Basic Information | |
---|---|
Family ID | F065951 |
Family Type | Metagenome |
Number of Sequences | 127 |
Average Sequence Length | 44 residues |
Representative Sequence | MPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAFL |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 88.80 % |
% of genes near scaffold ends (potentially truncated) | 97.64 % |
% of genes from short scaffolds (< 2000 bps) | 91.34 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (51.969 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (10.236 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.921 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (28.346 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 48.03 |
PF14332 | DUF4388 | 0.79 |
PF00756 | Esterase | 0.79 |
PF13304 | AAA_21 | 0.79 |
PF03951 | Gln-synt_N | 0.79 |
PF06724 | DUF1206 | 0.79 |
PF01596 | Methyltransf_3 | 0.79 |
PF13522 | GATase_6 | 0.79 |
PF13732 | DUF4162 | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.79 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.79 |
COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 51.97 % |
Unclassified | root | N/A | 48.03 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000443|F12B_10117388 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300001213|JGIcombinedJ13530_106172849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300003471|FeGluNO3_10377797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300004026|Ga0055443_10145211 | Not Available | 711 | Open in IMG/M |
3300004055|Ga0055480_10395848 | Not Available | 558 | Open in IMG/M |
3300004114|Ga0062593_103433470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300004157|Ga0062590_100569823 | Not Available | 986 | Open in IMG/M |
3300004157|Ga0062590_102247744 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300004480|Ga0062592_101182280 | Not Available | 714 | Open in IMG/M |
3300004808|Ga0062381_10426244 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005186|Ga0066676_10201128 | Not Available | 1281 | Open in IMG/M |
3300005295|Ga0065707_10521057 | Not Available | 736 | Open in IMG/M |
3300005345|Ga0070692_11223749 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300005354|Ga0070675_101182663 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 704 | Open in IMG/M |
3300005355|Ga0070671_100548405 | Not Available | 997 | Open in IMG/M |
3300005406|Ga0070703_10507260 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300005444|Ga0070694_101951499 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005445|Ga0070708_101271575 | Not Available | 688 | Open in IMG/M |
3300005447|Ga0066689_10965734 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300005518|Ga0070699_100638507 | Not Available | 971 | Open in IMG/M |
3300005549|Ga0070704_101305366 | Not Available | 664 | Open in IMG/M |
3300005578|Ga0068854_101475441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300005830|Ga0074473_10032335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300005836|Ga0074470_10750225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300006177|Ga0075362_10776610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300006237|Ga0097621_101423335 | Not Available | 657 | Open in IMG/M |
3300006796|Ga0066665_10574579 | Not Available | 912 | Open in IMG/M |
