in IMG/M |
3300018878|Ga0187910_10207734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2775 | Open in IMG/M |
3300018878|Ga0187910_10255992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2404 | Open in IMG/M |
3300018878|Ga0187910_10474386 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
3300018878|Ga0187910_11622437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 687 | Open in IMG/M |
3300018878|Ga0187910_12126498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 572 | Open in IMG/M |
3300018878|Ga0187910_12219841 | Not Available | 556 | Open in IMG/M |
3300019378|Ga0187901_10191626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1770 | Open in IMG/M |
3300019378|Ga0187901_10328514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1256 | Open in IMG/M |
3300019378|Ga0187901_10721112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 756 | Open in IMG/M |
3300019378|Ga0187901_10883815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 663 | Open in IMG/M |
3300019378|Ga0187901_11128035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 568 | Open in IMG/M |
3300019378|Ga0187901_11176172 | Not Available | 553 | Open in IMG/M |
3300022589|Ga0216346_10062118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3052 | Open in IMG/M |
3300022589|Ga0216346_10272318 | Not Available | 1108 | Open in IMG/M |
3300022589|Ga0216346_10656102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 599 | Open in IMG/M |
3300022601|Ga0216345_10214304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1257 | Open in IMG/M |
3300022601|Ga0216345_10569139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 624 | Open in IMG/M |
3300022654|Ga0216347_10094950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 2064 | Open in IMG/M |
3300022654|Ga0216347_10277150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1008 | Open in IMG/M |
3300022654|Ga0216347_10284391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 991 | Open in IMG/M |
3300022660|Ga0216342_10893780 | Not Available | 691 | Open in IMG/M |
3300022660|Ga0216342_11143331 | Not Available | 579 | Open in IMG/M |
3300022661|Ga0216339_10231702 | Not Available | 1775 | Open in IMG/M |
3300023371|Ga0216340_10223431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 2045 | Open in IMG/M |
3300023371|Ga0216340_10480608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1205 | Open in IMG/M |
3300023371|Ga0216340_11434203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 562 | Open in IMG/M |
3300024268|Ga0257090_10753445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1046 | Open in IMG/M |
3300024268|Ga0257090_11478965 | Not Available | 671 | Open in IMG/M |
3300024268|Ga0257090_11609754 | Not Available | 634 | Open in IMG/M |
3300024268|Ga0257090_11735886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 602 | Open in IMG/M |
3300024269|Ga0257076_10802963 | Not Available | 1027 | Open in IMG/M |
3300024269|Ga0257076_10842945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 996 | Open in IMG/M |
3300024269|Ga0257076_10880097 | Not Available | 970 | Open in IMG/M |
3300024269|Ga0257076_11577782 | Not Available | 668 | Open in IMG/M |
3300024269|Ga0257076_11692984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 638 | Open in IMG/M |
3300024269|Ga0257076_11792765 | Not Available | 614 | Open in IMG/M |
