| Basic Information | |
|---|---|
| Family ID | F066987 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAFTRTQIGIAVGAGVLLVGVFVGYLWWLSNQGPVLARS |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.20 % |
| % of genes near scaffold ends (potentially truncated) | 99.21 % |
| % of genes from short scaffolds (< 2000 bps) | 87.30 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.476 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.524 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.413 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF01196 | Ribosomal_L17 | 42.86 |
| PF03118 | RNA_pol_A_CTD | 11.90 |
| PF07676 | PD40 | 5.56 |
| PF07719 | TPR_2 | 1.59 |
| PF00411 | Ribosomal_S11 | 0.79 |
| PF04240 | Caroten_synth | 0.79 |
| PF02687 | FtsX | 0.79 |
| PF08241 | Methyltransf_11 | 0.79 |
| PF02576 | RimP_N | 0.79 |
| PF08544 | GHMP_kinases_C | 0.79 |
| PF02590 | SPOUT_MTase | 0.79 |
| PF01176 | eIF-1a | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0203 | Ribosomal protein L17 | Translation, ribosomal structure and biogenesis [J] | 42.86 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 11.90 |
| COG0100 | Ribosomal protein S11 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0779 | Ribosome maturation factor RimP | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG1576 | 23S rRNA pseudoU1915 N3-methylase RlmH | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG2324 | Uncharacterized membrane protein | Function unknown [S] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.27 % |
| Unclassified | root | N/A | 8.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001471|JGI12712J15308_10011288 | All Organisms → cellular organisms → Bacteria | 2411 | Open in IMG/M |
| 3300004092|Ga0062389_101821881 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300004092|Ga0062389_102200167 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005450|Ga0066682_10568919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300005526|Ga0073909_10271547 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005542|Ga0070732_10577153 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005554|Ga0066661_10665089 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005602|Ga0070762_10024125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3202 | Open in IMG/M |
| 3300005602|Ga0070762_10744632 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005764|Ga0066903_104244984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300005921|Ga0070766_10508842 | Not Available | 801 | Open in IMG/M |
| 3300006052|Ga0075029_101114026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300006175|Ga0070712_100606412 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300006854|Ga0075425_103065577 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300006893|Ga0073928_10044064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 4091 | Open in IMG/M |
| 3300007255|Ga0099791_10670270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300007788|Ga0099795_10160214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300007982|Ga0102924_1248653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300009088|Ga0099830_10377721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
| 3300009629|Ga0116119_1041387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1211 | Open in IMG/M |
| 3300009672|Ga0116215_1541800 | Not Available | 503 | Open in IMG/M |