3300006844|Ga0075428_102212815 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300006845|Ga0075421_100656514 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300006969|Ga0075419_11537356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300009012|Ga0066710_101169580 | Not Available | 1191 | Open in IMG/M |
3300009091|Ga0102851_13535811 | Not Available | 502 | Open in IMG/M |
3300009094|Ga0111539_10051573 | All Organisms → cellular organisms → Bacteria | 4900 | Open in IMG/M |
3300009094|Ga0111539_13300703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300009100|Ga0075418_11192274 | Not Available | 825 | Open in IMG/M |
3300009100|Ga0075418_11801544 | Not Available | 666 | Open in IMG/M |
3300009100|Ga0075418_12601237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300009146|Ga0105091_10061471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1682 | Open in IMG/M |
3300009147|Ga0114129_13480871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300009788|Ga0114923_11270786 | Not Available | 572 | Open in IMG/M |
3300009812|Ga0105067_1038398 | Not Available | 726 | Open in IMG/M |
3300009815|Ga0105070_1096554 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300009873|Ga0131077_11658728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300010360|Ga0126372_12239604 | Not Available | 596 | Open in IMG/M |
3300010360|Ga0126372_13004254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300010400|Ga0134122_12476902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300010403|Ga0134123_10809138 | Not Available | 932 | Open in IMG/M |
3300010403|Ga0134123_11001750 | Not Available | 851 | Open in IMG/M |
3300010403|Ga0134123_11805394 | Not Available | 665 | Open in IMG/M |
3300011402|Ga0137356_1004684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2322 | Open in IMG/M |
3300012171|Ga0137342_1032763 | Not Available | 999 | Open in IMG/M |
3300012202|Ga0137363_11420993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300012351|Ga0137386_10527998 | Not Available | 850 | Open in IMG/M |
3300012684|Ga0136614_10187042 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
3300012893|Ga0157284_10258239 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300012899|Ga0157299_10234397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300012912|Ga0157306_10024076 | Not Available | 1335 | Open in IMG/M |
3300014304|Ga0075340_1142008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300014324|Ga0075352_1081525 | Not Available | 820 | Open in IMG/M |
3300014881|Ga0180094_1055734 | Not Available | 852 | Open in IMG/M |
3300014885|Ga0180063_1303786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300015371|Ga0132258_10503880 | All Organisms → cellular organisms → Bacteria | 3028 | Open in IMG/M |
3300018059|Ga0184615_10564374 | Not Available | 601 | Open in IMG/M |
3300018064|Ga0187773_10406006 | Not Available | 790 | Open in IMG/M |
3300018079|Ga0184627_10279368 | Not Available | 877 | Open in IMG/M |
3300018476|Ga0190274_11435622 | Not Available | 780 | Open in IMG/M |
3300019458|Ga0187892_10558219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300021090|Ga0210377_10071583 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