3300024270|Ga0257091_10184372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2710 | Open in IMG/M |
3300024270|Ga0257091_11062169 | Not Available | 853 | Open in IMG/M |
3300024270|Ga0257091_11174360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 798 | Open in IMG/M |
3300024270|Ga0257091_11787059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 601 | Open in IMG/M |
3300024270|Ga0257091_11792678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → Thermoanaerobacter → Thermoanaerobacter uzonensis | 600 | Open in IMG/M |
3300024272|Ga0257077_10091711 | All Organisms → cellular organisms → Bacteria | 4642 | Open in IMG/M |
3300024272|Ga0257077_10445541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1615 | Open in IMG/M |
3300024272|Ga0257077_11989684 | Not Available | 606 | Open in IMG/M |
3300024272|Ga0257077_12262946 | Not Available | 554 | Open in IMG/M |
3300024272|Ga0257077_12568702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 506 | Open in IMG/M |
3300024303|Ga0257089_11101520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 773 | Open in IMG/M |
3300024303|Ga0257089_11491691 | Not Available | 634 | Open in IMG/M |
3300024303|Ga0257089_11593670 | Not Available | 607 | Open in IMG/M |
3300028242|Ga0302102_10436072 | Not Available | 994 | Open in IMG/M |
3300028242|Ga0302102_10437279 | Not Available | 992 | Open in IMG/M |
3300028242|Ga0302102_10572410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 839 | Open in IMG/M |
3300028242|Ga0302102_10840524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 661 | Open in IMG/M |
3300028242|Ga0302102_11308251 | Not Available | 503 | Open in IMG/M |
3300028454|Ga0307245_1350222 | Not Available | 513 | Open in IMG/M |
3300028833|Ga0247610_11682016 | Not Available | 600 | Open in IMG/M |
3300029305|Ga0307249_10414810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3111 | Open in IMG/M |
3300029305|Ga0307249_10568578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2404 | Open in IMG/M |
3300029305|Ga0307249_10679101 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
3300029305|Ga0307249_10679244 | Not Available | 2082 | Open in IMG/M |
3300029305|Ga0307249_12538340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 717 | Open in IMG/M |
3300029305|Ga0307249_12629064 | Not Available | 697 | Open in IMG/M |
3300029305|Ga0307249_12991390 | Not Available | 627 | Open in IMG/M |
3300029305|Ga0307249_13032419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 620 | Open in IMG/M |
3300029305|Ga0307249_13037763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 619 | Open in IMG/M |
3300029305|Ga0307249_13055688 | Not Available | 616 | Open in IMG/M |
3300029305|Ga0307249_13481377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 552 | Open in IMG/M |
3300029705|Ga0224414_10379449 | Not Available | 2062 | Open in IMG/M |
3300029705|Ga0224414_11544293 | Not Available | 727 | Open in IMG/M |
3300029705|Ga0224414_11843368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CLA-AA-H283 | 637 | Open in IMG/M |
3300029705|Ga0224414_11917349 | Not Available | 618 | Open in IMG/M |
3300029705|Ga0224414_12084863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 579 | Open in IMG/M |
3300029705|Ga0224414_12169032 | Not Available | 562 | Open in IMG/M |