| 3300009698|Ga0116216_10801060 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300009759|Ga0116101_1170683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300010048|Ga0126373_12203903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300010339|Ga0074046_10164459 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300010358|Ga0126370_12252952 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010358|Ga0126370_12390477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300010379|Ga0136449_100993468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1352 | Open in IMG/M |
| 3300011120|Ga0150983_13208872 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300011269|Ga0137392_10280341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1375 | Open in IMG/M |
| 3300011271|Ga0137393_11444480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300011411|Ga0153933_1088477 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012351|Ga0137386_10294194 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300012683|Ga0137398_10174028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1409 | Open in IMG/M |
| 3300012957|Ga0164303_10312588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300012971|Ga0126369_10262963 | Not Available | 1705 | Open in IMG/M |
| 3300014167|Ga0181528_10847257 | Not Available | 515 | Open in IMG/M |
| 3300014495|Ga0182015_10095830 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
| 3300015167|Ga0167661_1048395 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300017924|Ga0187820_1013408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1995 | Open in IMG/M |
| 3300017932|Ga0187814_10197945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300017933|Ga0187801_10412943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300017943|Ga0187819_10137462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1457 | Open in IMG/M |
| 3300017959|Ga0187779_10364876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300018007|Ga0187805_10588602 | Not Available | 525 | Open in IMG/M |
| 3300018008|Ga0187888_1240907 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300018043|Ga0187887_10118609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1589 | Open in IMG/M |
| 3300018086|Ga0187769_10349902 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300018086|Ga0187769_11539883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300018468|Ga0066662_10907071 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300020579|Ga0210407_10719586 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300020581|Ga0210399_10215864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1597 | Open in IMG/M |
| 3300020583|Ga0210401_10091128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2865 | Open in IMG/M |
| 3300020583|Ga0210401_10212247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1793 | Open in IMG/M |
| 3300020583|Ga0210401_10445774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
| 3300021401|Ga0210393_10118924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2111 | Open in IMG/M |
| 3300021406|Ga0210386_10930918 | Not Available | 743 | Open in IMG/M |
| 3300021420|Ga0210394_10405563 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
| 3300021420|Ga0210394_10817729 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300021420|Ga0210394_11358661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300021420|Ga0210394_11729897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300022730|Ga0224570_107324 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300024225|Ga0224572_1001037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3865 | Open in IMG/M |
