NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065882

Metagenome / Metatranscriptome Family F065882

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065882
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 49 residues
Representative Sequence MLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRIRSASGAD
Number of Associated Samples 119
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.15 %
% of genes near scaffold ends (potentially truncated) 99.21 %
% of genes from short scaffolds (< 2000 bps) 96.06 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.260 % of family members)
Environment Ontology (ENVO) Unclassified
(34.646 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.307 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 58.23%    β-sheet: 0.00%    Coil/Unstructured: 41.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF01343Peptidase_S49 95.28
PF00574CLP_protease 1.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 193.70
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 3.15
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.57

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908018|SwRhBV22_Contig_3307All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus536Open in IMG/M
2162886015|FOassembled-_contig15265All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia951Open in IMG/M
2170459012|GOYVCMS01DQZYKAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia511Open in IMG/M
2189573000|GPBTN7E01E20AZAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia510Open in IMG/M
2209111022|2221194616All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1524Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1076357All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia508Open in IMG/M
3300000890|JGI11643J12802_10954702All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia523Open in IMG/M
3300000890|JGI11643J12802_11617318All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium665Open in IMG/M
3300000955|JGI1027J12803_106472810All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1025Open in IMG/M
3300001867|JGI12627J18819_10086945All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1296Open in IMG/M
3300001867|JGI12627J18819_10305666All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia640Open in IMG/M
3300002128|JGI24036J26619_10020365All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1229Open in IMG/M
3300004633|Ga0066395_10450339All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia734Open in IMG/M
3300005175|Ga0066673_10669401All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia599Open in IMG/M
3300005288|Ga0065714_10211120All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia866Open in IMG/M
3300005289|Ga0065704_10263100All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia960Open in IMG/M
3300005290|Ga0065712_10157516All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1325Open in IMG/M
3300005294|Ga0065705_10571401All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia714Open in IMG/M
3300005328|Ga0070676_10460826All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia896Open in IMG/M
3300005329|Ga0070683_100012490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 897382Open in IMG/M
3300005332|Ga0066388_103652083All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia785Open in IMG/M
3300005354|Ga0070675_100607002All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia993Open in IMG/M
3300005366|Ga0070659_100938206All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia758Open in IMG/M
3300005367|Ga0070667_101080881All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia750Open in IMG/M
3300005435|Ga0070714_101424641All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia677Open in IMG/M
3300005447|Ga0066689_11010859All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia512Open in IMG/M
3300005457|Ga0070662_101129505All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia673Open in IMG/M
3300005553|Ga0066695_10090453All Organisms → cellular organisms → Bacteria1868Open in IMG/M