3300029705|Ga0224414_12251796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 545 | Open in IMG/M |
3300031086|Ga0074002_13887668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 531 | Open in IMG/M |
3300031555|Ga0318466_10357849 | Not Available | 3285 | Open in IMG/M |
3300031555|Ga0318466_10648024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2026 | Open in IMG/M |
3300031555|Ga0318466_10961067 | Not Available | 1473 | Open in IMG/M |
3300031555|Ga0318466_10964130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1469 | Open in IMG/M |
3300031555|Ga0318466_11056264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1364 | Open in IMG/M |
3300031555|Ga0318466_11326388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1132 | Open in IMG/M |
3300031555|Ga0318466_11438597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1059 | Open in IMG/M |
3300031555|Ga0318466_11706363 | Not Available | 919 | Open in IMG/M |
3300031555|Ga0318466_12167708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 748 | Open in IMG/M |
3300031555|Ga0318466_12429412 | Not Available | 678 | Open in IMG/M |
3300031555|Ga0318466_13216894 | Not Available | 531 | Open in IMG/M |
3300032167|Ga0224413_11050485 | Not Available | 1034 | Open in IMG/M |
3300032167|Ga0224413_11769891 | Not Available | 684 | Open in IMG/M |
3300032167|Ga0224413_12403954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 532 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Goat Feces | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces | 96.77% |
Fecal | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal | 1.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
Rumen | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300012979 | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung B1 Day 1 Metagenome | Host-Associated | Open in IMG/M |
3300012983 | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung C2 Day 2 Metagenome | Host-Associated | Open in IMG/M |
3300018427 | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Reed Canary Grass, Gen0, Rep 2, Chloramphenicol | Host-Associated | Open in IMG/M |
3300018430 | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Bagasse, Gen0, Rep 2, Chloramphenicol | Host-Associated | Open in IMG/M |
3300018475 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 1 | Host-Associated | Open in IMG/M |
3300018493 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 3 | Host-Associated | Open in IMG/M |
3300018494 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? diluted pellet 2 | Host-Associated | Open in IMG/M |
3300018495 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 2 | Host-Associated | Open in IMG/M |
3300018878 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? diluted pellet 1 | Host-Associated | Open in IMG/M |
3300019378 | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Alfalfa, Gen0, Rep 2, Chloramphenicol | Host-Associated | Open in IMG/M |
3300022589 | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Bagasse, Gen0, Rep 2, Chloramphenicol (v2) | Host-Associated | Open in IMG/M |
3300022601 | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Reed Canary Grass, Gen0, Rep 2, Chloramphenicol (v2) | Host-Associated | Open in IMG/M |
3300022654 | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Alfalfa, Gen0, Rep 2, Chloramphenicol (v2) | Host-Associated | Open in IMG/M |
