NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068122

Metagenome / Metatranscriptome Family F068122

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068122
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 58 residues
Representative Sequence MKRMVQEMITEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI
Number of Associated Samples 96
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 14.41 %
% of genes near scaffold ends (potentially truncated) 23.20 %
% of genes from short scaffolds (< 2000 bps) 85.60 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (93.600 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(16.000 % of family members)
Environment Ontology (ENVO) Unclassified
(29.600 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(60.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 82.46%    β-sheet: 0.00%    Coil/Unstructured: 17.54%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF01344Kelch_1 30.40
PF13639zf-RING_2 3.20
PF00643zf-B_box 3.20
PF13418Kelch_4 2.40
PF13415Kelch_3 1.60
PF13964Kelch_6 1.60
PF14634zf-RING_5 0.80



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.40 %
UnclassifiedrootN/A5.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_108900251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii536Open in IMG/M
3300002835|B570J40625_100226475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1985Open in IMG/M
3300002835|B570J40625_100236037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1927Open in IMG/M
3300002835|B570J40625_100544684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1077Open in IMG/M
3300004112|Ga0065166_10047412All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300004795|Ga0007756_10706842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300004802|Ga0007801_10029351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1666Open in IMG/M
3300005069|Ga0071350_1008909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2294Open in IMG/M
3300005584|Ga0049082_10131260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium873Open in IMG/M
3300005662|Ga0078894_10172355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1952Open in IMG/M
3300005758|Ga0078117_1035371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1975Open in IMG/M
3300006165|Ga0075443_10059069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1293Open in IMG/M
3300006165|Ga0075443_10099671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1001Open in IMG/M
3300006394|Ga0075492_1027495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1705Open in IMG/M
3300006396|Ga0075493_1047940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1076Open in IMG/M
3300006396|Ga0075493_1386004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii553Open in IMG/M
3300006404|Ga0075515_10245736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea566Open in IMG/M
3300006641|Ga0075471_10128044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1352Open in IMG/M
3300006803|Ga0075467_10048764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2647Open in IMG/M
3300006803|Ga0075467_10102611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1700Open in IMG/M
3300006803|Ga0075467_10184841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1170Open in IMG/M
3300006803|Ga0075467_10390524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii726Open in IMG/M
3300006803|Ga0075467_10477958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii642Open in IMG/M
3300006805|Ga0075464_10069735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1978Open in IMG/M
3300006805|Ga0075464_10183293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1240Open in IMG/M
3300006917|Ga0075472_10032721All Organisms → cellular organisms → Eukaryota2421Open in IMG/M
3300007094|Ga0102532_1176563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1514Open in IMG/M
3300007236|Ga0075463_10232383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii593Open in IMG/M
3300007543|Ga0102853_1068115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii639Open in IMG/M
3300007600|Ga0102920_1136700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea784Open in IMG/M
3300007636|Ga0102856_1033779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea782Open in IMG/M
3300007649|Ga0102912_1221090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea543Open in IMG/M
3300007670|Ga0102862_1071464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea855Open in IMG/M
3300007725|Ga0102951_1079727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani937Open in IMG/M
3300007860|Ga0105735_1051139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani815Open in IMG/M
3300007861|Ga0105736_1058301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii785Open in IMG/M
3300007953|Ga0105738_1057486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii643Open in IMG/M