3300005557|Ga0066704_10565598All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia738Open in IMG/M
3300005563|Ga0068855_101730287All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia637Open in IMG/M
3300005576|Ga0066708_10422343All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia855Open in IMG/M
3300005577|Ga0068857_101167501All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia745Open in IMG/M
3300005578|Ga0068854_100780469All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia831Open in IMG/M
3300005764|Ga0066903_105121034All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia694Open in IMG/M
3300005841|Ga0068863_100214292All Organisms → cellular organisms → Bacteria1855Open in IMG/M
3300006046|Ga0066652_100919843All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia834Open in IMG/M
3300006237|Ga0097621_100182507All Organisms → cellular organisms → Bacteria1813Open in IMG/M
3300006358|Ga0068871_101688188All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia600Open in IMG/M
3300009093|Ga0105240_12274178All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia562Open in IMG/M
3300009156|Ga0111538_12856093All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia605Open in IMG/M
3300009177|Ga0105248_10556327All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1294Open in IMG/M
3300009551|Ga0105238_12954897All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia511Open in IMG/M
3300010154|Ga0127503_10788856All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia554Open in IMG/M
3300010304|Ga0134088_10508355All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia594Open in IMG/M
3300010323|Ga0134086_10137780All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia884Open in IMG/M
3300010361|Ga0126378_11238549All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia843Open in IMG/M
3300010361|Ga0126378_13463157All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia500Open in IMG/M
3300010362|Ga0126377_10531153All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1212Open in IMG/M
3300010364|Ga0134066_10140572All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia747Open in IMG/M
3300010376|Ga0126381_100283416All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2261Open in IMG/M
3300012021|Ga0120192_10064021All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia683Open in IMG/M
3300012199|Ga0137383_11325720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi512Open in IMG/M
3300012210|Ga0137378_10848536All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia826Open in IMG/M
3300012212|Ga0150985_107867951All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1159Open in IMG/M
3300012351|Ga0137386_10494128All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia881Open in IMG/M
3300012356|Ga0137371_10930440All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia661Open in IMG/M
3300012519|Ga0157352_1107844All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia503Open in IMG/M
3300012885|Ga0157287_1084721All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia563Open in IMG/M
3300012898|Ga0157293_10243320All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia566Open in IMG/M
3300012899|Ga0157299_10130484All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia687Open in IMG/M
3300012907|Ga0157283_10077115All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia838Open in IMG/M
3300012911|Ga0157301_10126620All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia785Open in IMG/M
3300012918|Ga0137396_10735950All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia727Open in IMG/M
3300012938|Ga0162651_100004725All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter1455Open in IMG/M
3300012984|Ga0164309_10890672All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia724Open in IMG/M
3300012984|Ga0164309_11774244All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia529Open in IMG/M
3300012985|Ga0164308_11688290All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia587Open in IMG/M
3300012989|Ga0164305_11983558All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia531Open in IMG/M
