NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F065951

Metagenome Family F065951

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065951
Family Type Metagenome
Number of Sequences 127
Average Sequence Length 44 residues
Representative Sequence MPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAFL
Number of Associated Samples 112
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 88.80 %
% of genes near scaffold ends (potentially truncated) 97.64 %
% of genes from short scaffolds (< 2000 bps) 91.34 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.969 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(10.236 % of family members)
Environment Ontology (ENVO) Unclassified
(29.921 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(28.346 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF00005ABC_tran 48.03
PF14332DUF4388 0.79
PF00756Esterase 0.79
PF13304AAA_21 0.79
PF03951Gln-synt_N 0.79
PF06724DUF1206 0.79
PF01596Methyltransf_3 0.79
PF13522GATase_6 0.79
PF13732DUF4162 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG0174Glutamine synthetaseAmino acid transport and metabolism [E] 0.79
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.79
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.79
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.97 %
UnclassifiedrootN/A48.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000443|F12B_10117388All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300001213|JGIcombinedJ13530_106172849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300003471|FeGluNO3_10377797All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300004026|Ga0055443_10145211Not Available711Open in IMG/M
3300004055|Ga0055480_10395848Not Available558Open in IMG/M
3300004114|Ga0062593_103433470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300004157|Ga0062590_100569823Not Available986Open in IMG/M
3300004157|Ga0062590_102247744All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300004480|Ga0062592_101182280Not Available714Open in IMG/M
3300004808|Ga0062381_10426244All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005186|Ga0066676_10201128Not Available1281Open in IMG/M
3300005295|Ga0065707_10521057Not Available736Open in IMG/M
3300005345|Ga0070692_11223749All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005354|Ga0070675_101182663All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes704Open in IMG/M
3300005355|Ga0070671_100548405Not Available997Open in IMG/M
3300005406|Ga0070703_10507260All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005444|Ga0070694_101951499All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005445|Ga0070708_101271575Not Available688Open in IMG/M
3300005447|Ga0066689_10965734All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005518|Ga0070699_100638507Not Available971Open in IMG/M
3300005549|Ga0070704_101305366Not Available664Open in IMG/M
3300005578|Ga0068854_101475441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300005830|Ga0074473_10032335All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300005836|Ga0074470_10750225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300006177|Ga0075362_10776610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300006237|Ga0097621_101423335Not Available657Open in IMG/M
3300006796|Ga0066665_10574579Not Available912Open in IMG/M
3300006844|Ga0075428_102212815All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300006845|Ga0075421_100656514All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300006969|Ga0075419_11537356All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300009012|Ga0066710_101169580Not Available1191Open in IMG/M