| 3300025414|Ga0208935_1057806 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300025434|Ga0208690_1068665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300025442|Ga0208034_1080649 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300025912|Ga0207707_11318068 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300025913|Ga0207695_10123300 | All Organisms → cellular organisms → Bacteria | 2557 | Open in IMG/M |
| 3300025916|Ga0207663_10664164 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300025928|Ga0207700_11897970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300026025|Ga0208778_1016375 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300026078|Ga0207702_10689586 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300026489|Ga0257160_1051755 | Not Available | 710 | Open in IMG/M |
| 3300026557|Ga0179587_10477531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300026683|Ga0208210_100908 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300027587|Ga0209220_1078932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300027616|Ga0209106_1155891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300027652|Ga0209007_1072275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300027783|Ga0209448_10048608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1427 | Open in IMG/M |
| 3300027842|Ga0209580_10256330 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300027842|Ga0209580_10316274 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300027853|Ga0209274_10389765 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300027882|Ga0209590_10883478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300027882|Ga0209590_11023330 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027884|Ga0209275_10528930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300027898|Ga0209067_10519456 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300027908|Ga0209006_10146378 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
| 3300028566|Ga0302147_10317862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300028748|Ga0302156_10291570 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300028801|Ga0302226_10191847 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300028863|Ga0302218_10029327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1741 | Open in IMG/M |
| 3300028906|Ga0308309_10778208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300029882|Ga0311368_10282282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1267 | Open in IMG/M |
| 3300029915|Ga0311358_10568176 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300029943|Ga0311340_10169547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2250 | Open in IMG/M |
| 3300030058|Ga0302179_10029825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2551 | Open in IMG/M |
| 3300030503|Ga0311370_10012624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 13259 | Open in IMG/M |
| 3300030520|Ga0311372_11398121 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300030580|Ga0311355_10295018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1633 | Open in IMG/M |
| 3300030707|Ga0310038_10242253 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300030815|Ga0265746_1041759 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031128|Ga0170823_12603727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1170 | Open in IMG/M |
| 3300031234|Ga0302325_11036778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
| 3300031236|Ga0302324_101672953 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300031238|Ga0265332_10135817 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300031241|Ga0265325_10239481 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300031446|Ga0170820_15548146 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300031474|Ga0170818_101815601 | Not Available | 2161 | Open in IMG/M |