3300007954|Ga0105739_1132294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea585Open in IMG/M
3300007981|Ga0102904_1067194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea824Open in IMG/M
3300008999|Ga0102816_1052969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1208Open in IMG/M
3300009001|Ga0102963_1052853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1678Open in IMG/M
3300009055|Ga0102905_1016724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1374Open in IMG/M
3300009152|Ga0114980_10075408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2027Open in IMG/M
3300009160|Ga0114981_10284439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea899Open in IMG/M
3300009436|Ga0115008_10105001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2095Open in IMG/M
3300009436|Ga0115008_10124834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1892Open in IMG/M
3300009436|Ga0115008_10166730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1594Open in IMG/M
3300009436|Ga0115008_10737945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300009440|Ga0115561_1172141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii837Open in IMG/M
3300009441|Ga0115007_10131155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1604Open in IMG/M
3300009593|Ga0115011_10508484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea957Open in IMG/M
3300009608|Ga0115100_10318072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300010885|Ga0133913_11901928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1483Open in IMG/M
3300012952|Ga0163180_10397615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1007Open in IMG/M
3300012952|Ga0163180_11812955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300012953|Ga0163179_10136770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1816Open in IMG/M
3300012953|Ga0163179_10699319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae860Open in IMG/M
3300012965|Ga0129346_1149591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1090Open in IMG/M
3300012968|Ga0129337_1352235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii605Open in IMG/M
3300013010|Ga0129327_10290564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii844Open in IMG/M
3300017107|Ga0186524_103282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1937Open in IMG/M
3300017719|Ga0181390_1167669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii543Open in IMG/M
3300017751|Ga0187219_1133798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii725Open in IMG/M
3300018420|Ga0181563_10090116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2032Open in IMG/M
3300018876|Ga0181564_10213567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1113Open in IMG/M
3300018974|Ga0192873_10028685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1870Open in IMG/M
3300018999|Ga0193514_10058820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1333Open in IMG/M
3300019017|Ga0193569_10028157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2117Open in IMG/M
3300019153|Ga0192975_10310740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii518Open in IMG/M
3300019153|Ga0192975_10312947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300020109|Ga0194112_10952656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii547Open in IMG/M
3300020155|Ga0194050_1172130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii590Open in IMG/M
3300020159|Ga0211734_10212141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium905Open in IMG/M
3300020159|Ga0211734_10597202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum806Open in IMG/M
3300020159|Ga0211734_10668547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii885Open in IMG/M
3300020160|Ga0211733_10521760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1235Open in IMG/M
3300020183|Ga0194115_10116365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1458Open in IMG/M
3300020193|Ga0194131_10074521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2011Open in IMG/M
3300020197|Ga0194128_10191056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1112Open in IMG/M
3300020197|Ga0194128_10192778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1105Open in IMG/M
3300020204|Ga0194116_10131344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1539Open in IMG/M
3300020205|Ga0211731_10841163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii555Open in IMG/M
3300020222|Ga0194125_10557412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum691Open in IMG/M
3300020546|Ga0208853_1010554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1985Open in IMG/M
3300020557|Ga0208231_1007971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1974Open in IMG/M
3300021336|Ga0210307_1196867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii675Open in IMG/M