3300013297|Ga0157378_10532067All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1178Open in IMG/M
3300015201|Ga0173478_10838841All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia509Open in IMG/M
3300015371|Ga0132258_11546401All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1675Open in IMG/M
3300015374|Ga0132255_103500683All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia668Open in IMG/M
3300017657|Ga0134074_1388954All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia518Open in IMG/M
3300018000|Ga0184604_10167557All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia735Open in IMG/M
3300018028|Ga0184608_10177566All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia927Open in IMG/M
3300018433|Ga0066667_11448081All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia605Open in IMG/M
3300018433|Ga0066667_11534441All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium590Open in IMG/M
3300019356|Ga0173481_10286992All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia759Open in IMG/M
3300019789|Ga0137408_1200322All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia643Open in IMG/M
3300019882|Ga0193713_1179986All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia550Open in IMG/M
3300019886|Ga0193727_1017304All Organisms → cellular organisms → Bacteria2638Open in IMG/M
3300019997|Ga0193711_1008746All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1274Open in IMG/M
3300020001|Ga0193731_1132891All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia624Open in IMG/M
3300020016|Ga0193696_1028666All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1493Open in IMG/M
3300021344|Ga0193719_10274079All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia710Open in IMG/M
3300021411|Ga0193709_1089534All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia675Open in IMG/M
3300022756|Ga0222622_11051690All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia598Open in IMG/M
3300022883|Ga0247786_1029346All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1067Open in IMG/M
3300022898|Ga0247745_1037085All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia743Open in IMG/M
3300024055|Ga0247794_10134216All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia763Open in IMG/M
3300025290|Ga0207673_1011837All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1132Open in IMG/M
3300025315|Ga0207697_10045019All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300025315|Ga0207697_10271879All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia751Open in IMG/M
3300025903|Ga0207680_10382675All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia992Open in IMG/M
3300025909|Ga0207705_11439029All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia523Open in IMG/M
3300025916|Ga0207663_10175583All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1525Open in IMG/M
3300025926|Ga0207659_10293005All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1334Open in IMG/M
3300025930|Ga0207701_10457705All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1095Open in IMG/M
3300025930|Ga0207701_11252194All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia610Open in IMG/M
3300025931|Ga0207644_11187139All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia641Open in IMG/M
3300025933|Ga0207706_10070147All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3082Open in IMG/M
3300025960|Ga0207651_10832851All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia819Open in IMG/M
3300026067|Ga0207678_10425091All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300026116|Ga0207674_10403212All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1321Open in IMG/M
3300026325|Ga0209152_10334291All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia575Open in IMG/M
3300026861|Ga0207503_1007236All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia650Open in IMG/M
3300028716|Ga0307311_10206734All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia577Open in IMG/M
3300028787|Ga0307323_10357684All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia523Open in IMG/M