3300009091|Ga0102851_13535811Not Available502Open in IMG/M
3300009094|Ga0111539_10051573All Organisms → cellular organisms → Bacteria4900Open in IMG/M
3300009094|Ga0111539_13300703All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300009100|Ga0075418_11192274Not Available825Open in IMG/M
3300009100|Ga0075418_11801544Not Available666Open in IMG/M
3300009100|Ga0075418_12601237All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300009146|Ga0105091_10061471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1682Open in IMG/M
3300009147|Ga0114129_13480871All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300009788|Ga0114923_11270786Not Available572Open in IMG/M
3300009812|Ga0105067_1038398Not Available726Open in IMG/M
3300009815|Ga0105070_1096554All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300009873|Ga0131077_11658728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300010360|Ga0126372_12239604Not Available596Open in IMG/M
3300010360|Ga0126372_13004254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300010400|Ga0134122_12476902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300010403|Ga0134123_10809138Not Available932Open in IMG/M
3300010403|Ga0134123_11001750Not Available851Open in IMG/M
3300010403|Ga0134123_11805394Not Available665Open in IMG/M
3300011402|Ga0137356_1004684All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2322Open in IMG/M
3300012171|Ga0137342_1032763Not Available999Open in IMG/M
3300012202|Ga0137363_11420993All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300012351|Ga0137386_10527998Not Available850Open in IMG/M
3300012684|Ga0136614_10187042All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300012893|Ga0157284_10258239All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300012899|Ga0157299_10234397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300012912|Ga0157306_10024076Not Available1335Open in IMG/M
3300014304|Ga0075340_1142008All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300014324|Ga0075352_1081525Not Available820Open in IMG/M
3300014881|Ga0180094_1055734Not Available852Open in IMG/M
3300014885|Ga0180063_1303786All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300015371|Ga0132258_10503880All Organisms → cellular organisms → Bacteria3028Open in IMG/M
3300018059|Ga0184615_10564374Not Available601Open in IMG/M
3300018064|Ga0187773_10406006Not Available790Open in IMG/M
3300018079|Ga0184627_10279368Not Available877Open in IMG/M
3300018476|Ga0190274_11435622Not Available780Open in IMG/M
3300019458|Ga0187892_10558219All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300021090|Ga0210377_10071583All Organisms → cellular organisms → Bacteria2359Open in IMG/M
3300021090|Ga0210377_10820762All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300022213|Ga0224500_10237098All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium667Open in IMG/M
3300022213|Ga0224500_10387020All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300022756|Ga0222622_11162579All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300025312|Ga0209321_10119672Not Available1436Open in IMG/M
3300025322|Ga0209641_10211731Not Available1453Open in IMG/M
3300025823|Ga0210123_1247267All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300025923|Ga0207681_11231950All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300025926|Ga0207659_11868822All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300025981|Ga0207640_10519911All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300025985|Ga0210117_1052219All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium681Open in IMG/M