| 3300031708|Ga0310686_105202838 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300031708|Ga0310686_111290234 | Not Available | 507 | Open in IMG/M |
| 3300031711|Ga0265314_10334344 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300031823|Ga0307478_11525251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300032174|Ga0307470_10780735 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300032770|Ga0335085_10903249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300032828|Ga0335080_11984227 | Not Available | 564 | Open in IMG/M |
| 3300032892|Ga0335081_10624918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1324 | Open in IMG/M |
| 3300032892|Ga0335081_12380951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300032955|Ga0335076_10233724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1735 | Open in IMG/M |
| 3300033887|Ga0334790_033114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2110 | Open in IMG/M |
| 3300033888|Ga0334792_065658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1081 | Open in IMG/M |
| 3300034125|Ga0370484_0097940 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300034163|Ga0370515_0008491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 4941 | Open in IMG/M |
| 3300034163|Ga0370515_0404977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300034163|Ga0370515_0490705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300034199|Ga0370514_164102 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.97% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.17% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.17% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.38% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.38% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.59% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.59% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.59% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.59% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.79% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.79% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.79% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.79% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026025 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026683 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN352 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12712J15308_100112881 | 3300001471 | Forest Soil | MTFTRTGFTRAQIGIAVGAAALLVFGFLGYIWWLSNQGPVLARSEDHDPL |
| Ga0062389_1018218812 | 3300004092 | Bog Forest Soil | MGFTRTQIGIAVGAGALLVFGFLGYIWWLNNQGPVLARSEDHDPLT |
| Ga0062389_1022001672 | 3300004092 | Bog Forest Soil | MGFTRTQIAIAVTAGALLVFGFLGYIWWLSNQGPVLARSE |
| Ga0066682_105689192 | 3300005450 | Soil | MAFTRNQIGIAVGAGTLLVLVFLGYVWWLSNQGPVLARSEDRD |
| Ga0073909_102715472 | 3300005526 | Surface Soil | MAFTRTQIGIAVGVGALLVFGFVGYLWWMSNQGPVLAR |
| Ga0070732_105771532 | 3300005542 | Surface Soil | MAVTRTQIGIAVGAGVLLVLVFVGYLFWLSNQGPVLA |
| Ga0066661_106650891 | 3300005554 | Soil | MAANRNQIGIAVGAGALIVLVFLGYIWWLSNQGPVLARSEDHDP |
| Ga0070762_100241253 | 3300005602 | Soil | MAFTRTQIGIAASAGALLVLVFVGYLWWLSNQGPVLA |
| Ga0070762_107446321 | 3300005602 | Soil | MAFTRTQIGIAVGVGALLVFGFVGYLWWLSNQGPVRERSEEKD |
| Ga0066903_1042449841 | 3300005764 | Tropical Forest Soil | MAFTKVQIGIAVGTAALLVFGFVGYLWWLSNQGPVLARSEQKDS |
| Ga0070766_105088421 | 3300005921 | Soil | MGFTRIQIGIAVGVAALLVFGFLGYIWWLSNQGPVLARSE |
| Ga0075029_1011140262 | 3300006052 | Watersheds | MAFTRTQIGIAVGAGVFLVLVFVGYLWWLSNQGPVLA |
| Ga0070712_1006064121 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFTRTQIGIAVGAASLLVLVFVGYLWWLSNQGPVLARSEDHDP |