3300021336|Ga0210307_1410661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1934Open in IMG/M
3300021365|Ga0206123_10271667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300021376|Ga0194130_10166641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1338Open in IMG/M
3300021376|Ga0194130_10415150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea711Open in IMG/M
3300024343|Ga0244777_10100226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1870Open in IMG/M
3300024343|Ga0244777_10192981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1308Open in IMG/M
3300024343|Ga0244777_10367458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii900Open in IMG/M
3300024343|Ga0244777_10491922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii754Open in IMG/M
3300024343|Ga0244777_10556280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea699Open in IMG/M
3300024343|Ga0244777_10754509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii578Open in IMG/M
3300024543|Ga0256348_1083874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300025848|Ga0208005_1014090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2439Open in IMG/M
3300025887|Ga0208544_10197664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii833Open in IMG/M
3300027205|Ga0208926_1064173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea538Open in IMG/M
3300027228|Ga0208308_1018718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea938Open in IMG/M
3300027797|Ga0209107_10091288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1647Open in IMG/M
3300027810|Ga0209302_10048306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2280Open in IMG/M
3300027810|Ga0209302_10055595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2094Open in IMG/M
3300027833|Ga0209092_10168336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1252Open in IMG/M
3300027883|Ga0209713_10581815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii723Open in IMG/M
3300027885|Ga0209450_10668585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani756Open in IMG/M
3300027899|Ga0209668_10688073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea686Open in IMG/M
3300027899|Ga0209668_11233743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii502Open in IMG/M
3300030709|Ga0307400_10080037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1826Open in IMG/M
3300031036|Ga0073978_1532760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1392Open in IMG/M
3300031569|Ga0307489_10136923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1457Open in IMG/M
3300031569|Ga0307489_10143690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1427Open in IMG/M
3300031602|Ga0307993_1141692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani604Open in IMG/M
3300031750|Ga0307389_10332763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii944Open in IMG/M
3300031784|Ga0315899_10322743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1521Open in IMG/M
3300031857|Ga0315909_10982830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii512Open in IMG/M
3300032754|Ga0314692_10597561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea588Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous16.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine14.40%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake8.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater4.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.20%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.20%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water3.20%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.40%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.40%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.60%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.60%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.60%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.60%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.60%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.80%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.80%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.80%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.80%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.80%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.80%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.80%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.80%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.80%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.80%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.80%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2MEnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007094Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A)EnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300007953Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3umEnvironmentalOpen in IMG/M