3300026088|Ga0207641_10969612Not Available846Open in IMG/M
3300026116|Ga0207674_11232742Not Available718Open in IMG/M
3300026118|Ga0207675_100320922All Organisms → cellular organisms → Bacteria1512Open in IMG/M
3300026118|Ga0207675_102192524All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300026306|Ga0209468_1131468Not Available716Open in IMG/M
3300026319|Ga0209647_1048664All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2301Open in IMG/M
3300026324|Ga0209470_1250939Not Available709Open in IMG/M
3300026328|Ga0209802_1047248All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2152Open in IMG/M
3300026357|Ga0256810_1027245Not Available739Open in IMG/M
3300027871|Ga0209397_10456641Not Available631Open in IMG/M
3300027880|Ga0209481_10748130All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300027907|Ga0207428_10044641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3575Open in IMG/M
3300028380|Ga0268265_11001235Not Available825Open in IMG/M
3300028381|Ga0268264_12076167All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300028791|Ga0307290_10104537Not Available1033Open in IMG/M
3300028793|Ga0307299_10247230Not Available670Open in IMG/M
3300028870|Ga0302254_10035610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1772Open in IMG/M
3300031728|Ga0316578_10063354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2181Open in IMG/M
3300031873|Ga0315297_10690524Not Available855Open in IMG/M
3300031873|Ga0315297_11485839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300031908|Ga0310900_10107316All Organisms → cellular organisms → Bacteria1806Open in IMG/M
3300032012|Ga0310902_11194813Not Available535Open in IMG/M
3300032251|Ga0316198_10238801Not Available1042Open in IMG/M
3300032251|Ga0316198_10625148All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300032263|Ga0316195_10613319All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300032782|Ga0335082_10403615Not Available1231Open in IMG/M
3300032829|Ga0335070_11700204Not Available572Open in IMG/M
3300032955|Ga0335076_11752067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300033004|Ga0335084_10734020Not Available1005Open in IMG/M
3300033413|Ga0316603_11058168Not Available767Open in IMG/M
3300033416|Ga0316622_101320753Not Available843Open in IMG/M
3300033416|Ga0316622_103191664All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300033429|Ga0316193_10045048All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3429Open in IMG/M
3300033481|Ga0316600_10393999Not Available949Open in IMG/M
3300033481|Ga0316600_10574561Not Available787Open in IMG/M
3300033482|Ga0316627_101237970Not Available740Open in IMG/M
3300033482|Ga0316627_102632411All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300033486|Ga0316624_10821077Not Available827Open in IMG/M
3300033489|Ga0299912_10843347Not Available697Open in IMG/M
3300033803|Ga0314862_0183794All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300033811|Ga0364924_082692Not Available714Open in IMG/M
3300034081|Ga0373911_036110Not Available836Open in IMG/M
3300034099|Ga0373902_056975Not Available826Open in IMG/M
3300034147|Ga0364925_0094444Not Available1056Open in IMG/M