3300022660 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 2 (v2) | Host-Associated | Open in IMG/M |
3300022661 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? diluted pellet 2 (v2) | Host-Associated | Open in IMG/M |
3300023371 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? diluted pellet 1 (v2) | Host-Associated | Open in IMG/M |
3300024268 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 2 Spades (v3) | Host-Associated | Open in IMG/M |
3300024269 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? diluted pellet 2 Spades (v3) | Host-Associated | Open in IMG/M |
3300024270 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 1 Spades (v3) | Host-Associated | Open in IMG/M |
3300024272 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? diluted pellet 1 Spades (v3) | Host-Associated | Open in IMG/M |
3300024303 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 3 Spades (v3) | Host-Associated | Open in IMG/M |
3300028242 | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Alfalfa, Gen0, Rep 2, Chloramphenicol (v3) | Host-Associated | Open in IMG/M |
3300028454 | Goat Fecal Pellet Co-assembly of all samples untreated with antibiotics | Host-Associated | Open in IMG/M |
3300028833 | Sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1742 DNA GHGhigh gp2 | Host-Associated | Open in IMG/M |
3300029305 | Goal Fecal Pellet Co-assembly of all three pellet samples and three diluted pellet samples. | Host-Associated | Open in IMG/M |
3300029705 | Goat Fecal Pellets diluted in media | Host-Associated | Open in IMG/M |
3300031086 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031555 | Goal Fecal Pellet Co-assembly of all three pellet samples and three diluted pellet samples.(v2) | Host-Associated | Open in IMG/M |
3300032167 | Three Goat Fecal Pellets | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0123348_108561971 | 3300012979 | Fecal | MSNPNMEAKVKELMELKRMKEELDAEIAAVEDEIKSVMG |
Ga0123349_103577741 | 3300012983 | Fecal | MEAKVKELMELKRMKEEIEAEIAAAEDDIKAVMGDEETLFAGA |
Ga0187903_106365151 | 3300018427 | Goat Feces | MSNPTMEAKVHELMELKRMKEEIEAEITAAEDAIKAVMGDEQFL |
Ga0187903_109030941 | 3300018427 | Goat Feces | MSNPNMEAKVKELMELKRMKEELEAEIAATEDEIKSVMGE |
Ga0187902_103482221 | 3300018430 | Goat Feces | MSNPNMETKVKELLELKRMKEELEAEITSMEDEIKSVMGE |
Ga0187902_108392381 | 3300018430 | Goat Feces | MSNPNMETKVKELLELKRMKEELEAEITSMEDEIKQVM |
Ga0187902_111855562 | 3300018430 | Goat Feces | MSNPNMEPKIKELLELKRMKEELEAEITSMEDEIKQVM |
Ga0187907_104069915 | 3300018475 | Goat Feces | MSNPNMEIKVKELLELKFMKEELEAEIAGMEDEIKAVMGDEET |
Ga0187907_106311753 | 3300018475 | Goat Feces | MSNPNMETKVKELMELKRMKEEIEAEIAAAEDEIKG |
Ga0187907_109032845 | 3300018475 | Goat Feces | MSNPNMEAKVKELMELKRMREELDAEISAAEDEIKN |
Ga0187907_113312292 | 3300018475 | Goat Feces | MCNPNMEAKVHELMELKRMKEELEAEIAAAEDAIKAVMGDEELLTAG |
Ga0187907_115261231 | 3300018475 | Goat Feces | MSNPNMESKVKELMELKRMKEEIEAEIAAAEDEIKK |
Ga0187907_117640051 | 3300018475 | Goat Feces | MSNPNLENKVKELLELKRMKEELEAEIAGMEDEIKAVMGDEETL |
Ga0187907_122019832 | 3300018475 | Goat Feces | MSNPNMENKVKELLELKRMKEELEAEIATMEDEIK |
Ga0187909_101555116 | 3300018493 | Goat Feces | MSNPNMESIVKELLELKRMKEELEAEITAMEDEIKKV |