3300028803|Ga0307281_10082828All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1058Open in IMG/M
3300028807|Ga0307305_10026683All Organisms → cellular organisms → Bacteria2625Open in IMG/M
3300028811|Ga0307292_10253980All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia730Open in IMG/M
3300028824|Ga0307310_10085277All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300031231|Ga0170824_112469301All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia553Open in IMG/M
3300031446|Ga0170820_11731087All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia675Open in IMG/M
3300031538|Ga0310888_10099788All Organisms → cellular organisms → Bacteria1474Open in IMG/M
3300031547|Ga0310887_10824948All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia584Open in IMG/M
3300031720|Ga0307469_10449502All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1115Open in IMG/M
3300031940|Ga0310901_10319451All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia657Open in IMG/M
3300031944|Ga0310884_10646547All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium635Open in IMG/M
3300031954|Ga0306926_11098356All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia941Open in IMG/M
3300032001|Ga0306922_11493919All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia676Open in IMG/M
3300032035|Ga0310911_10126363All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300032205|Ga0307472_102404565All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia534Open in IMG/M
3300033289|Ga0310914_11070852All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia707Open in IMG/M
3300033412|Ga0310810_10357591All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300033475|Ga0310811_10420296All Organisms → cellular organisms → Bacteria1450Open in IMG/M
3300033475|Ga0310811_11124186All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia662Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.09%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.15%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.15%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere2.36%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.36%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.36%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.57%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil1.57%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.57%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.57%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.57%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.57%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.57%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.79%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.79%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.79%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.79%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908018Switchgrass rhizosphere microbial communities from Rose Lake, Michigan, USA - BV2.2Host-AssociatedOpen in IMG/M
2162886015Grass soil microbial communities from Rothamsted Park, UK - FO (Mercury 0.02g/kg) assembledEnvironmentalOpen in IMG/M
2170459012Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grassEnvironmentalOpen in IMG/M
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
2209111022Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichmentEnvironmentalOpen in IMG/M
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012021Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019997Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025290Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5Host-AssociatedOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026861Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-12 (SPAdes)EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwRhBV22_000414402124908018Switchgrass RhizosphereMLFGNVFATFGAAPSLALFLLSALYFIASLCVYVSLIYQISTRIRGASGADAPARAFGLPEA
FOassembled-_0265.000013902162886015Grass SoilMLFGKVFATFGAAPSLALGLLSALYFIASLCVYVSL