3300034149|Ga0364929_0365318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300034165|Ga0364942_0214819All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil10.24%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.72%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment3.15%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.15%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.15%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.15%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.36%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.57%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.57%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.57%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.57%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.57%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.57%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.57%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.57%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.57%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry1.57%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.79%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.79%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.79%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.79%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.79%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.79%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.79%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.79%
Wetland SedimentEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.79%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.79%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.79%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.79%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.79%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003471Fe-reducing enrichment culture from wetland. Sample 5 with periodic nitrate additions.EnvironmentalOpen in IMG/M
3300004026Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2EnvironmentalOpen in IMG/M
3300004055Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009788Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaGEnvironmentalOpen in IMG/M
3300009812Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60EnvironmentalOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300014304Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025823Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025985Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026357Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU5EnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028870Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4EnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031728Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrCHost-AssociatedOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032251Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxicEnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300034081Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.3EngineeredOpen in IMG/M
3300034099Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3EngineeredOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F12B_1011738823300000443SoilMPIYEQTYRKYEAREPLRTVRFWPITREALRLILSKR
JGIcombinedJ13530_10617284913300001213WetlandMPIYDQGYRRREGRGPLRSVRFWPITREALRLILARRAFLALLA
FeGluNO3_1037779723300003471Wetland SedimentMPIYDQGYRRYVARAPLHRARFWPITREALRLVLAKRAFLGLL
Ga0055443_1014521123300004026Natural And Restored WetlandsMPIYDQGYRRYEARGPLRQVRFWPITREALRMILSKRAFLGL
Ga0055480_1039584823300004055Natural And Restored WetlandsMPVYEQSYRSHEARAPIRQVRFWPILREGLRLLLARKALL
Ga0062593_10343347013300004114SoilMPIYEQSYRRYEARAPLRRVRFWPITREALRLILAKRAFLGLLALSWLPFLGF
Ga0062590_10056982313300004157SoilMPIYDQTYRRYEARGPLRTLRFWPITREGLRLVLVRRWFVALVAAAWVPFLVQVI
Ga0062590_10224774423300004157SoilMPIYEQSYRRHEARGALRRVRFWPITREALRLLLARRLFLMLLF
Ga0062592_10118228013300004480SoilVPIYDQSYRRYEAREALRRVRFWPITREALRLILAKRAFLGL