Ga0187909_102067565 | 3300018493 | Goat Feces | MSNPSMEPKIKELLELKRMKEELEAEITSMEDEIK |
Ga0187909_104246374 | 3300018493 | Goat Feces | MSNPAMEAKVHELMELKRMKEELDSEIVQIEDEIKAVMGNEE |
Ga0187909_105525875 | 3300018493 | Goat Feces | MSNPNMEAKVKELMELKRMKEELEAEITAMEDEIKSVMGDEETLL |
Ga0187909_108105604 | 3300018493 | Goat Feces | MSNPTMEATIRELMELKRMKEELEAEISAAEDAIKAVMG |
Ga0187909_113527033 | 3300018493 | Goat Feces | MSNPNMETKVKELLELKRMKEELEAEITSMEDEIKQVMG |
Ga0187909_114130151 | 3300018493 | Goat Feces | MSNPNMEAKVKELMELKRMKEELEAEIAATEDEIKAVMGQEELLLAG |
Ga0187909_114369402 | 3300018493 | Goat Feces | MSNPNMESKIKELMELKRMKEEIEAEIAAAEDEIKSVMGGEETLLAG |
Ga0187909_118378572 | 3300018493 | Goat Feces | MSNPNMESQIKELLELKRMKEELEDAITAAEDGIKAAMGDEEILGVRKS |
Ga0187909_119400762 | 3300018493 | Goat Feces | MSNPNMEAKVKELMELKRMKEELEAEIAAAEDEIKSVMGEEE |
Ga0187911_1006407910 | 3300018494 | Goat Feces | MSNPNMESIVKELLELKRMKEELEAEITAMEDEIK |
Ga0187911_106242153 | 3300018494 | Goat Feces | MSNPNMETKVKELLELKRMKEELEAEITSMEDEIKSVMGK |
Ga0187911_110412383 | 3300018494 | Goat Feces | MSNPNMEPKIKELLELKRMKEELEAEITSMEDEIKQVMG |
Ga0187911_111791703 | 3300018494 | Goat Feces | MSNPNMENKVKELMELKRMKEELEAEIAGMEDEIKAVMGD |
Ga0187908_100526311 | 3300018495 | Goat Feces | MSNPTMEAKVHELMELKRMKEEIEAEITAAEDAIKAVMGDEQ |
Ga0187908_101730775 | 3300018495 | Goat Feces | MSNPNMEAKVKELMELKRLKEELEAEIAAAEDAIKAVMGDEELLL |
Ga0187908_102550901 | 3300018495 | Goat Feces | MSNPNMENKVKELMELKRMKEELEAEITSMEDEIKSV |
Ga0187908_109851014 | 3300018495 | Goat Feces | MSDHNMEPKIKELMELKRMREELEAEITTIEDEIKSRMGDE |
Ga0187908_115111412 | 3300018495 | Goat Feces | MSNPNMEAKVKELMELKRMKEEIEAEIAAAEDEIKGV |
Ga0187908_116361981 | 3300018495 | Goat Feces | MSNPNMETKVKELLELKRMKEELEAEIAGVEDEIKSVM |
Ga0187908_116397471 | 3300018495 | Goat Feces | MSNPNMEPKIKELLELKRMKEELEAEITSMEDEIKNVMGDEETLL |
Ga0187910_102077345 | 3300018878 | Goat Feces | MSNPNMESKIKELMELKRMKEEIEAEIAAAEDEIK |
Ga0187910_102559921 | 3300018878 | Goat Feces | MSNPNMETKVKELLELKRMKEELEAEITSMEDEIKQV |
Ga0187910_104743864 | 3300018878 | Goat Feces | MSDHNMEPKIKELIELKRMREELVAEITTIEDEIKSRMGTEE |
Ga0187910_116224372 | 3300018878 | Goat Feces | MSNPNMENKVKELMELKRMKEELEAEIAGMEDEIKAVMGDDETLLA |
Ga0187910_121264982 | 3300018878 | Goat Feces | MSNPNMEAKVKELMELKRMREELDAEISAAEDEIK |
Ga0187910_122198411 | 3300018878 | Goat Feces | MSNPNLEPKVKELMELRRMKEELDNEIASLEDEIKQAMGNEETLIAG |
Ga0187901_101916264 | 3300019378 | Goat Feces | MRNPNMEAKVHELMELKRMKEELEAEIAAAEDAIKAV |
Ga0187901_103285144 | 3300019378 | Goat Feces | MSNPNMESIVKELLELKRMKEELEAEITAMEDEIKKVMGDEELLT |
Ga0187901_107211123 | 3300019378 | Goat Feces | MSNPNMESKIKELMELKRMKEEIEAEIAAAEDEIKGVMGDE |
Ga0187901_108838153 | 3300019378 | Goat Feces | MSNPNMEIKVKELLELKRMKEELEAEIAGMEDEIKAVMGEEE |
Ga0187901_111280351 | 3300019378 | Goat Feces | MCNPNMEAKVHELMELKRMKEEIEAEIAAAEDAIKA |
Ga0187901_111761721 | 3300019378 | Goat Feces | MSNPNLENKVKELLELKRMKEELEAEIAGMEDEIKAVMGDEETLLA |
Ga0216346_100621181 | 3300022589 | Goat Feces | MSNPNLEPKIKELMELKRLREEVDAEIAGIEDEIKQGMGNEETLIAGAF |
Ga0216346_102723183 | 3300022589 | Goat Feces | MSNPNMEAKVKELMELKRMKEELEAEIAAAEDEIKAVMGE |
Ga0216346_106561022 | 3300022589 | Goat Feces | MSNPNLENKVKELLELKRMKEELEAEIAGMEDQIKAVMG |
Ga0216345_102143042 | 3300022601 | Goat Feces | MENKVKELMELKRMKEELEAEITSMEDEIKSVMGEEETLL |