N56_091716602170459012Grass SoilMLFENIFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRIRSASGVDAPVR
N55_110212802189573000Grass SoilMLFGTFLRTFGAAPSLALSLLSAVYFIGSLCVYVS
22220142232209111022Grass SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQIS
AF_2010_repII_A01DRAFT_107635713300000580Forest SoilMLFGNFFATFGAAPSLVLGLLSALYFIASLCVYVSLIYQISTRIRSAS
JGI11643J12802_1095470213300000890SoilMLFGNVFATFGAAPSLALFLLSALYFIASLCVFVSLIYQISTRIRSASGADV
JGI11643J12802_1161731823300000890SoilLMLFGNLFATFGAAPTVALGLLSFVYSIAGVCVYVSLIYQISA
JGI1027J12803_10647281023300000955SoilMLLGNFFATFGAAPSVALGLLSFLYLVVSICVYVSLTYQISTRTRNASGAD
JGI12627J18819_1008694513300001867Forest SoilMLFGNVFATFGAAPSLALGLLSALYFIGSLCAYVSLIYQ
JGI12627J18819_1030566623300001867Forest SoilMLFGNVFTTIGAAPNLALALLSFLYAIASVCVYMS
JGI24036J26619_1002036513300002128Corn, Switchgrass And Miscanthus RhizosphereMLVGNVFVIFGAAPSVALALLSFLYAIASVCVYLSLIYQISTHIRSA
Ga0066395_1045033913300004633Tropical Forest SoilMLFGNVFTIFGAAPSLALSLLSALYFIASLCVYVSLIYQISTRIRSAFGADAQ
Ga0066673_1066940123300005175SoilMLFGNVFATFRAAPSLALFLLSALYFIGSLCVYVSLIYQISARIRSASGADA
Ga0065714_1021112023300005288Miscanthus RhizosphereMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSLIYQISARIRTASGADVPRRVFGLPEAVLA
Ga0065704_1026310013300005289Switchgrass RhizosphereMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISAR
Ga0065712_1015751623300005290Miscanthus RhizosphereMLFGNVFATFGAAPSLALSLLSAVYFVGSLCVYVSLIYQISVRIRS
Ga0065705_1057140123300005294Switchgrass RhizosphereMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRI
Ga0070676_1046082623300005328Miscanthus RhizosphereMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSLIYQISARIRSASGADVPA
Ga0070683_10001249073300005329Corn RhizosphereMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISARIR
Ga0066388_10365208323300005332Tropical Forest SoilMLFGNIFATFGAAQSLALGLLSALYFIGSVCVYVSLIYQIS
Ga0070675_10060700213300005354Miscanthus RhizosphereMLFGNVFAISGAAPGLALGLLSALYFIASLCVYVSLIYQISARI
Ga0070659_10093820613300005366Corn RhizosphereMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSLIYQISARIR
Ga0070667_10108088123300005367Switchgrass RhizosphereMLFGNVFATFGAAPNLALGLLSALYFIASLCVYVSLIYQISARIRIASGADAPARAFGLPEAV
Ga0070714_10142464113300005435Agricultural SoilMLFGNSLATFGAAPSVALALLSFLYLIASTCVYVSLIYQISTRIRSASGTDASARGFGLPEAVLA
Ga0066689_1101085923300005447SoilMLFGNVFATFGATPSLALGLLSALYFIAGLCGLCVYVSLIYQI
Ga0070662_10112950523300005457Corn RhizosphereMPFGNIFATFGAAPSVALGVLSALYLIASLCVYVSLIYQISTRVRDASATDVPARAFGLPEAIL
Ga0066695_1009045333300005553SoilMLFGNVFATFGAAPSLALALLSALYFIASLCVYVS
Ga0066704_1056559823300005557SoilMLFGNIFVTFGAAPSLALGLLSALYFIASLCVYVSL
Ga0068855_10173028723300005563Corn RhizosphereMLIGNVFATFGATPSLALSLLSALYFIASLCVYVSLIYQISNRIRSASGADV
Ga0066708_1042234323300005576SoilMLFGNIFATFGAAPSLALFLLSALYFIGSLCVYVSLIYQISARIRSA
Ga0068857_10116750113300005577Corn RhizosphereMLIGNVFATFGATPSLALSLLSALYFIASLCVYVSLIYQISNRIRSASGADVP
Ga0068854_10078046913300005578Corn RhizosphereMLVGNVFVIFGAAPSVALALLSFLYAIASVCVYLSLIYQISTHIRS
Ga0066903_10512103423300005764Tropical Forest SoilMLFGNVLATFGAAPSIALALLSFLYTIASVCVYVSLIYQIS
Ga0068863_10021429213300005841Switchgrass RhizosphereMQFGNVFATFGAAQTVALGLLSFVYSIASICVYVSLIYQI
Ga0066652_10091984323300006046SoilMLFYNLFATFGAVPSLALGLLSALYFIASLCVYVSL
Ga0097621_10018250733300006237Miscanthus RhizosphereMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSL
Ga0068871_10168818813300006358Miscanthus RhizosphereMLFGNVFATFGAAPSLALSLLSAVYFVGSLCVYVSLIYQISVRIRSASGVDAPARAFGLPEAVL
Ga0105240_1227417813300009093Corn RhizosphereMLFGNVFATFGAAPNLALGLLSALYFIGSLCVYVSLIYQISIRIRIASGADAPARAFGLPEAV
Ga0111538_1285609313300009156Populus RhizosphereMQFGNVFATFGAAQTVALGLLSFVYSIASICVYVSLIYQISARI
Ga0105248_1055632713300009177Switchgrass RhizosphereMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISARIRIASGADVPTPGFGLPEA
Ga0105238_1295489723300009551Corn RhizosphereMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQ
Ga0127503_1078885623300010154SoilMLFGNVFATFGAAPSLALFLLSALYFIASLCVYVSLIYQI
Ga0134088_1050835513300010304Grasslands SoilMLFGNVFATFGAVPSLALGLLSALYFIASLCVYVSLIYQIS