3300021090|Ga0210377_10820762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300022213|Ga0224500_10237098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300022213|Ga0224500_10387020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300022756|Ga0222622_11162579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300025312|Ga0209321_10119672 | Not Available | 1436 | Open in IMG/M |
3300025322|Ga0209641_10211731 | Not Available | 1453 | Open in IMG/M |
3300025823|Ga0210123_1247267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300025923|Ga0207681_11231950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300025926|Ga0207659_11868822 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300025981|Ga0207640_10519911 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300025985|Ga0210117_1052219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 681 | Open in IMG/M |
3300026088|Ga0207641_10969612 | Not Available | 846 | Open in IMG/M |
3300026116|Ga0207674_11232742 | Not Available | 718 | Open in IMG/M |
3300026118|Ga0207675_100320922 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300026118|Ga0207675_102192524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300026306|Ga0209468_1131468 | Not Available | 716 | Open in IMG/M |
3300026319|Ga0209647_1048664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2301 | Open in IMG/M |
3300026324|Ga0209470_1250939 | Not Available | 709 | Open in IMG/M |
3300026328|Ga0209802_1047248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2152 | Open in IMG/M |
3300026357|Ga0256810_1027245 | Not Available | 739 | Open in IMG/M |
3300027871|Ga0209397_10456641 | Not Available | 631 | Open in IMG/M |
3300027880|Ga0209481_10748130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300027907|Ga0207428_10044641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3575 | Open in IMG/M |
3300028380|Ga0268265_11001235 | Not Available | 825 | Open in IMG/M |
3300028381|Ga0268264_12076167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300028791|Ga0307290_10104537 | Not Available | 1033 | Open in IMG/M |
3300028793|Ga0307299_10247230 | Not Available | 670 | Open in IMG/M |
3300028870|Ga0302254_10035610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1772 | Open in IMG/M |
3300031728|Ga0316578_10063354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2181 | Open in IMG/M |
3300031873|Ga0315297_10690524 | Not Available | 855 | Open in IMG/M |
3300031873|Ga0315297_11485839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300031908|Ga0310900_10107316 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
3300032012|Ga0310902_11194813 | Not Available | 535 | Open in IMG/M |
3300032251|Ga0316198_10238801 | Not Available | 1042 | Open in IMG/M |
3300032251|Ga0316198_10625148 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300032263|Ga0316195_10613319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300032782|Ga0335082_10403615 | Not Available | 1231 | Open in IMG/M |
3300032829|Ga0335070_11700204 | Not Available | 572 | Open in IMG/M |
3300032955|Ga0335076_11752067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300033004|Ga0335084_10734020 | Not Available | 1005 | Open in IMG/M |
3300033413|Ga0316603_11058168 | Not Available | 767 | Open in IMG/M |
3300033416|Ga0316622_101320753 | Not Available | 843 | Open in IMG/M |