Ga0062381_1042624413300004808Wetland SedimentMPIYEQGYRRWEARGPLSRVRFWPITREALRTVLSRRPFLLLLFASFIPFLVRVAQ
Ga0066676_1020112833300005186SoilVPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRAFLILLMMSWLPFV
Ga0065707_1052105723300005295Switchgrass RhizosphereMPIYDQGYRRYEARGPLRKARFWPITREALRLVLVKRWFLALLTA
Ga0070692_1122374923300005345Corn, Switchgrass And Miscanthus RhizosphereMPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAFLGLLLVAWGQFLF
Ga0070675_10118266323300005354Miscanthus RhizosphereMPIYDQTYRRYEARGPLRALRFWPITREALRLVLVRRWFLALLAAAW
Ga0070671_10054840523300005355Switchgrass RhizosphereMPIYEQTYRRYEARAPLRAVRFWPITREALRLILARRAFLGLLLVAWGQFLFRV
Ga0070703_1050726013300005406Corn, Switchgrass And Miscanthus RhizosphereVPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRAFLILLMMSWVPF
Ga0070694_10195149923300005444Corn, Switchgrass And Miscanthus RhizosphereMPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAFL
Ga0070708_10127157523300005445Corn, Switchgrass And Miscanthus RhizosphereMPIYEQTYRRHEARGALRRVRFWPITREALRLILARRWFL
Ga0066689_1096573423300005447SoilMPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRWFLALLA
Ga0070699_10063850723300005518Corn, Switchgrass And Miscanthus RhizosphereLPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRWFLA
Ga0070704_10130536623300005549Corn, Switchgrass And Miscanthus RhizosphereMPIYEQTYRRYEAREPLRQLRFWPITREGLRLILAKRAFLILLIVA
Ga0068854_10147544123300005578Corn RhizosphereMPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAF
Ga0074473_1003233523300005830Sediment (Intertidal)MPIYDQTYRKYDAREPLRSVRFWPIPREALRLHLM
Ga0074470_1075022523300005836Sediment (Intertidal)MPIYEQAYRKYEAREGPRQVRFWPITREALRLVLAKRAFI
Ga0075362_1077661023300006177Populus EndosphereVPIYDRTYRRHEARGPLRRVRFWPITREALRLVLARRAFLALLAASWIPFLVRVVQI
Ga0097621_10142333513300006237Miscanthus RhizosphereMPIYEQTYRRYEARAPLRAVRFWPITREALRLILARRAF
Ga0066665_1057457913300006796SoilVPIYEQTYRKHEARGPLRRVRSWPITREALRLILARRAFLALLVFSWLPCV
Ga0075428_10221281513300006844Populus RhizosphereMPIYEQTYRRYQAREPLRRFRFWPITREVLRTLLAKRAF
Ga0075421_10065651433300006845Populus RhizosphereMPIYEQTYRRYEARAPLRRLRFWPITREALRLILAKRAFLGLLLLCWLP
Ga0075419_1153735613300006969Populus RhizosphereMPVYDQGYRRHQARRPLRALRFWPITREALRLLLRRWTLLGLLVLA
Ga0066710_10116958033300009012Grasslands SoilMPIYDQGYRPYEARQPLRTLRFWPITREALRLLLARRAFLILLA
Ga0102851_1353581123300009091Freshwater WetlandsMPVYDQGYRRYEARHPLRTVRFWPIVREALRGLFTRKAFLAL
Ga0111539_1005157313300009094Populus RhizosphereMPIYDQTYRRYEARGPLRALRFWPITREALRLVLVRRWFLALLA
Ga0111539_1330070323300009094Populus RhizosphereMPIYDQGYRRYEARGPLRKARFWPITREALRLVLSKRAFLGLLLAGFI
Ga0075418_1119227413300009100Populus RhizosphereLPIYDQTYRRYEARAPLRRARFWPITREALRLILARRWFLALLVAAWVPFVV
Ga0075418_1180154413300009100Populus RhizosphereMPIYEQAYRKYEARAEARAIRFWPITREALRLVLSRRAFIGLMVVGF
Ga0075418_1260123723300009100Populus RhizosphereMPIYDQTYRRYEARGALRPIRFWPITREALRLILA
Ga0105091_1006147143300009146Freshwater SedimentMPIYDQGYRHYQARSPLHKARFWPITREALRLVLMKRAFLGLIAA
Ga0114129_1348087123300009147Populus RhizosphereVPIYQQGYRPYQARGPLRGVRFWPITREALRLILARRAFLGLLVLSW
Ga0114923_1127078613300009788Deep SubsurfaceMPIYEQSYRRHEARAPLRSVRFWPITREALRLILVKRAFLGLLAMGWLPAGCCTASPWPS
Ga0105067_103839813300009812Groundwater SandMPIYEQAYRKYEARAPLRQVRFWPITREALRLVLAKRAFIVLLLACLIPFVVRVVQI
Ga0105070_109655413300009815Groundwater SandMPIYEQAYRKYEARAPLRQVRFWPITREALRLVLAKRAFIVL
Ga0131077_1165872823300009873WastewaterMPVYDQGYRRYEARHPLRRVRFWPIVREALRGLVTRKAFLA
Ga0126372_1223960423300010360Tropical Forest SoilMPIYEQTYRKYEARAPLRQIRFWPITREALRLVLAPRLFLVLLLASYLPF