| Ga0075425_1030655771 | 3300006854 | Populus Rhizosphere | MAFTKAQIGIAVGSGALLVFGFVGYLWWLSNQGPVL |
| Ga0073928_100440641 | 3300006893 | Iron-Sulfur Acid Spring | MAFTRTQIGIAVGAGVLLVAVFLGYVRWLSDQGPVLARS |
| Ga0099791_106702701 | 3300007255 | Vadose Zone Soil | MAFTRNQIGIAVGAGALLVLVFLGYVWWLSNQGPVLARSEDRDPLTGIPNSVT |
| Ga0099795_101602141 | 3300007788 | Vadose Zone Soil | MTLYPMQFSKTHLGIAIGAASLLVLVFVGYLWWLSNQPPVL |
| Ga0102924_12486531 | 3300007982 | Iron-Sulfur Acid Spring | MAFTRTQIGIAVGAGVLLVLVFVGYLFWLSNQGPVLARSE |
| Ga0099830_103777211 | 3300009088 | Vadose Zone Soil | MAFTRNQIGIAVGAGALLVLVFLGYVWWLSNQGPV |
| Ga0116119_10413872 | 3300009629 | Peatland | MGFTRIQIGIAVSAGALLVFGFLGYIWWLSNQGPVLA |
| Ga0116215_15418001 | 3300009672 | Peatlands Soil | MGFTRTQIAIAAAAGALLVFGFLGYIWWLSNQGPVLARSED |
| Ga0116216_108010602 | 3300009698 | Peatlands Soil | MAFTRTQIGIAVGAGVLLVGVFVGYLWWLSNQGPVLARS |
| Ga0116101_11706832 | 3300009759 | Peatland | MGFTRTQIGIAVGAAALLVFGFLGYIWWLSNQGPVLARS |
| Ga0126373_122039031 | 3300010048 | Tropical Forest Soil | MAFTKTQIGIAVGAGALLVCVFVGYLWWLSNQGPV |
| Ga0074046_101644593 | 3300010339 | Bog Forest Soil | MAFTRTQIGIAAGTGVLIVGVFVGYLWWLSNQGPVLARSEDHDPL |
| Ga0126370_122529521 | 3300010358 | Tropical Forest Soil | MAATRTQIGIAVGAGVLLVLVFLGYLWWLSNQGPVLARSEDHDPLTGL |
| Ga0126370_123904772 | 3300010358 | Tropical Forest Soil | MAFTRTQIGIAVGTGALLVFGFVGYLWWLSNQPPVLARSEQ |
| Ga0136449_1009934681 | 3300010379 | Peatlands Soil | MAFTKTQIGIAAGTGILLVSVFVGYLWWLSNQGPVLARSEDHDPLTG |
| Ga0150983_132088721 | 3300011120 | Forest Soil | MAFTRNQIGIAVGAGTLLVLVFLGYVWWLSNQGPVLARSEDRDPLTGIPNS |
| Ga0137392_102803413 | 3300011269 | Vadose Zone Soil | MATTRSQIGIAVGAGALLVLGFLGYVWWLNNQGPVLA |
| Ga0137393_114444802 | 3300011271 | Vadose Zone Soil | MEFSRTQVGIAVGVGALLVAIFFGYLLWLNNQGPVLARSEE |
| Ga0153933_10884772 | 3300011411 | Attine Ant Fungus Gardens | MGFTRTQIAIAVGVGALLVFGFLGYIWWLSNQGPVLSRSEEHDPLTGL |
| Ga0137386_102941942 | 3300012351 | Vadose Zone Soil | MAFTRNQIGIAIGAGTLLVLVFLGYVWWLSNQGPVLARSEDRDPLTGIPN |
| Ga0137398_101740281 | 3300012683 | Vadose Zone Soil | MATTRSQIGIAVGAGALLVLGFLGYVWWLSNQGPVLARSD |
| Ga0164303_103125881 | 3300012957 | Soil | MAFTRTQIGIAVGVGALLVFGFVGYLWWMSNQGPVLARSEDKD |
| Ga0126369_102629631 | 3300012971 | Tropical Forest Soil | MAFTRTQIGIAVGTGALLVFGFVGYLWWLSNQPPVLARSEEKDTLTGLPV |
| Ga0181528_108472571 | 3300014167 | Bog | MAFTRTQIGIAVTTGVLLVGGFVGYLYWLSNQGPVLARSE |
| Ga0182015_100958301 | 3300014495 | Palsa | MGFTRTQIGIAVGAAALLVFGFLGYIWWLSNQGPVLARSEDHDPLTGL |
| Ga0167661_10483952 | 3300015167 | Glacier Forefield Soil | MAFTKTQIGIAVGAASLLVLVFLGYLWWLNGQGPVLARSDDHDPLTG |
| Ga0187820_10134082 | 3300017924 | Freshwater Sediment | MAFTKTQIGIAVSAGVLLVLVFVGYLWWLSNQGPVLARSEEHDP |
| Ga0187814_101979451 | 3300017932 | Freshwater Sediment | MAFTKTQIGIAVSAGVLLVLVFVGYLWWLSNQGPVL |
| Ga0187801_104129432 | 3300017933 | Freshwater Sediment | MAATRTQIGIAVGAGILLVLVFVGYLWWLSNQGPVLARSE |
| Ga0187819_101374622 | 3300017943 | Freshwater Sediment | MAFTKTQIGIAVGAGVLLVLVFVGYLWWLSNQGPVLARSE |
| Ga0187779_103648761 | 3300017959 | Tropical Peatland | VAFTKTQIGIAVGAGALLVLVFLGYLWWLSNQGPVLARSDDHDPL |
| Ga0187805_105886021 | 3300018007 | Freshwater Sediment | MAFTKTQIGIAVGGGALLVFVFVGYLWWLSNQGPVL |
| Ga0187888_12409071 | 3300018008 | Peatland | MGFTRTQIGIAVGAAALLVFGFLGYIWWLSNQGPVLARSEERDS |
| Ga0187887_101186091 | 3300018043 | Peatland | MGFTRTQIGIAVGAAALLVFGFLGYIWWLSNQGPVLARSEERDSLSGL |
| Ga0187769_103499021 | 3300018086 | Tropical Peatland | MASFTKNQIGIAVGFASVLVLIFVGYLWWLSNQGP |
| Ga0187769_115398832 | 3300018086 | Tropical Peatland | MAFTRTQIGIAVGVGALLVLSFLGYIWWLSNQGPV |