3300033416|Ga0316622_103191664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300033429|Ga0316193_10045048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3429 | Open in IMG/M |
3300033481|Ga0316600_10393999 | Not Available | 949 | Open in IMG/M |
3300033481|Ga0316600_10574561 | Not Available | 787 | Open in IMG/M |
3300033482|Ga0316627_101237970 | Not Available | 740 | Open in IMG/M |
3300033482|Ga0316627_102632411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300033486|Ga0316624_10821077 | Not Available | 827 | Open in IMG/M |
3300033489|Ga0299912_10843347 | Not Available | 697 | Open in IMG/M |
3300033803|Ga0314862_0183794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300033811|Ga0364924_082692 | Not Available | 714 | Open in IMG/M |
3300034081|Ga0373911_036110 | Not Available | 836 | Open in IMG/M |
3300034099|Ga0373902_056975 | Not Available | 826 | Open in IMG/M |
3300034147|Ga0364925_0094444 | Not Available | 1056 | Open in IMG/M |
3300034149|Ga0364929_0365318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300034165|Ga0364942_0214819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.24% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.72% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.72% |
Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 3.15% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.15% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.15% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.15% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 3.15% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.36% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.57% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.57% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.57% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.57% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.57% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.57% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.57% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.57% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.57% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.57% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.79% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.79% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.79% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.79% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.79% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.79% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.79% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.79% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
Wetland Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.79% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.79% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.79% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.79% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300003471 | Fe-reducing enrichment culture from wetland. Sample 5 with periodic nitrate additions. | Environmental | Open in IMG/M |
3300004026 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 | Environmental | Open in IMG/M |
3300004055 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009788 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG | Environmental | Open in IMG/M |