Ga0216345_105691391 | 3300022601 | Goat Feces | MSNPNMETKVKELLELKRMKEELEAEITSMEDEIKQVMGE |
Ga0216347_100949506 | 3300022654 | Goat Feces | MSNPNMENKIKELMELKRMKEELEAEITSMEDEIKSVMG |
Ga0216347_102771501 | 3300022654 | Goat Feces | MSNPNMESKVKELMELKRMKEEIEAEIAAAEDEIKKV |
Ga0216347_102843913 | 3300022654 | Goat Feces | MSNPNMETKVKELLELKRMKEELEAEITSMEDEIKQ |
Ga0216342_108937801 | 3300022660 | Goat Feces | MSNPNMETKVKELLELKRMKEELEAEITSMEDEIKQVIAE |
Ga0216342_111433312 | 3300022660 | Goat Feces | MSNPNMENKVKELMELKRMKEELEAEISAMEDEIK |
Ga0216339_102317021 | 3300022661 | Goat Feces | MCNPNMEAKVHELMELKRMKEELEAEIAATEDEIKAVMGQ |
Ga0216340_102234311 | 3300023371 | Goat Feces | MSNPNMESKIKELMELKRMKEEIEAEIAAAEDEIKGVMGDEETLL |
Ga0216340_104806083 | 3300023371 | Goat Feces | MSNPNLEPKVKELMELKRMREELDAEIERLEDQIKQVMGNEETLIAGA |
Ga0216340_114342032 | 3300023371 | Goat Feces | VSNPNMEAKVKELMELKRMKEELEAEITAMEDEIKNVMGDEE |
Ga0257090_107534451 | 3300024268 | Goat Feces | MSNPNMETKVKELLELKRMKEELEAEITSMEDEIKSV |
Ga0257090_114789651 | 3300024268 | Goat Feces | MSNPNMEAKVKELMELKRLKEELEAEIAAAEDAIKAVMGD |
Ga0257090_116097543 | 3300024268 | Goat Feces | MSNPNMEPKIKELLELKRMKEELEAEITSMEDEIKQVIAE |
Ga0257090_117358862 | 3300024268 | Goat Feces | MSNPTMEAKIRELMELKRMREELDAEIASVEDAIK |
Ga0257076_108029634 | 3300024269 | Goat Feces | MSNQSMEVKVKELLELKRMKEELEAEITAVEDEIKTVM |
Ga0257076_108429451 | 3300024269 | Goat Feces | MSNPNMETKVKELLELKRMKEELEAEITSMEDEIKSVM |
Ga0257076_108800971 | 3300024269 | Goat Feces | MSNPSMETKIKELLELKRMKEELEAEISSMEDEIKQAMGEEE |
Ga0257076_115777822 | 3300024269 | Goat Feces | MSNPNLEPTIKELMELRRMKEELDTEITQLEDQIKQSMGNEETLIAGAFKVT |
Ga0257076_116929841 | 3300024269 | Goat Feces | MSNQSMEVKVKELLELKRMKEELEAEIAAVEDEIKAV |
Ga0257076_117927652 | 3300024269 | Goat Feces | MSNPNMESKVKELMELRRMKEEIEAEIAAAEDEIKSVMGDEETLLAG |
Ga0257091_101843721 | 3300024270 | Goat Feces | MSNPNMEAKVKELMELKRMREELDAEISAAEDEIKNVM |
Ga0257091_110621691 | 3300024270 | Goat Feces | MSNPNLEPKVRELLELKRMKEELEAEITAAEDEIKSIMGDE |
Ga0257091_111743601 | 3300024270 | Goat Feces | MSNPTMEPKIKELLELKRMKEELEAEITAIEDEIKSRMGDEETLLA |
Ga0257091_117870591 | 3300024270 | Goat Feces | MSNPNMESIVKELLELKRMKEELEAEITAMEDEIKKVMGDE |
Ga0257091_117926781 | 3300024270 | Goat Feces | MSNPSMEAKVRELMELKRMKEELEAEIAAAEDEIKLVM |
Ga0257077_100917111 | 3300024272 | Goat Feces | MSNPNMESKIKELMELKRMKEEIEAEIAAAEDEIKGVMGDEETL |
Ga0257077_104455413 | 3300024272 | Goat Feces | MRNPNMEAKVHELMELKRMKEELEAEIAAAEDAIKAVMG |
Ga0257077_119896841 | 3300024272 | Goat Feces | MSNPNLEPKVRELLELKRMKEELEAEIAAAEDEIKSLMGS |
Ga0257077_122629461 | 3300024272 | Goat Feces | MSNPNMEPKIKELLELKRMKEELEAEITSMEDEIKQVMGEEETLL |
Ga0257077_125687022 | 3300024272 | Goat Feces | MSNPNMEAKVKELMELKRMREELDAEISAAEDEIKKVMGDEETL |
Ga0257089_111015201 | 3300024303 | Goat Feces | MSNPNMESKIKELMELKRMKEEIEAEIAAAEDEIKGVMGDEE |
Ga0257089_114916912 | 3300024303 | Goat Feces | MSNPNMEAKVKELMELKRMKEELEAEIAATEDEIKAVMGQEELLL |
Ga0257089_115936702 | 3300024303 | Goat Feces | MSDHNMEPKIKELIELKRMREELEAEITTIEDEIK |
Ga0302102_104360723 | 3300028242 | Goat Feces | MSNPNMEAKVKELMEFKRMKEEIEAEIAAAEDEIKGVMGTEETLFAGA |
Ga0302102_104372791 | 3300028242 | Goat Feces | MSNPSMETKVKELMELKRMKEEIEIEITAAEDAIKAVMG |
Ga0302102_105724101 | 3300028242 | Goat Feces | MSNPNMENKIKELMELKRMKEELEAEITSMEDEIK |
Ga0302102_108405243 | 3300028242 | Goat Feces | MSNPNMEAKVKELMELKRMKEELEAEIAAAEDEIKSVMGEEEILNA |