| Ga0066662_109070713 | 3300018468 | Grasslands Soil | MAFTRTQIGIAVGVGALLVFGFVGYLWWLSNQGPVL |
| Ga0210407_107195861 | 3300020579 | Soil | MAFTRNQIGIAVGAGTLLVLVFLGYVWWLSNQGPVLARSEDRDPLTGM |
| Ga0210399_102158643 | 3300020581 | Soil | MAFTRTQIGIAGGAGTLLVLVFVGYIWWLSNQGPVLARSEDHDPLT |
| Ga0210401_100911284 | 3300020583 | Soil | MAFTRTQIGIAASAGALLVLVFVGYLWWLSNQGPVLAR |
| Ga0210401_102122473 | 3300020583 | Soil | MAFTRTHIGIAVGAGVLLVGIFVGYLWWLSNQGPVLARSEDR |
| Ga0210401_104457741 | 3300020583 | Soil | MAFTRTQIGIAVGIGALLVFGFVGYLWWLSNQGPVWARSE |
| Ga0210393_101189243 | 3300021401 | Soil | MGFTRTQIGIAVGAGALLVLVFLGYIWWLSNQGPVLARSEDH |
| Ga0210386_109309182 | 3300021406 | Soil | MGFTRVQIGIAVGVAALLVFGFLGYIWWLSNQGPVLARSE |
| Ga0210394_104055631 | 3300021420 | Soil | MGFTRTQIGIAVGAGVLLVAVFLGYVWWLSDQGPV |
| Ga0210394_108177291 | 3300021420 | Soil | MAFTRTQIGIAVGAGTLLVLVFVGYIWWLSNQGPVLA |
| Ga0210394_113586612 | 3300021420 | Soil | MAFTRTQIGIAVGAGVLLVGVFVGYLWWLSNQGPVLARSDDHD |
| Ga0210394_117298971 | 3300021420 | Soil | MGFTRTQIGIAVGVASLLVFGFLGYIWWLSNQGPVLARSEDHDPLT |
| Ga0224570_1073241 | 3300022730 | Rhizosphere | MAFTRTQIGIAVGAGVLLVAVFLGYVWWLSDQGPVLARS |
| Ga0224572_10010375 | 3300024225 | Rhizosphere | MAFTRTQIGIAVGAGVLLVAVFLGYVWWLSDQGPVLARSEERDPLS |
| Ga0208935_10578062 | 3300025414 | Peatland | MAFTKTQIGIAVGAGALLVMVFVGYLWWLSNQGPVLARSE |
| Ga0208690_10686651 | 3300025434 | Peatland | MAFTRTQIGIAVGAGVLLVAVFLGYVWWLSDQGPVLARSEERD |
| Ga0208034_10806491 | 3300025442 | Peatland | MAFTRTQIGIAVGAGTMLVLVFVGYLWWLSNQGPVLAR |
| Ga0207707_113180682 | 3300025912 | Corn Rhizosphere | MAFTKTQIGIAAGAGVFLVLVFLGYLWWLSNQGPVLARSED |
| Ga0207695_101233004 | 3300025913 | Corn Rhizosphere | MAFTKTQIGIAAGAGVLLVMVFVGYLWWLSNQGPVLARSE |
| Ga0207663_106641641 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFTKTQIGIAAGAGVFLVLVFLGYLWWLSNQGPVLAR |
| Ga0207700_118979702 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFTRTQIAIAAGAGALMVLVFLGYVWWLSNQGPVLARSQD |
| Ga0208778_10163751 | 3300026025 | Rice Paddy Soil | MAFTKTQIGIAVGAAALLVGLFLGYLWWLSNQGPVLARSEDHDPLTG |
| Ga0207702_106895861 | 3300026078 | Corn Rhizosphere | MAFTKTQIGIAAGAGVFLVLVFLGYLWWLSNQGPVLARS |
| Ga0257160_10517552 | 3300026489 | Soil | MGFTRTQIAIAASAAALLVLVFLGYIWWLGNQGPVLA |
| Ga0179587_104775311 | 3300026557 | Vadose Zone Soil | MGFTRIQIAIAAAAGALLVFGFLGYIWWLSNQGPVLARSEDHDSLTG |
| Ga0208210_1009081 | 3300026683 | Soil | MAFTKAQIGIAVGSGALLVFGFVGYLWWLSNQGPVLARSEEK |
| Ga0209220_10789321 | 3300027587 | Forest Soil | MAFTRNQIGIAVGAGALLVLVFLGYVWWLSNQGPVLARSEDRDP |
| Ga0209106_11558912 | 3300027616 | Forest Soil | MASTRSQIGIAVGAGVLLVLGFLGYVWWLNNQGPVLARSEDHDPLTG |
| Ga0209007_10722751 | 3300027652 | Forest Soil | MAFTKTQIGIAVGAGLLLVAVFLGYVWWLSDQGPVLAR |
| Ga0209448_100486081 | 3300027783 | Bog Forest Soil | MAFTKTQIGIAVGAGVLLVLVFVGYLLWLSNQGPVLARSDDHD |
| Ga0209580_102563302 | 3300027842 | Surface Soil | MAVTRTQIGIAVGTGALLVFGFVGYLWWLSNQGPVLARSDDHDPL |
| Ga0209580_103162742 | 3300027842 | Surface Soil | MAVTRTQIGIAVGAGVLLVLVFVGYLFWLSNQGPVL |
| Ga0209274_103897652 | 3300027853 | Soil | MAFTRTQIGIAVGAGVLLVAVFLGYVWWLSDQGPVLARSEERDPLSG |
| Ga0209590_108834781 | 3300027882 | Vadose Zone Soil | MGFTRTQIAIAVGAGALLVFGFLGYIWWLSNQGPVLARSVDHDSLT |
| Ga0209590_110233301 | 3300027882 | Vadose Zone Soil | MGFTRTQIGIAAGAGVLLVGIFVGYLWWLSNQGPVLA |
| Ga0209275_105289302 | 3300027884 | Soil | MAFTRTQIAIAVGVGALLVFGFVGYLWWLSNQGPVWARSEDKDPL |
| Ga0209067_105194561 | 3300027898 | Watersheds | MAFTRTQIGIAVGVGALLVFGFVGYLWWLSNQGPVLARSEDK |
| Ga0209006_101463781 | 3300027908 | Forest Soil | MAFTRTQIGIAVGAGVLLVGVFVGYIWWLSNQGPV |