3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011402 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2 | Environmental | Open in IMG/M |
3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025823 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026357 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU5 | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300034081 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.3 | Engineered | Open in IMG/M |
3300034099 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3 | Engineered | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F12B_101173882 | 3300000443 | Soil | MPIYEQTYRKYEAREPLRTVRFWPITREALRLILSKR |
JGIcombinedJ13530_1061728491 | 3300001213 | Wetland | MPIYDQGYRRREGRGPLRSVRFWPITREALRLILARRAFLALLA |
FeGluNO3_103777972 | 3300003471 | Wetland Sediment | MPIYDQGYRRYVARAPLHRARFWPITREALRLVLAKRAFLGLL |
Ga0055443_101452112 | 3300004026 | Natural And Restored Wetlands | MPIYDQGYRRYEARGPLRQVRFWPITREALRMILSKRAFLGL |
Ga0055480_103958482 | 3300004055 | Natural And Restored Wetlands | MPVYEQSYRSHEARAPIRQVRFWPILREGLRLLLARKALL |
Ga0062593_1034334701 | 3300004114 | Soil | MPIYEQSYRRYEARAPLRRVRFWPITREALRLILAKRAFLGLLALSWLPFLGF |
Ga0062590_1005698231 | 3300004157 | Soil | MPIYDQTYRRYEARGPLRTLRFWPITREGLRLVLVRRWFVALVAAAWVPFLVQVI |
Ga0062590_1022477442 | 3300004157 | Soil | MPIYEQSYRRHEARGALRRVRFWPITREALRLLLARRLFLMLLF |
Ga0062592_1011822801 | 3300004480 | Soil | VPIYDQSYRRYEAREALRRVRFWPITREALRLILAKRAFLGL |
Ga0062381_104262441 | 3300004808 | Wetland Sediment | MPIYEQGYRRWEARGPLSRVRFWPITREALRTVLSRRPFLLLLFASFIPFLVRVAQ |
Ga0066676_102011283 | 3300005186 | Soil | VPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRAFLILLMMSWLPFV |
Ga0065707_105210572 | 3300005295 | Switchgrass Rhizosphere | MPIYDQGYRRYEARGPLRKARFWPITREALRLVLVKRWFLALLTA |
Ga0070692_112237492 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAFLGLLLVAWGQFLF |
Ga0070675_1011826632 | 3300005354 | Miscanthus Rhizosphere | MPIYDQTYRRYEARGPLRALRFWPITREALRLVLVRRWFLALLAAAW |
Ga0070671_1005484052 | 3300005355 | Switchgrass Rhizosphere | MPIYEQTYRRYEARAPLRAVRFWPITREALRLILARRAFLGLLLVAWGQFLFRV |
Ga0070703_105072601 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRAFLILLMMSWVPF |
Ga0070694_1019514992 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAFL |
Ga0070708_1012715752 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIYEQTYRRHEARGALRRVRFWPITREALRLILARRWFL |
Ga0066689_109657342 | 3300005447 | Soil | MPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRWFLALLA |
Ga0070699_1006385072 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRWFLA |
Ga0070704_1013053662 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIYEQTYRRYEAREPLRQLRFWPITREGLRLILAKRAFLILLIVA |
Ga0068854_1014754412 | 3300005578 | Corn Rhizosphere | MPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAF |
Ga0074473_100323352 | 3300005830 | Sediment (Intertidal) | MPIYDQTYRKYDAREPLRSVRFWPIPREALRLHLM |
Ga0074470_107502252 | 3300005836 | Sediment (Intertidal) | MPIYEQAYRKYEAREGPRQVRFWPITREALRLVLAKRAFI |
Ga0075362_107766102 | 3300006177 | Populus Endosphere | VPIYDRTYRRHEARGPLRRVRFWPITREALRLVLARRAFLALLAASWIPFLVRVVQI |
Ga0097621_1014233351 | 3300006237 | Miscanthus Rhizosphere | MPIYEQTYRRYEARAPLRAVRFWPITREALRLILARRAF |