3300007954Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017107Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/20 medium, no silicate, 19 C, 30 psu salinity and 446 ?mol photons light - Strombidinopsis sp. SopsisLIS2011 (MMETSP0463)Host-AssociatedOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020155Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-10mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020204Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300020546Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020557Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024543Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027205Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027228Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10890025113300002408FreshwaterFFYILVVDMKKMVNEMVQEVEVLESETPATEDMYSKLEQKVRKKFNEEIDRLEKSFRRIMDQLDI*
B570J29032_10939983013300002408FreshwaterMDMKRMVQEMVTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMKEQIDKEI
B570J40625_10022647543300002835FreshwaterMKRMVQEMVTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQ*
B570J40625_10023603723300002835FreshwaterMVTDVEALEQETPASEELYSKLEIKVRKRFNEEVDRLEKSFRRVME*
B570J40625_10054468423300002835FreshwaterMLTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLY*
Ga0065166_1004741243300004112Freshwater LakeLSEVEALEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDIQ*
Ga0007756_1070684223300004795Freshwater LakeMVTDVEALEQETPASEELYSKLEIKVRKRFNEEVDRLEKSFRRVM
Ga0007801_1002935113300004802FreshwaterMKRMVQELLTEVENLEQETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDIQQQNLY*
Ga0071350_100890913300005069FreshwaterMFIVLDMKRMVQEMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQ*
Ga0049082_1013126013300005584Freshwater LenticMVQELLTEVETLELETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIME*
Ga0078894_1017235543300005662Freshwater LakeMKNMIQELLSEVEALEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDIQ*
Ga0078117_103537123300005758Lake WaterMDMKRMVQEMLTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLY*
Ga0075443_1005906923300006165MarineMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQ*
Ga0075443_1009967113300006165MarineMKRMVHEMITEVEVYEAETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI*
Ga0075492_102749513300006394AqueousMKRMVQEMITEVEVLESETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLEIQQQNLYQMMKE*
Ga0075493_104794033300006396AqueousIDMKRMVQEMITEVEVLESETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLEIQQQNLYQMMKE*
Ga0075493_138600413300006396AqueousLDMKRMVSEMINEVEQLESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI*
Ga0075515_1024573623300006404AqueousMKKMVQELLQEVEQIEQETPPSEEQYYNKLELKVRKKFNEEIDRLEKSFRRIMEQLDIQ
Ga0075471_1012804433300006641AqueousMLTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI*
Ga0075467_1004876433300006803AqueousVVFFALVLDMKRMVSEMINEVEQLESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI*
Ga0075467_1010261123300006803AqueousMVQEMITEVEVLESETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLEIQQQNLYQMMKE*
Ga0075467_1018484123300006803AqueousMVQEMISEVETYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMKE*
Ga0075467_1039052423300006803AqueousMKHMIQELANEVETLEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDI*
Ga0075467_1047795823300006803AqueousMDMKKMVQEMLNEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI*
Ga0075464_1006973553300006805AqueousMVQELITEENNEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDIQ*
Ga0075464_1018329333300006805AqueousMKKMVQEMVSEVETLEQETPATEELYSKLELKVRKKFNEEIDRLEKSFRRIME*
Ga0075473_1003187853300006875AqueousMVQEMLTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMKEQIDKEIRSL*
Ga0075472_1003272143300006917AqueousMKRMVQEMITEVEVLEQETPASEELYSKLEQKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMKE*
Ga0102532_117656313300007094Freshwater LakeMFSVLDMKRMVQEMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI*
Ga0075463_1023238313300007236AqueousMITEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQ
Ga0102853_106811513300007543EstuarineMKRMVQELITEVETIEQESPSSEEQYYNKLELKVRKKFNEEIDRLEKSFRRIME*
Ga0102920_113670023300007600EstuarineMKNMIQELLSEVEALEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDIQQQNLY*
Ga0102856_103377913300007636EstuarineMKRMVQELLTEVETLEQETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDIQ*
Ga0102912_122109013300007649EstuarineLSEVEALEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDI*
Ga0102862_107146413300007670EstuarineELITEVETIEQESPSSEAQYYNKLELKVRKKFNEEIDRLEKSFRRIME*
Ga0102951_107972713300007725WaterVYENETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLY*
Ga0105735_105113933300007860Estuary WaterMDKKRMVQEMVTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI*