Ga0126372_1300425423300010360Tropical Forest SoilVPIYEQTYRRYEARGPLRALRFWPITREALRILLARRAFL
Ga0134122_1247690223300010400Terrestrial SoilMPIYEQSYRRYEARQPLRRVRFWTITREALRLVLVRRMFLALLAVAWLPFVGYVPFSE
Ga0134123_1080913813300010403Terrestrial SoilMPIYDQVYRRYEARGPLRALRFWPITREGLRLVLVRRWFLALLAAAWV
Ga0134123_1100175013300010403Terrestrial SoilVPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRAFLILLMMS
Ga0134123_1180539423300010403Terrestrial SoilVPIYEQSYRRYEARGPLRTVRFWPIAREALRHVLAKRAFLGLLAL
Ga0137356_100468433300011402SoilMPIYDQGYRRYEARSPLHQTRFWPITHEALRLVLAKRAFLRLLAVSFLPFV
Ga0137342_103276313300012171SoilMPIYEQAYRKYEARSPLRAVRFWPITREALRLILAKRAFIGLLIGAWIP
Ga0137363_1142099323300012202Vadose Zone SoilMPIYEQSYRRYEARGPLRTVRFWPITREALRLILSRKAFLVLLMIAWTPFLWRVI
Ga0137386_1052799823300012351Vadose Zone SoilLPIYDQSYRRHEARGPLRRARFWPITREALRLILARRAFLILLMMSWLPFAMRL
Ga0136614_1018704233300012684Polar Desert SandMPIYDQSYRRYEAREPLRKVRFWPITREALRLILARRALLGLL
Ga0157284_1025823913300012893SoilMPIYEQTYRRYEARAPLRAVRFWPITREALRLILARRAFLGLLL
Ga0157299_1023439723300012899SoilMPIYDQTYRRYEARGPLRALRFWPITREALRLVLVRR
Ga0157306_1002407613300012912SoilMPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAFLGLLLVAWGQF
Ga0075340_114200813300014304Natural And Restored WetlandsMPIYDQGYRRYVARSPLHRVRFWPITREALRLVLAKRAFLGLLAA
Ga0075352_108152523300014324Natural And Restored WetlandsMPIYDQTYRRHEARAPLRSVRFWPITREALRLLLQKR
Ga0180094_105573413300014881SoilMPIYEQAYRKYEARSPLRTVRFWPITREALRLILVNRA
Ga0180063_130378613300014885SoilMPIYDQSYRKHLARGPLRQLRFWPIAREGLRLVLVKRAFLVLLGFSFIPF
Ga0132258_1050388013300015371Arabidopsis RhizosphereMPIYEQSYRRYEARAPLRRVRFWPITREALRLILAKRAFL
Ga0184615_1056437413300018059Groundwater SedimentLPIYEQSYRRYEAREPLRTIRFWPIAREALVHVLAKRAFLGLLALSWLPF
Ga0187773_1040600613300018064Tropical PeatlandMPIYDQGYRKYEARGPLRKARFWPITREALRLILVKRAFL
Ga0184627_1027936813300018079Groundwater SedimentMPIYDQAYRRWEARGPLRRVRFWPITRESLRLILSKRAFL
Ga0190274_1143562213300018476SoilMPVYEQTYRRYEARQPLRTVRFWPITREALRLLLSKWAFLGLVILCWVPFLAFAIYVW
Ga0187892_1055821923300019458Bio-OozeMPIYEQTYRRYEARAPLTRFRFWPITREALRLVLMKRAFLGLLAVSFLPFLFQVGWVYVV
Ga0210377_1007158313300021090Groundwater SedimentMPIYDQGYRRYEARAPLRKARFWPITREALRLVLS
Ga0210377_1082076213300021090Groundwater SedimentMPIYDQTYRKYDARGPLRSVRFWPITREGLRLLLAKKAFLALWAACWLPFIGFVI
Ga0224500_1023709813300022213SedimentMPIYDQGYRRYEARSPLHQIRFWPITREALRLILAKRAFLFLLAPPLIVFLFYVG
Ga0224500_1038702023300022213SedimentMPIYDQGYRRYEARAPLRTARFWPITREALRMVLQKRAFLGLLAAAF
Ga0222622_1116257923300022756Groundwater SedimentMPIYDQTYRRYEARGPLRRLRFWPITREALRLVLARRWFLALLVA
Ga0209321_1011967213300025312SoilMPIYDQGYRRYEARAPLRRLRFWPITREALRLILAK
Ga0209641_1021173113300025322SoilMPIYDQGYRRYEARAPLRKARFWPITREALRLVLSKRAFLGLIAAAFL
Ga0210123_124726713300025823Natural And Restored WetlandsMPVYEQSYRSHEARAPIRQVRFWPILREGLRLLLARKAL
Ga0207681_1123195023300025923Switchgrass RhizosphereMPIYDQTYRRYEARGPLRALRFWPITREGLRLVLVRRWFLALLAAAW
Ga0207659_1186882223300025926Miscanthus RhizosphereMPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRA
Ga0207640_1051991133300025981Corn RhizosphereMPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRVF
Ga0210117_105221923300025985Natural And Restored WetlandsMPIYEQAYRRYEARGPLRRLRFWPITREALRLLLAGRWF
Ga0207641_1096961213300026088Switchgrass RhizosphereMPIYEQSYRRWEARGPLREARFLPITREALRLILSRRAFLL
Ga0207674_1123274213300026116Corn RhizosphereMPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRVFLGLLLVAWVPVLWQ
Ga0207675_10032092213300026118Switchgrass RhizosphereMPIYEQAYRRWESRGPLRQIRFLPITREALRLILARR
Ga0207675_10219252423300026118Switchgrass RhizosphereMPIYEQTYRRYEARAPLRRLRFWPITREALRLILAKRAFLGLLLLC