Ga0302102_113082512 | 3300028242 | Goat Feces | MSNPNMESIVKELLELKRMKEELEAEITAMEDEIKKVMGDEE |
Ga0307245_13502222 | 3300028454 | Goat Feces | MSNPNMEAKVKELMELKRLKEELEAEIAAAEDAIKAVMGDEEQVALVLLH |
Ga0247610_116820162 | 3300028833 | Rumen | MESKVRELVELKKMAQELEDEITMIEDEIKQVMGTEEVLMAGQY |
Ga0307249_104148107 | 3300029305 | Goat Feces | MSDQNMETKVKELMELKRMKEEIEAEIESAEDEIKKVIPQH |
Ga0307249_105685783 | 3300029305 | Goat Feces | MSNPTLESRVKELLELKRMREEIDSEISTIEDELKKAMGNEETLIAGAFKL |
Ga0307249_106791015 | 3300029305 | Goat Feces | MSNPNMEGKIKELMELKRMKEEIEVEIAAAEDEIKSVMG |
Ga0307249_106792444 | 3300029305 | Goat Feces | MSNPSMEARVKELMELKRMKEELDNEITAIEDEIKSVMGDEEILLA |
Ga0307249_125383403 | 3300029305 | Goat Feces | MSNPNMESKVKELMELRRMKEEIEAEIAAAEDEIKG |
Ga0307249_126290641 | 3300029305 | Goat Feces | MSNQSMEAKVKELMELKRMKEELEAEIAAAEDEIKA |
Ga0307249_129913902 | 3300029305 | Goat Feces | MSNPNLEPKVRELLELKRMKEELEAEIAAAEDEIKSLMGSEETLL |
Ga0307249_130324192 | 3300029305 | Goat Feces | MSNPNMEAKVKELMELKRMREELDAEIAAAEDEIK |
Ga0307249_130377631 | 3300029305 | Goat Feces | MSNPNMESKVKELMELRRMKEEIEAEIAAAEDEIKGVMG |
Ga0307249_130556881 | 3300029305 | Goat Feces | MSNPNLEPKVRELLELKRMKEELEAEITAAEDEIKSIMGD |
Ga0307249_134813772 | 3300029305 | Goat Feces | MSNPNMENKVKELLELKRMKEELEAEIATMEDEIKSVM |
Ga0224414_103794491 | 3300029705 | Goat Feces | MSNQSMEVKVKELMELKRMKEELEAEIAAAEDEIKKVMG |
Ga0224414_115442932 | 3300029705 | Goat Feces | MSNPNMENKVKELMELKRMKEELEAEITSMEDEIKSVM |
Ga0224414_118433682 | 3300029705 | Goat Feces | MSNPNMEPKIKELLELKRMKEELEAEITSMEDEIKQVMGDEET |
Ga0224414_119173491 | 3300029705 | Goat Feces | MSNPNLEPKIKELLELKRLKEELEAEIAGMEDEIKA |
Ga0224414_120848631 | 3300029705 | Goat Feces | MSNPNMEDKVKELMELKRMKEELEAEIAAAEDEIKSVMGDEETL |
Ga0224414_121690321 | 3300029705 | Goat Feces | MSNPNMEAKVKELMELKRMKEELEAEITAMEDEIKS |
Ga0224414_122517962 | 3300029705 | Goat Feces | MSDHNLEPKVKELLELKRMKEELEAEITAIEDEIKGRM |
Ga0074002_138876682 | 3300031086 | Soil | MSNPNMEAKVKELMELKRMREELDAEISAAEDEIKNVMGAEETLFA |
Ga0318466_103578498 | 3300031555 | Goat Feces | MSNPNMENKVKELLELKRMKEELEAEITSMEDEIKSVMGDEE |
Ga0318466_106480243 | 3300031555 | Goat Feces | MSNPNLEPRIRELLELKRMKEEIEQEISSMEDEIKSIMGDEETL |
Ga0318466_109610671 | 3300031555 | Goat Feces | MSNPNMENKVKELLELKRMKEELEAEITSMEDEIKSVMG |
Ga0318466_109641301 | 3300031555 | Goat Feces | MSNPSMEARVKELMELKRMKEELDNEITAIEDEIK |
Ga0318466_110562643 | 3300031555 | Goat Feces | MCDHNMESKVKDLMELRRMKEELEAEISAAEDEIKA |
Ga0318466_113263881 | 3300031555 | Goat Feces | MSNPNMENKVKELLELKRMKEELEAEISAMEDEIKQ |
Ga0318466_114385973 | 3300031555 | Goat Feces | MSNPNMESIVKELLELKRMKEELEAEITAMEDEIKKVMGDEELLTA |
Ga0318466_117063633 | 3300031555 | Goat Feces | MSNPSMENKVKELLELKRMKEEIEAEITGMEDEIKAIMQNAR |
Ga0318466_121677081 | 3300031555 | Goat Feces | MSNPNMESKVKELMELRRMKEEIEAEIAAAEDEIK |
Ga0318466_124294121 | 3300031555 | Goat Feces | MSNPNMEAKVKELMELKRMKEELEAEIAAAEDEIKSVMGEEEIL |
Ga0318466_132168942 | 3300031555 | Goat Feces | MSNPNMEAKVKELMELKRMKEELEAEITAMEDEIKAVMGDEET |
Ga0224413_110504851 | 3300032167 | Goat Feces | MSNPTLEPKIKELLELKRMKEELEAEITAMEDEIKQVMGNEETLLAP |
Ga0224413_117698912 | 3300032167 | Goat Feces | MSNPSMEPKIKELLELKRMKEELETEIISMEDEIKQAMGD |
Ga0224413_124039542 | 3300032167 | Goat Feces | MCNPNMEAKVHELMELKRMKEELEAEIAAAEDAIKAV |
⦗Top⦘ |