Ga0105736_105830133300007861Estuary WaterMVQELLTEVETLEQETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDIQ*
Ga0105738_105748623300007953Estuary WaterMDMKRMVQEMVTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQ*
Ga0105739_113229423300007954Estuary WaterEVETLEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDIQQ*
Ga0102904_106719423300007981EstuarineMINEVEVYEQETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQ*
Ga0102816_105296923300008999EstuarineMKHMVQELLSEVETLEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDIQQ*
Ga0102963_105285313300009001Pond WaterMINEVEVLESETPASEELYQKLELKVRKKFNEEIDRLEKSFRRIMEQLEI*
Ga0102905_101672433300009055EstuarineMDMKRMVQEMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLY*
Ga0114980_1007540833300009152Freshwater LakeMKRMVQELLTEVETLEQETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDIQQQNLYQMMKE*
Ga0114981_1028443913300009160Freshwater LakeQELLTEVETLEQETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIME*
Ga0115008_1010500123300009436MarineMKRLVTEMIAEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLEKSFRRINEALEI*
Ga0115008_1012483423300009436MarineMQRMVREMITEVEVYENETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIME*
Ga0115008_1016673033300009436MarineMVREMITEVEVYENETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIME*
Ga0115008_1073794523300009436MarineMISEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLEKSFRRINEALEIQQQNLY
Ga0115561_117214113300009440Pelagic MarineMKRLVTEMIAEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLAKSFRRINEALEI*
Ga0115007_1013115513300009441MarineMINEVEVYEAETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIME*
Ga0115011_1050848423300009593MarineQTCLVVDMKRLVTEMIAEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLEKSFRRINEALEI*
Ga0115100_1031807223300009608MarineRMVQEMINEVEVLESETPASEELYSKLEVKVRKKFNEEIDRLEKSFRRIMEQLEIQQQNLY*
Ga0129333_1016413753300010354Freshwater To Marine Saline GradientMDMKRMVQEMLTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMKEQIDKEIRSL*
Ga0133913_1190192833300010885Freshwater LakeETLEQETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDIQQQNLYQMMKE*
Ga0163180_1039761523300012952SeawaterMVQEMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQ*
Ga0163180_1181295523300012952SeawaterMKRMVQEMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIME*
Ga0163179_1013677013300012953SeawaterMINEVEVYENETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMKEQIDKEIRSL*
Ga0163179_1069931913300012953SeawaterMVQEMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIME*
Ga0129346_114959113300012965AqueousMKRMVMEMINEVEVYESETPASEELYSKLELKVRKKFNDEVDRLEKSFRRIMEQLEI*
Ga0129337_135223533300012968AqueousMLTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMK
Ga0129327_1029056423300013010Freshwater To Marine Saline GradientMKRMVQEMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI*
Ga0186524_10328223300017107Host-AssociatedMIEEVNILENETTASEELYSKLELKVRKKFNEEIDHLEKSFRRIMEQLEI
Ga0181390_116766913300017719SeawaterMIAEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLEKSFRRIMEQLDI
Ga0187219_113379823300017751SeawaterMIAEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLEKSFRRINEALEIQ
Ga0181563_1009011643300018420Salt MarshMDMKKMVQEMLNEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI
Ga0181564_1021356723300018876Salt MarshMLNEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI
Ga0192873_1002868523300018974MarineMKRMVQEMITEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI
Ga0193514_1005882013300018999MarineMQRMVQEMINEVEVYENETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQ
Ga0193569_1002815723300019017MarineMINEVEVLEQETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMK
Ga0192975_1031074023300019153MarineVDMKRLVSEMIAEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLEKSFRRINEALEI
Ga0192975_1031294713300019153MarineMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQ
Ga0194112_1095265623300020109Freshwater LakeMKSVVVDMKKMVAEMASEVEILEQETPATEELYSKLELKVRKKFNEEIDRLEKSFRRIME
Ga0194050_117213013300020155Anoxic Zone FreshwaterMVQELLTEVETLEQETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDIQ
Ga0211734_1021214123300020159FreshwaterMKRMVQELLTEVETLEQETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDI
Ga0211734_1059720223300020159FreshwaterMLTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLY
Ga0211734_1066854713300020159FreshwaterMKRMVQEMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQ
Ga0211733_1052176013300020160FreshwaterMKRMVQELLTEVETLEQETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIME
Ga0194115_1011636523300020183Freshwater LakeMKKMVAEMASEVEVLEQETPATEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDI
Ga0194131_1007452143300020193Freshwater LakeMASEVEVIEQDIPVSEELYSKLELKVCKKFNEEIDRLEKSFRRIMEQLDI