Ga0066665_105745791 | 3300006796 | Soil | VPIYEQTYRKHEARGPLRRVRSWPITREALRLILARRAFLALLVFSWLPCV |
Ga0075428_1022128151 | 3300006844 | Populus Rhizosphere | MPIYEQTYRRYQAREPLRRFRFWPITREVLRTLLAKRAF |
Ga0075421_1006565143 | 3300006845 | Populus Rhizosphere | MPIYEQTYRRYEARAPLRRLRFWPITREALRLILAKRAFLGLLLLCWLP |
Ga0075419_115373561 | 3300006969 | Populus Rhizosphere | MPVYDQGYRRHQARRPLRALRFWPITREALRLLLRRWTLLGLLVLA |
Ga0066710_1011695803 | 3300009012 | Grasslands Soil | MPIYDQGYRPYEARQPLRTLRFWPITREALRLLLARRAFLILLA |
Ga0102851_135358112 | 3300009091 | Freshwater Wetlands | MPVYDQGYRRYEARHPLRTVRFWPIVREALRGLFTRKAFLAL |
Ga0111539_100515731 | 3300009094 | Populus Rhizosphere | MPIYDQTYRRYEARGPLRALRFWPITREALRLVLVRRWFLALLA |
Ga0111539_133007032 | 3300009094 | Populus Rhizosphere | MPIYDQGYRRYEARGPLRKARFWPITREALRLVLSKRAFLGLLLAGFI |
Ga0075418_111922741 | 3300009100 | Populus Rhizosphere | LPIYDQTYRRYEARAPLRRARFWPITREALRLILARRWFLALLVAAWVPFVV |
Ga0075418_118015441 | 3300009100 | Populus Rhizosphere | MPIYEQAYRKYEARAEARAIRFWPITREALRLVLSRRAFIGLMVVGF |
Ga0075418_126012372 | 3300009100 | Populus Rhizosphere | MPIYDQTYRRYEARGALRPIRFWPITREALRLILA |
Ga0105091_100614714 | 3300009146 | Freshwater Sediment | MPIYDQGYRHYQARSPLHKARFWPITREALRLVLMKRAFLGLIAA |
Ga0114129_134808712 | 3300009147 | Populus Rhizosphere | VPIYQQGYRPYQARGPLRGVRFWPITREALRLILARRAFLGLLVLSW |
Ga0114923_112707861 | 3300009788 | Deep Subsurface | MPIYEQSYRRHEARAPLRSVRFWPITREALRLILVKRAFLGLLAMGWLPAGCCTASPWPS |
Ga0105067_10383981 | 3300009812 | Groundwater Sand | MPIYEQAYRKYEARAPLRQVRFWPITREALRLVLAKRAFIVLLLACLIPFVVRVVQI |
Ga0105070_10965541 | 3300009815 | Groundwater Sand | MPIYEQAYRKYEARAPLRQVRFWPITREALRLVLAKRAFIVL |
Ga0131077_116587282 | 3300009873 | Wastewater | MPVYDQGYRRYEARHPLRRVRFWPIVREALRGLVTRKAFLA |
Ga0126372_122396042 | 3300010360 | Tropical Forest Soil | MPIYEQTYRKYEARAPLRQIRFWPITREALRLVLAPRLFLVLLLASYLPF |
Ga0126372_130042542 | 3300010360 | Tropical Forest Soil | VPIYEQTYRRYEARGPLRALRFWPITREALRILLARRAFL |
Ga0134122_124769022 | 3300010400 | Terrestrial Soil | MPIYEQSYRRYEARQPLRRVRFWTITREALRLVLVRRMFLALLAVAWLPFVGYVPFSE |
Ga0134123_108091381 | 3300010403 | Terrestrial Soil | MPIYDQVYRRYEARGPLRALRFWPITREGLRLVLVRRWFLALLAAAWV |
Ga0134123_110017501 | 3300010403 | Terrestrial Soil | VPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRAFLILLMMS |
Ga0134123_118053942 | 3300010403 | Terrestrial Soil | VPIYEQSYRRYEARGPLRTVRFWPIAREALRHVLAKRAFLGLLAL |
Ga0137356_10046843 | 3300011402 | Soil | MPIYDQGYRRYEARSPLHQTRFWPITHEALRLVLAKRAFLRLLAVSFLPFV |
Ga0137342_10327631 | 3300012171 | Soil | MPIYEQAYRKYEARSPLRAVRFWPITREALRLILAKRAFIGLLIGAWIP |
Ga0137363_114209932 | 3300012202 | Vadose Zone Soil | MPIYEQSYRRYEARGPLRTVRFWPITREALRLILSRKAFLVLLMIAWTPFLWRVI |
Ga0137386_105279982 | 3300012351 | Vadose Zone Soil | LPIYDQSYRRHEARGPLRRARFWPITREALRLILARRAFLILLMMSWLPFAMRL |
Ga0136614_101870423 | 3300012684 | Polar Desert Sand | MPIYDQSYRRYEAREPLRKVRFWPITREALRLILARRALLGLL |
Ga0157284_102582391 | 3300012893 | Soil | MPIYEQTYRRYEARAPLRAVRFWPITREALRLILARRAFLGLLL |
Ga0157299_102343972 | 3300012899 | Soil | MPIYDQTYRRYEARGPLRALRFWPITREALRLVLVRR |
Ga0157306_100240761 | 3300012912 | Soil | MPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAFLGLLLVAWGQF |
Ga0075340_11420081 | 3300014304 | Natural And Restored Wetlands | MPIYDQGYRRYVARSPLHRVRFWPITREALRLVLAKRAFLGLLAA |