Ga0134086_1013778023300010323Grasslands SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQVS
Ga0126378_1123854913300010361Tropical Forest SoilMLFGNVLATFGAAPSVALALLSFLYTIASVCVYVS
Ga0126378_1346315713300010361Tropical Forest SoilMLTGNPFATFGAAPSVALGLLSFLYLIASICVYVSLIYQISARIRST
Ga0126377_1053115313300010362Tropical Forest SoilMLSGSVFAAVGAAPSLALGLLSTLYFIASLCVYVSLIYQISNRIRSASGADAPTGA
Ga0134066_1014057213300010364Grasslands SoilMLFGNVFATFGAGTSLALFLLSALYFIGSLCVYVSLIYQISARIRSASGADAP
Ga0126381_10028341633300010376Tropical Forest SoilMLFGNVFVIFGAAPSVALALLSFLYAIASVCVYLSLIYQISTRIR
Ga0120192_1006402123300012021TerrestrialMLNGNVFATFGAAPSLALFFLSAFYLIASLCVYVSLIYQI
Ga0137383_1132572013300012199Vadose Zone SoilMLFYHLLATHGAVPRLGLGLLSALYFIASLCVYVSLIYQI
Ga0137378_1084853613300012210Vadose Zone SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRIRSASGAD
Ga0150985_10786795113300012212Avena Fatua RhizosphereMLVGNVFATSGAAPGLALGLLSALYFIASLCVYVSLIYQISAR
Ga0137386_1049412823300012351Vadose Zone SoilMLFGNVFATFGVAPSLALGLLSALYFIASLCVYVSLIYQISTRIRSASGAD
Ga0137371_1093044023300012356Vadose Zone SoilMLFGNVFATFGVAPSLALGLLSALYFIASLCVYVSLIYQISTRIRSASG
Ga0157352_110784423300012519Unplanted SoilMLFGNVFATFGAAPSFALFLLSALYFIASLCVYVSLIYQISTQIRSAYGA
Ga0157287_108472123300012885SoilMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSLIYQISARIRSASGADVPGGAFGVPEAV
Ga0157293_1024332023300012898SoilMLFGNVFAISGASPGLALALLSALYFIASLCVYVSLIYQISARIRSASGADVPGGAFGVPEAV
Ga0157299_1013048413300012899SoilMLFGNVFAISGAAPGLALALLSALYFIASLCVYVS
Ga0157283_1007711513300012907SoilMLFGNVFATFGAAPSLALALLSALYFIASICVYMSLSYQISARIR
Ga0157301_1012662023300012911SoilMLFGNVFATFGAAPSLALALLSALYFIASLCVYVSLSYQISARIRFASGADAPA
Ga0137396_1073595023300012918Vadose Zone SoilMLFGNVFAPFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRIRSASGDDVP
Ga0162651_10000472513300012938SoilMLFGNIFATFGAAPSLALFLLSALYLIASLCVYVSLIYQ
Ga0164309_1089067223300012984SoilMLFGNVFGTLGAAPSLALGLLSALYCTASLCGYVSLIYQISTRIRGASGPDAP
Ga0164309_1177424413300012984SoilMLFGNVFATFGAAPNLALGLLSALYFIASLCVYVSLIYPVSARIRISSGADAPARP
Ga0164308_1168829023300012985SoilMLFGNVFATFGAAPSLALFLLSALYFIASLCVYVSL
Ga0164305_1198355823300012989SoilMLFGNVFATFGAAPNLALGLLSALYFIASLCVYVSLIYQISARVR
Ga0157378_1053206713300013297Miscanthus RhizosphereMLIGNVFATFGATPSLALSLLSALYFIASLCVYVSLIYQISNRIRSASGADVPT
Ga0173478_1083884123300015201SoilMLFGNVFATFGAVPSLALGLLSALYFIASLCVYVSLSYQISARIRFASGA
Ga0132258_1154640113300015371Arabidopsis RhizosphereMLFGNVFVIFGAAPSVALALLSFLYAIASVCVYLSLIYQISTRIRSAFGTQVPVRG
Ga0132255_10350068323300015374Arabidopsis RhizosphereMLFGNVFATFGAAPNLALGLLSALYFIASLCVYVSLIYQISARIRISSGAD
Ga0134074_138895423300017657Grasslands SoilMLFGNVFATFGATPSLALGLLSALYFIASLCVYVSLIYQISTRSRKASVADV
Ga0184604_1016755723300018000Groundwater SedimentMLFGNIFATSGAAPSLALGLLSALYFIGSLCVYVSLIYQISTRIRSASGADASARAFGVPEAV
Ga0184608_1017756613300018028Groundwater SedimentMQFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQIST
Ga0066667_1144808123300018433Grasslands SoilMLFGNVFATFGAGPSLALFLLSALYFIGSLCVYVSLIYQISARIRSASGAD
Ga0066667_1153444113300018433Grasslands SoilMLFGNVFATFGAAPSIALALLSFLYLIASICVYVSLIYQISTRIRSAS
Ga0173481_1028699223300019356SoilMLFGNVFATFGAVPSLALGLLSALYFIASLCVYVSLIYQISARIRTASGADVPRRVFGLP
Ga0137408_120032213300019789Vadose Zone SoilMLFGNIFATFGAAPGLALFLLSALYLIASLCVYVSLIYQLST
Ga0193713_117998623300019882SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQI
Ga0193727_101730413300019886SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIY
Ga0193711_100874613300019997SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRIRSASGDDAPAR
Ga0193731_113289113300020001SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRIR
Ga0193696_102866613300020016SoilMLFVNVFATFGAAPNFALGLLSALYFIASLCVYVSLIYQISARIR
Ga0193719_1027407923300021344SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRIRSASGTDAP
Ga0193709_108953423300021411SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRIRSASGADAPTGAF
Ga0222622_1105169013300022756Groundwater SedimentMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRICGASGADAPAR
Ga0247786_102934623300022883SoilMLFGNVFATSGAAPGLALGLLSALYFIASLCVYVSLIYQISARIRSASGADVPGRAFGLPEAV