Ga0194128_1019105633300020197Freshwater LakeMVSEVEVIEQDIPVSEELYSKLELKVCKKFNEEIDRLEKSFRSIMEQLDI
Ga0194128_1019277813300020197Freshwater LakeMLTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMKEQIDKEIRSL
Ga0194116_1013134453300020204Freshwater LakeSPTITYLLVVDMKKMVAEMASEVEVLEQETPATEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDI
Ga0211731_1084116313300020205FreshwaterMKKMVQEMVSEVETLEQETPATEELYSKLELKVRKKFNEEIDRLEKSFRRIME
Ga0194125_1055741223300020222Freshwater LakeMLTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQ
Ga0208853_101055443300020546FreshwaterMKRMVQEMVTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQ
Ga0208231_100797143300020557FreshwaterMVTDVEALEQETPASEELYSKLEIKVRKRFNEEVDRLEKSFRRVME
Ga0210307_119686723300021336EstuarineMKHMVQELLSEVETLEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDIQQ
Ga0210307_141066143300021336EstuarineMKRMVQELITEVETIEQESPSSEEQYYNKLELKVRKKFNEEIDRLEKSFRRIME
Ga0206123_1027166713300021365SeawaterMKRLVTEMISEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLEKSFRRINEALEIQQQNLYSMMK
Ga0194130_1016664113300021376Freshwater LakeMKSMIQELLSEVEALEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDIQQ
Ga0194130_1041515013300021376Freshwater LakeVSEVEVFEQDIPVSEELYSKLELKVCKKFNEEIDRLEKSFRRIMEQLDI
Ga0213920_111049613300021438FreshwaterMTIYANLSSLSLVLEMKRMVREMLEEVDAIDRNNSVCEELYGKLEQKVRKKFNEEVERLEKSFRRIIEQLEIQQQNLYTMMKEQIDKELKCL
Ga0063105_101358713300021887MarineMKRLVTEMIAEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLEKSFRRINEALEIQQQNLYSMMKEQIDKEIRSL
Ga0063090_107351413300021890MarineMKRLVTEMIAEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLEKSFRRINEALEIXQQNLYSMMKEQIDKEIRSL
Ga0244777_1010022633300024343EstuarineMINEVEVYEQETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQ
Ga0244777_1019298133300024343EstuarineMDMKRMVQEMINEVEVLEQETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI
Ga0244777_1036745823300024343EstuarineMVQELITEVETIEQESPSSEEQYYNKLELKVRKKFNEEIDRLEKSFRRIME
Ga0244777_1049192223300024343EstuarineMVQEMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLY
Ga0244777_1055628013300024343EstuarineMKNMIQELLSEVEALEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDI
Ga0244777_1075450913300024343EstuarineMKRMVTEMITEVEMYEQETPASEELYGKLELKVRKKFNDEVDRLEKSFRRI
Ga0256348_108387413300024543FreshwaterQCSPKIMDMKRMVQEMLTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEI
Ga0208784_102221353300025732AqueousMVQEMLTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMKEQIDKEIRSL
Ga0208005_101409043300025848AqueousMKRMVQEMITEVEVLEQETPASEELYSKLEQKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMKE
Ga0208544_1019766413300025887AqueousVETLEQETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDI
Ga0208926_106417313300027205EstuarineKRMVQELITEVETIEQESPSSEEQYYNKLELKVRKKFNEEIDRLEKSFRRIME
Ga0208308_101871833300027228EstuarineMDMKRMVQEMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLY
Ga0209107_1009128813300027797Freshwater And SedimentMKRMVQELLTEVETLEQETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDIQQQNLYQMMKE
Ga0209302_1004830623300027810MarineMNDHDLTGCFFCVLVLDMQRMVKEMINEVEVYENETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIME
Ga0209302_1005559523300027810MarineMKRLVTEMIAEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLEKSFRRINEALEI
Ga0209092_1016833633300027833MarineMVREMITEVEVYENETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIME
Ga0209713_1058181523300027883MarineMQRMVREMITEVEVYENETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIME
Ga0209450_1066858513300027885Freshwater Lake SedimentMKRMVQELLTEVENLELETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIMEQLDIQ
Ga0209668_1068807323300027899Freshwater Lake SedimentMVQEMVTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQ
Ga0209668_1123374313300027899Freshwater Lake SedimentVTRQNAXIQTIYVLVLDMKRMVQEMVTEVEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLY
Ga0307400_1008003713300030709MarineLKHEVINCSYKIVDMKRLVSEMIAEVEVLETETPATEELYSKLEVKVRKKFNEEIDRLEKSFRRINEALEI
Ga0073978_153276033300031036MarineMMTELIGEVEVLEMETPATEDMYSKLEVKVRKKFNEEIDRLEKSFRRINEALEIQQQNLYSMMKE
Ga0307489_1013692323300031569Sackhole BrineVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLYQMMKEQIDKEIRSL
Ga0307489_1014369033300031569Sackhole BrineMKKMVQEMVLEVETLESETPASEELYSKLELKVRKKFNEEIDRLEKSFRRIME
Ga0307993_114169223300031602MarineMKRMVQEMINEVEVYESETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIME
Ga0307389_1033276323300031750MarineMKRMVQEMITEVEVYEAETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQ
Ga0315899_1032274343300031784FreshwaterLSEVEALEQETPASEDLYNKLEMKVRKKFNEEIDRLEKSFRRIMEQLDIQQQNLY
Ga0315909_1098283013300031857FreshwaterEAYEVETPASEELYSKLELKVRKKFNDEIDRLEKSFRRIMEQLEIQQQNLY
Ga0314692_1059756123300032754SeawaterMKKMVQELLQEVEQIEQETPPSEEQYYNKLELKVRKKFNEEIDRLEKSFRRIM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.