Ga0075352_10815252 | 3300014324 | Natural And Restored Wetlands | MPIYDQTYRRHEARAPLRSVRFWPITREALRLLLQKR |
Ga0180094_10557341 | 3300014881 | Soil | MPIYEQAYRKYEARSPLRTVRFWPITREALRLILVNRA |
Ga0180063_13037861 | 3300014885 | Soil | MPIYDQSYRKHLARGPLRQLRFWPIAREGLRLVLVKRAFLVLLGFSFIPF |
Ga0132258_105038801 | 3300015371 | Arabidopsis Rhizosphere | MPIYEQSYRRYEARAPLRRVRFWPITREALRLILAKRAFL |
Ga0184615_105643741 | 3300018059 | Groundwater Sediment | LPIYEQSYRRYEAREPLRTIRFWPIAREALVHVLAKRAFLGLLALSWLPF |
Ga0187773_104060061 | 3300018064 | Tropical Peatland | MPIYDQGYRKYEARGPLRKARFWPITREALRLILVKRAFL |
Ga0184627_102793681 | 3300018079 | Groundwater Sediment | MPIYDQAYRRWEARGPLRRVRFWPITRESLRLILSKRAFL |
Ga0190274_114356221 | 3300018476 | Soil | MPVYEQTYRRYEARQPLRTVRFWPITREALRLLLSKWAFLGLVILCWVPFLAFAIYVW |
Ga0187892_105582192 | 3300019458 | Bio-Ooze | MPIYEQTYRRYEARAPLTRFRFWPITREALRLVLMKRAFLGLLAVSFLPFLFQVGWVYVV |
Ga0210377_100715831 | 3300021090 | Groundwater Sediment | MPIYDQGYRRYEARAPLRKARFWPITREALRLVLS |
Ga0210377_108207621 | 3300021090 | Groundwater Sediment | MPIYDQTYRKYDARGPLRSVRFWPITREGLRLLLAKKAFLALWAACWLPFIGFVI |
Ga0224500_102370981 | 3300022213 | Sediment | MPIYDQGYRRYEARSPLHQIRFWPITREALRLILAKRAFLFLLAPPLIVFLFYVG |
Ga0224500_103870202 | 3300022213 | Sediment | MPIYDQGYRRYEARAPLRTARFWPITREALRMVLQKRAFLGLLAAAF |
Ga0222622_111625792 | 3300022756 | Groundwater Sediment | MPIYDQTYRRYEARGPLRRLRFWPITREALRLVLARRWFLALLVA |
Ga0209321_101196721 | 3300025312 | Soil | MPIYDQGYRRYEARAPLRRLRFWPITREALRLILAK |
Ga0209641_102117311 | 3300025322 | Soil | MPIYDQGYRRYEARAPLRKARFWPITREALRLVLSKRAFLGLIAAAFL |
Ga0210123_12472671 | 3300025823 | Natural And Restored Wetlands | MPVYEQSYRSHEARAPIRQVRFWPILREGLRLLLARKAL |
Ga0207681_112319502 | 3300025923 | Switchgrass Rhizosphere | MPIYDQTYRRYEARGPLRALRFWPITREGLRLVLVRRWFLALLAAAW |
Ga0207659_118688222 | 3300025926 | Miscanthus Rhizosphere | MPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRA |
Ga0207640_105199113 | 3300025981 | Corn Rhizosphere | MPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRVF |
Ga0210117_10522192 | 3300025985 | Natural And Restored Wetlands | MPIYEQAYRRYEARGPLRRLRFWPITREALRLLLAGRWF |
Ga0207641_109696121 | 3300026088 | Switchgrass Rhizosphere | MPIYEQSYRRWEARGPLREARFLPITREALRLILSRRAFLL |
Ga0207674_112327421 | 3300026116 | Corn Rhizosphere | MPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRVFLGLLLVAWVPVLWQ |
Ga0207675_1003209221 | 3300026118 | Switchgrass Rhizosphere | MPIYEQAYRRWESRGPLRQIRFLPITREALRLILARR |
Ga0207675_1021925242 | 3300026118 | Switchgrass Rhizosphere | MPIYEQTYRRYEARAPLRRLRFWPITREALRLILAKRAFLGLLLLC |
Ga0209468_11314681 | 3300026306 | Soil | LPIYEQTYRRHEARGALRRVRFWPITREALRLILA |
Ga0209647_10486644 | 3300026319 | Grasslands Soil | MPIYEQTYRRYEARAPLRTLRFWPITREALRLILARRAFMGLLLVAWGQFLV |
Ga0209470_12509391 | 3300026324 | Soil | VPIYEQTYRRHEARGPLRRVRFWPITREALRLILARRA |
Ga0209802_10472481 | 3300026328 | Soil | MPIYEQTYRRYEARGPLRTVRFWPITREALRLVLAR |
Ga0256810_10272451 | 3300026357 | Sediment | MPIYDQGYRRYQARAPLRKARFWPITREALRLVLARRWFLILMSI |
Ga0209397_104566412 | 3300027871 | Wetland | MPIYDQGYRRYEARSPLHQVRFWPITREALRMVLAK |
Ga0209481_107481302 | 3300027880 | Populus Rhizosphere | MPIYDQGYRRYEARAPLRKARFWPITREALRLVLLRRWFLGL |
Ga0207428_100446414 | 3300027907 | Populus Rhizosphere | MPIYEQSYRRWEARGPLRAARFLPITREALRLLLA |