Ga0247745_103708523300022898SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISARIRIASGADIP
Ga0247794_1013421613300024055SoilMLFGNVFAISGAAPGLALGLLSALYFIASLCVYVSLIYQISARIRSASGADV
Ga0207673_101183713300025290Corn, Switchgrass And Miscanthus RhizosphereMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSLIYQISARIRSASGADVPGGAFGVPEA
Ga0207697_1004501913300025315Corn, Switchgrass And Miscanthus RhizosphereMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSL
Ga0207697_1027187913300025315Corn, Switchgrass And Miscanthus RhizosphereMQFGNVFATFGAAQTVALGLLSFVYSIASICVYVSLIYQISARIRSAS
Ga0207680_1038267523300025903Switchgrass RhizosphereMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSLIYQISARIRSASGADVPGGAFGVPEAVLA
Ga0207705_1143902923300025909Corn RhizosphereMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISARIRIA
Ga0207663_1017558313300025916Corn, Switchgrass And Miscanthus RhizosphereMLFGNVFATFGAAPSLALFLLSALYLIASLCVYVSLIYQISARIRIAFGADAPARP
Ga0207659_1029300523300025926Miscanthus RhizosphereMQFGNVFATFGAAQTVALGLLSFVYSIASICVYVSLIYQISARIRSASEADFPTRVF
Ga0207701_1045770523300025930Corn, Switchgrass And Miscanthus RhizosphereMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSLIYQIS
Ga0207701_1125219413300025930Corn, Switchgrass And Miscanthus RhizosphereMQFGNVFATFGAAPTVALGLLSFVYSIASICVYVSLIYQISARIRSASEAD
Ga0207644_1118713913300025931Switchgrass RhizosphereMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSLIYQISARIRSASGADVPGRI
Ga0207706_1007014743300025933Corn RhizosphereMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSLIYQISARIRTASGADVPGQA
Ga0207651_1083285113300025960Switchgrass RhizosphereMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRIRGASGPD
Ga0207678_1042509133300026067Corn RhizosphereMLFGNLFATFGAAPGLALSLLSALYFIASFCVYASLIYQISRRIRDASGIDEPARAFGLPEAI
Ga0207674_1040321213300026116Corn RhizosphereMLIGNVFATFGATPSLALSLLSALYFIASLCVYVSLIYQISNRIRSASGADVPTGAFGLPEA
Ga0209152_1033429113300026325SoilMLFGNVFATFGAAPSLALFLLSALYFIGSLCVYVSLIYQISARIRSASGADAPERA
Ga0207503_100723623300026861SoilMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSLIYQISTRIRSAFGTEVPVRGFGLP
Ga0307311_1020673423300028716SoilMLFGNVFATFGAAPNLALGLLSALYFIASLCVHVSLIY
Ga0307323_1035768423300028787SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRIRSASGTDAPAH
Ga0307281_1008282813300028803SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISARIRIASGADAPARAFGLPEA
Ga0307305_1002668333300028807SoilMLFGNVFATFGAAPGLALGLLSALYFIASLCVYVSLIYQISARIRSASGADAPPRAFGLPEA
Ga0307292_1025398013300028811SoilMLFGNVFATSGAAPSLALGLLSALYFIASLCVYVSLIYQISARIRIASGADAPARAFGLP
Ga0307310_1008527733300028824SoilMLFGNVFATLGAAPNLALGLLSALYFIASLCVYVSLIY
Ga0170824_11246930123300031231Forest SoilMLFGNVFATFGAAPGLALGLLSALYFIASLCVYVSLIYQISTRIRS
Ga0170820_1173108723300031446Forest SoilMLFGNVLTFGAAPGLALSLLSALYFIASLCVYVSLIYQISTRIRGASGADVPTGVFGLPE
Ga0310888_1009978833300031538SoilMQFGNVFATFGAAQTVALGLLSFVYSIASICVYVSLIYQISARIRSASEADFP
Ga0310887_1082494823300031547SoilMLIGNVFATFGAAPNLALGLLSALYFIASLCVYVSLIYQISARIRIASGADAPARAFGL
Ga0307469_1044950223300031720Hardwood Forest SoilMLFGNVFATFGAAPSLALFLLSALYFIASLCVYVSLIYQISTRIRSASGAD
Ga0310901_1031945123300031940SoilMLFGNVFSTFGAAPSLALSLLSALYFIGSLCVYVSLIYQISARIRITSGADAPARA
Ga0310884_1064654723300031944SoilMLFGNIFATFGAAPSLALFLLSALYLIASLCVYVSLIYQISTRIRGASGADVT
Ga0306926_1109835623300031954SoilMLFGNVFTTFGAAPSFALALLSLLYAIASVCVYVSLIYQISTRIREASVADSPTRAF
Ga0306922_1149391923300032001SoilMLFGNVFATFGAAPSLALSLLSALYFIASLCVYVSLIYQISTRIRSASGAD
Ga0310911_1012636333300032035SoilMLVGNVFVIFGAAPSVALALLSFLYAIASVCVYLSLIYQISTRIRNAS
Ga0307472_10240456523300032205Hardwood Forest SoilMLFGNVFATFGAAPSLALGLLSALYFIGSLCVYVSLIYQISTRI
Ga0310914_1107085213300033289SoilMLFGNVFVIFGAVPSVALALLSFLYAIASVCVYLSLIYQISTRIRSAFGTEVPVRGFGLPEAV
Ga0310810_1035759133300033412SoilMLIGNVFVIFGAVPSVALALLSFLYAIASVCVYLSLIYQISTRIRSAF
Ga0310811_1042029613300033475SoilMLFGNVFAISGAAPGLALALLSALYFIASLCVYVSLIYQISARIRTASGADVPRRVFG
Ga0310811_1112418623300033475SoilMLFGNVFATFGAAPSLALGLLSALYFIASLCVYVSLIYQISTRIRSASGADVPTGAFGLPEA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.