| Ga0302147_103178622 | 3300028566 | Bog | MGFTRTQIGIAVGAGALLVFGFLGYIWWLSNQGPVLARSED |
| Ga0302156_102915702 | 3300028748 | Bog | MGFTRIQIGIAVGVAAVLVFGFLGYINWLSNQGPVLARS |
| Ga0302226_101918472 | 3300028801 | Palsa | MAFTRTQIGIAVGVGALLVFGFLGYIWWLSNQGPVLARSDDHDP |
| Ga0302218_100293273 | 3300028863 | Palsa | MAFTRTQIGIAVGVGALLVFGFLGYIWWLSNQGPV |
| Ga0308309_107782082 | 3300028906 | Soil | MGFTRTQIGIAVGVGALMVFGFLGYIWWLSNQGPV |
| Ga0311368_102822821 | 3300029882 | Palsa | MGFTRTQIGIAVGVAALLVFGFLGYIWWLSDQGPVLARSEDHDP |
| Ga0311358_105681762 | 3300029915 | Bog | MGFTRTQIGIAVGAAALLVFGFLGYIWWLSNQGPVLARSEERDSLSGLP |
| Ga0311340_101695475 | 3300029943 | Palsa | MAFTRTQIGIAVGAGVLLVAVFLGYVWWLSDQGPVLARSEEHDPLSGLPV |
| Ga0302179_100298251 | 3300030058 | Palsa | MAFTRTQIGIAVGAGVLLVAVFLGYVWWLSDQGPV |
| Ga0311370_1001262424 | 3300030503 | Palsa | MGFTRTQIGIAVGVAALLVFGFLGYIWWLSDQGPV |
| Ga0311372_113981212 | 3300030520 | Palsa | MGFTRTQIGIAVGVAALLVFGFLGYIWWLSDQGPVLARSEDHDPLT |
| Ga0311355_102950181 | 3300030580 | Palsa | MGFTRTQIGIAIGAGALLVLVFLGYIWWLSNQGPVLA |
| Ga0310038_102422531 | 3300030707 | Peatlands Soil | MAFTRTQIGIAVGAGVLLVLVFVGYLWWLSDQGPVLARSEDHDPLTGLPV |
| Ga0265746_10417592 | 3300030815 | Soil | MAFTRNQIGIAVGAGALLVFGFLGYIWWLNSQGPVLARSP |
| Ga0170823_126037271 | 3300031128 | Forest Soil | MAATRTQIGIAAGTGALLVAVFLGYLWWLNGQGPV |
| Ga0302325_110367783 | 3300031234 | Palsa | MGFTRTQIGIAVGAAALLVFGFLGYIWWLSNQGPVLARSEDHDPLTGLPV |
| Ga0302324_1016729532 | 3300031236 | Palsa | MGFTRIQIGIAVGVAAVLVFSFLGYINWLSNQGPVL |
| Ga0265332_101358172 | 3300031238 | Rhizosphere | MAFTRTQIGIAVGAGVLLVGVFVGYLWWLSNQGPVL |
| Ga0265325_102394811 | 3300031241 | Rhizosphere | MAFTRVQIGIAVGAGVLLVGIFVGYLWWLSNQGPVLARSEDHDPLTG |
| Ga0170820_155481461 | 3300031446 | Forest Soil | MAFTRTQIGIAAGAGVLLVGIFVGYLWWLSNQGPVLARSEDHDPLT |
| Ga0170818_1018156013 | 3300031474 | Forest Soil | MAFTRTQIGIAVGAGTLLVCVFLGYLWWLSNQGPVLA |
| Ga0310686_1052028382 | 3300031708 | Soil | MAFTRTQIAIAVTAGALLVFGFLGYIWWLSNQGPV |
| Ga0310686_1112902342 | 3300031708 | Soil | MGFTRIQIGIAVGVAALLVFGFLGYIWWLSNQGPVLAR |
| Ga0265314_103343442 | 3300031711 | Rhizosphere | MAFTRTQIGIAVGAGVLVVGVFVGYLWWLSNQGPVLARSDDHDPLTGLPV |
| Ga0307478_115252511 | 3300031823 | Hardwood Forest Soil | MAFTKTQIGIAVGAGALLVLVFVGYLWWLNNQGPVLARSDDHDPL |
| Ga0307470_107807351 | 3300032174 | Hardwood Forest Soil | MGFTRTQIAIAAAAGALLVFGFLGYFWWLSNQGPVLARSEDHDSL |
| Ga0335085_109032491 | 3300032770 | Soil | MAFTRTQIGIAAGTGFLLVFVFVGYLWWLSNQGPVLARS |
| Ga0335080_119842272 | 3300032828 | Soil | MAFTKTQIGIAVGAGALLVFVFVGYLWWLSNQGPVLARS |
| Ga0335081_106249181 | 3300032892 | Soil | MAFTKTQIGIAVGAGALLVFVFVGYLWWLSNQGPVLARSEDH |
| Ga0335081_123809512 | 3300032892 | Soil | MAFSKTHIGIAVGAGSLLVLVFVGYLWWLNNQGPVLARSEDKDP |
| Ga0335072_114792162 | 3300032898 | Soil | MAFTKTQIGIASATAALLVLGFVGYLWWLSSQGPVLARSDE |
| Ga0335076_102337241 | 3300032955 | Soil | MGSFSKTQIGIAVGTALVLVLAFVGYFWWLSNQGPV |
| Ga0334790_033114_2_118 | 3300033887 | Soil | MAFTRVQIGIAVGAGVLLVGVFVGYLWWLSNQGPVLARS |
| Ga0334792_065658_3_110 | 3300033888 | Soil | MAFTRTQIGIAVGTGTLLVMVFVGYLWWLSNQGPVL |
| Ga0370484_0097940_651_761 | 3300034125 | Untreated Peat Soil | MAFTRTQIGIAVGTGSLLVLVFVGYIWWLSNQGPVLA |
| Ga0370515_0008491_1_141 | 3300034163 | Untreated Peat Soil | MAFTRTQIGIAVGAGVLLVGVFVGYLWWLSNQGPVLARSEDHDPLTG |
| Ga0370515_0404977_433_576 | 3300034163 | Untreated Peat Soil | MGFTRIQIGIAVGAASLLVFGFLGYIWWLSKQGPVLARSEERDSLSGL |
| Ga0370515_0490705_384_518 | 3300034163 | Untreated Peat Soil | MGFTRIQIGIAVGVAALLVCGFLGYINWLSNQGPVLARSEERDTL |
| Ga0370514_164102_3_149 | 3300034199 | Untreated Peat Soil | MAFTRTQIGISVGAGFLLVAVFLGYVWWLSDQGPVLARSEERAPLSGLP |
| ⦗Top⦘ |