Ga0209468_113146813300026306SoilLPIYEQTYRRHEARGALRRVRFWPITREALRLILA
Ga0209647_104866443300026319Grasslands SoilMPIYEQTYRRYEARAPLRTLRFWPITREALRLILARRAFMGLLLVAWGQFLV
Ga0209470_125093913300026324SoilVPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRA
Ga0209802_104724813300026328SoilMPIYEQTYRRYEARGPLRTVRFWPITREALRLVLAR
Ga0256810_102724513300026357SedimentMPIYDQGYRRYQARAPLRKARFWPITREALRLVLARRWFLILMSI
Ga0209397_1045664123300027871WetlandMPIYDQGYRRYEARSPLHQVRFWPITREALRMVLAK
Ga0209481_1074813023300027880Populus RhizosphereMPIYDQGYRRYEARAPLRKARFWPITREALRLVLLRRWFLGL
Ga0207428_1004464143300027907Populus RhizosphereMPIYEQSYRRWEARGPLRAARFLPITREALRLLLA
Ga0268265_1100123513300028380Switchgrass RhizosphereMPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAFLGLLL
Ga0268264_1207616723300028381Switchgrass RhizosphereMPIYDQTYRRYEARGPLRALRFWPITREALRLVLVRRWFLALLAAAWLPF
Ga0307290_1010453713300028791SoilLPIYEQTYRRHEARGALRRVRFWPITREALRLILARR
Ga0307299_1024723013300028793SoilLPIYEQTYRRHEARGALRRVRFWPITREALRLILARRWFLE
Ga0302254_1003561013300028870FenMPIYEQGYRRYVARAALHTTRFWPITREALRLLLQKRLFT
Ga0311350_1184514413300030002FenMPIYEQGYRRYVARAALHTTRFWPITREALRLLLQKRLFTLFLLGSLSPLAV
Ga0316578_1006335433300031728RhizosphereMPIYDQGYRRYEAREALRQIRFWPITREALKLILSKRAF
Ga0315297_1069052423300031873SedimentMPIYDQGYRRYEARAPLRKARFWPITREALRLVLSKRAFLGLIAAAFLP
Ga0315297_1148583923300031873SedimentMPIYDQGYRRYEARSPLHQVRFWPITREALRLILAKRAFLGLL
Ga0310900_1010731613300031908SoilMPIYEQSYRRWEARGPLRAARFLPITREALRLLLARKAFLLLLIAA
Ga0310902_1119481313300032012SoilMPIYEQAYRKYEARAEARAIRFWPITREALRLVLS
Ga0316198_1023880123300032251SedimentMPIHDQSYRRYEARGPLRSVRFWPITREALRLILVR
Ga0316198_1062514823300032251SedimentMPIYDQGYRRYEARGALRQVRFWPITREALRLILSKRAFLGL
Ga0316195_1061331913300032263SedimentMPIYDQGYRRYEARGPLRQVRFWPITREALRMILSKRAFLG
Ga0335082_1040361523300032782SoilMPIYDQGYRRYVARSPLQAARFWPITREALRMILSKRAF
Ga0335070_1170020413300032829SoilMPIYDQGYRRYEARSPLHQIRFWPITREALRMILLKRAFLALIAVSFVPFLV
Ga0335076_1175206723300032955SoilMPIYDQAYRKYEAREAARRVRFWPITREALRLVLAKR
Ga0335084_1073402013300033004SoilMPIYDQGYRRYEARQPLRRARFWPITREAMRIILAKRWFLVLLA
Ga0316603_1105816813300033413SoilMPIYDQGYRRYEARGPLHQIRFWPITREALRLILAKRAFLSL
Ga0316622_10132075323300033416SoilMPIYDQGYRRYEARGPLRTLRFWPITREALRLVLSR
Ga0316622_10319166423300033416SoilMPIYDQGYRRYLARSPLHKARFWPITREALRLVLAKRAFLGLL
Ga0316193_1004504813300033429SedimentMPIYDQGYRRYEAREPLHQLRFWPITREALRLVLAKRAFLGLLAVSFLP
Ga0316600_1039399923300033481SoilMPIYDQGYRHYEARSPLHRARFWPITREALRLILAKRAFLG
Ga0316600_1057456113300033481SoilMPIYDQGYRRYVARSPLHRLRFWPITREALRSFAQRRFFVM
Ga0316627_10123797013300033482SoilMPIYDQGYRRYEARAPLRKARFWPITREALRLVLSKRAFLG
Ga0316627_10263241113300033482SoilMPIYDQGYRRYEARSPLHQIRFWPITREALRLILA
Ga0316624_1082107713300033486SoilMPIYDQGYRRYEARGPLHQIRFWPITREALRLILAK
Ga0316621_1142644913300033488SoilMPIYDQGYRRYEARGPLHQIRFWPITREALRLILAKRAFLSLLAPPLAVLLFYVGR
Ga0299912_1084334723300033489SoilMPIYDRGYRRYEARAPLHQIRFWPITREALRMILAKRAFLILLAVSFLPF
Ga0314862_0183794_402_5153300033803PeatlandMPVYDQSYRRYQARRPLRDLRFWPITREALRMILNRRA
Ga0364924_082692_597_7133300033811SedimentMPIYEQTYRRHQERAPLRKTRFWPITREALRLLLSRKIF
Ga0373911_036110_710_8353300034081Sediment SlurryMPIYDQGYRRYEARGPLHQIRFWPITREALRLILAKRAFLGL
Ga0373902_056975_1_1263300034099Sediment SlurryMPIYDQGYRRYEARAPLHQIRFWPITREALRMILLKRAFLAL
Ga0364925_0094444_947_10543300034147SedimentMPIYDQGYRRYEARSPLHRARFWPITREALRLILAK
Ga0364929_0365318_391_5013300034149SedimentMPIYDQGYRRYVARLPLHKARFWPITREALRLILAKR
Ga0364942_0214819_2_1693300034165SedimentMPIYDQGYRRYEARAPLRKARFWPITREALRLVLLRRWFLGLVAGAFVPFIIRVGQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.