Ga0268265_110012351 | 3300028380 | Switchgrass Rhizosphere | MPIYEQTYRRYEARAPLRTVRFWPITREALRLILARRAFLGLLL |
Ga0268264_120761672 | 3300028381 | Switchgrass Rhizosphere | MPIYDQTYRRYEARGPLRALRFWPITREALRLVLVRRWFLALLAAAWLPF |
Ga0307290_101045371 | 3300028791 | Soil | LPIYEQTYRRHEARGALRRVRFWPITREALRLILARR |
Ga0307299_102472301 | 3300028793 | Soil | LPIYEQTYRRHEARGALRRVRFWPITREALRLILARRWFLE |
Ga0302254_100356101 | 3300028870 | Fen | MPIYEQGYRRYVARAALHTTRFWPITREALRLLLQKRLFT |
Ga0311350_118451441 | 3300030002 | Fen | MPIYEQGYRRYVARAALHTTRFWPITREALRLLLQKRLFTLFLLGSLSPLAV |
Ga0316578_100633543 | 3300031728 | Rhizosphere | MPIYDQGYRRYEAREALRQIRFWPITREALKLILSKRAF |
Ga0315297_106905242 | 3300031873 | Sediment | MPIYDQGYRRYEARAPLRKARFWPITREALRLVLSKRAFLGLIAAAFLP |
Ga0315297_114858392 | 3300031873 | Sediment | MPIYDQGYRRYEARSPLHQVRFWPITREALRLILAKRAFLGLL |
Ga0310900_101073161 | 3300031908 | Soil | MPIYEQSYRRWEARGPLRAARFLPITREALRLLLARKAFLLLLIAA |
Ga0310902_111948131 | 3300032012 | Soil | MPIYEQAYRKYEARAEARAIRFWPITREALRLVLS |
Ga0316198_102388012 | 3300032251 | Sediment | MPIHDQSYRRYEARGPLRSVRFWPITREALRLILVR |
Ga0316198_106251482 | 3300032251 | Sediment | MPIYDQGYRRYEARGALRQVRFWPITREALRLILSKRAFLGL |
Ga0316195_106133191 | 3300032263 | Sediment | MPIYDQGYRRYEARGPLRQVRFWPITREALRMILSKRAFLG |
Ga0335082_104036152 | 3300032782 | Soil | MPIYDQGYRRYVARSPLQAARFWPITREALRMILSKRAF |
Ga0335070_117002041 | 3300032829 | Soil | MPIYDQGYRRYEARSPLHQIRFWPITREALRMILLKRAFLALIAVSFVPFLV |
Ga0335076_117520672 | 3300032955 | Soil | MPIYDQAYRKYEAREAARRVRFWPITREALRLVLAKR |
Ga0335084_107340201 | 3300033004 | Soil | MPIYDQGYRRYEARQPLRRARFWPITREAMRIILAKRWFLVLLA |
Ga0316603_110581681 | 3300033413 | Soil | MPIYDQGYRRYEARGPLHQIRFWPITREALRLILAKRAFLSL |
Ga0316622_1013207532 | 3300033416 | Soil | MPIYDQGYRRYEARGPLRTLRFWPITREALRLVLSR |
Ga0316622_1031916642 | 3300033416 | Soil | MPIYDQGYRRYLARSPLHKARFWPITREALRLVLAKRAFLGLL |
Ga0316193_100450481 | 3300033429 | Sediment | MPIYDQGYRRYEAREPLHQLRFWPITREALRLVLAKRAFLGLLAVSFLP |
Ga0316600_103939992 | 3300033481 | Soil | MPIYDQGYRHYEARSPLHRARFWPITREALRLILAKRAFLG |
Ga0316600_105745611 | 3300033481 | Soil | MPIYDQGYRRYVARSPLHRLRFWPITREALRSFAQRRFFVM |
Ga0316627_1012379701 | 3300033482 | Soil | MPIYDQGYRRYEARAPLRKARFWPITREALRLVLSKRAFLG |
Ga0316627_1026324111 | 3300033482 | Soil | MPIYDQGYRRYEARSPLHQIRFWPITREALRLILA |
Ga0316624_108210771 | 3300033486 | Soil | MPIYDQGYRRYEARGPLHQIRFWPITREALRLILAK |
Ga0316621_114264491 | 3300033488 | Soil | MPIYDQGYRRYEARGPLHQIRFWPITREALRLILAKRAFLSLLAPPLAVLLFYVGR |
Ga0299912_108433472 | 3300033489 | Soil | MPIYDRGYRRYEARAPLHQIRFWPITREALRMILAKRAFLILLAVSFLPF |
Ga0314862_0183794_402_515 | 3300033803 | Peatland | MPVYDQSYRRYQARRPLRDLRFWPITREALRMILNRRA |
Ga0364924_082692_597_713 | 3300033811 | Sediment | MPIYEQTYRRHQERAPLRKTRFWPITREALRLLLSRKIF |
Ga0373911_036110_710_835 | 3300034081 | Sediment Slurry | MPIYDQGYRRYEARGPLHQIRFWPITREALRLILAKRAFLGL |
Ga0373902_056975_1_126 | 3300034099 | Sediment Slurry | MPIYDQGYRRYEARAPLHQIRFWPITREALRMILLKRAFLAL |
Ga0364925_0094444_947_1054 | 3300034147 | Sediment | MPIYDQGYRRYEARSPLHRARFWPITREALRLILAK |
Ga0364929_0365318_391_501 | 3300034149 | Sediment | MPIYDQGYRRYVARLPLHKARFWPITREALRLILAKR |
Ga0364942_0214819_2_169 | 3300034165 | Sediment | MPIYDQGYRRYEARAPLRKARFWPITREALRLVLLRRWFLGLVAGAFVPFIIRVGQ |
⦗Top⦘ |