| Basic Information | |
|---|---|
| Family ID | F065781 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MSEGDRAGWWAIVYLLMVGAAAYFTIFMIIFSFVKKLFWS |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 89.76 % |
| % of genes near scaffold ends (potentially truncated) | 4.72 % |
| % of genes from short scaffolds (< 2000 bps) | 75.59 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (43.307 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (11.811 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.370 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (54.331 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF13671 | AAA_33 | 3.15 |
| PF08410 | DUF1737 | 1.57 |
| PF14743 | DNA_ligase_OB_2 | 1.57 |
| PF13394 | Fer4_14 | 1.57 |
| PF05118 | Asp_Arg_Hydrox | 0.79 |
| PF08722 | Tn7_TnsA-like_N | 0.79 |
| PF00782 | DSPc | 0.79 |
| PF04293 | SpoVR | 0.79 |
| PF09511 | RNA_lig_T4_1 | 0.79 |
| PF12850 | Metallophos_2 | 0.79 |
| PF09967 | DUF2201 | 0.79 |
| PF00768 | Peptidase_S11 | 0.79 |
| PF01176 | eIF-1a | 0.79 |
| PF04679 | DNA_ligase_A_C | 0.79 |
| PF00004 | AAA | 0.79 |
| PF13192 | Thioredoxin_3 | 0.79 |
| PF11750 | DUF3307 | 0.79 |
| PF00133 | tRNA-synt_1 | 0.79 |
| PF05496 | RuvB_N | 0.79 |
| PF09722 | Xre_MbcA_ParS_C | 0.79 |
| PF00011 | HSP20 | 0.79 |
| PF16473 | Rv2179c-like | 0.79 |
| PF04851 | ResIII | 0.79 |
| PF00149 | Metallophos | 0.79 |
| PF01541 | GIY-YIG | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.79 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.79 |
| COG2719 | Stage V sporulation protein SpoVR/YcgB, involved in spore cortex formation (function unknown) | Cell cycle control, cell division, chromosome partitioning [D] | 0.79 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.20 % |
| Unclassified | root | N/A | 37.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c002316 | All Organisms → Viruses → Predicted Viral | 4499 | Open in IMG/M |
| 3300000558|Draft_10266308 | All Organisms → Viruses → Predicted Viral | 3025 | Open in IMG/M |
| 3300001239|Draft_10328802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
| 3300001580|Draft_10370534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300001605|Draft_10263731 | Not Available | 980 | Open in IMG/M |
| 3300001605|Draft_10326767 | Not Available | 837 | Open in IMG/M |
| 3300002408|B570J29032_109841230 | All Organisms → Viruses → Predicted Viral | 1586 | Open in IMG/M |
| 3300003852|Ga0031655_10307988 | Not Available | 591 | Open in IMG/M |
| 3300004240|Ga0007787_10689759 | Not Available | 510 | Open in IMG/M |
| 3300004774|Ga0007794_10183774 | Not Available | 624 | Open in IMG/M |
| 3300005077|Ga0071116_1004276 | Not Available | 17835 | Open in IMG/M |
| 3300005581|Ga0049081_10024193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2306 | Open in IMG/M |
| 3300005581|Ga0049081_10229764 | Not Available | 657 | Open in IMG/M |
| 3300005582|Ga0049080_10024273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2117 | Open in IMG/M |
| 3300005582|Ga0049080_10030912 | All Organisms → Viruses → Predicted Viral | 1869 | Open in IMG/M |
| 3300005582|Ga0049080_10172068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300005662|Ga0078894_10332656 | All Organisms → Viruses → Predicted Viral | 1376 | Open in IMG/M |
| 3300005805|Ga0079957_1003648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13028 | Open in IMG/M |
| 3300005805|Ga0079957_1054310 | All Organisms → Viruses → Predicted Viral | 2428 | Open in IMG/M |
| 3300005805|Ga0079957_1093946 | Not Available | 1654 | Open in IMG/M |
| 3300005805|Ga0079957_1195230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
| 3300006484|Ga0070744_10027348 | All Organisms → Viruses → Predicted Viral | 1689 | Open in IMG/M |
| 3300006484|Ga0070744_10091480 | Not Available | 880 | Open in IMG/M |
| 3300006484|Ga0070744_10219282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 540 | Open in IMG/M |
| 3300006641|Ga0075471_10113970 | Not Available | 1445 | Open in IMG/M |
| 3300006641|Ga0075471_10170364 | Not Available | 1144 | Open in IMG/M |
| 3300006641|Ga0075471_10178467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
| 3300006641|Ga0075471_10250144 | Not Available | 911 | Open in IMG/M |
| 3300006802|Ga0070749_10722529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300006805|Ga0075464_10895450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300006875|Ga0075473_10215560 | Not Available | 775 | Open in IMG/M |
| 3300006917|Ga0075472_10504471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300007177|Ga0102978_1063696 | All Organisms → Viruses → Predicted Viral | 1491 | Open in IMG/M |
| 3300007177|Ga0102978_1350736 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
| 3300007559|Ga0102828_1029361 | Not Available | 1229 | Open in IMG/M |
| 3300008055|Ga0108970_10551616 | Not Available | 11388 | Open in IMG/M |
| 3300008107|Ga0114340_1000005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 185548 | Open in IMG/M |
| 3300008962|Ga0104242_1063054 | Not Available | 620 | Open in IMG/M |
| 3300009151|Ga0114962_10013967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5823 | Open in IMG/M |
| 3300009161|Ga0114966_10099635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1956 | Open in IMG/M |
| 3300009419|Ga0114982_1103069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300010157|Ga0114964_10004879 | Not Available | 8761 | Open in IMG/M |
| 3300010160|Ga0114967_10018576 | Not Available | 4941 | Open in IMG/M |
| 3300010160|Ga0114967_10351890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300010354|Ga0129333_10007348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10404 | Open in IMG/M |
| 3300010354|Ga0129333_10284356 | All Organisms → Viruses → Predicted Viral | 1483 | Open in IMG/M |
| 3300010354|Ga0129333_10722408 | Not Available | 855 | Open in IMG/M |
| 3300010354|Ga0129333_11178926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300010354|Ga0129333_11312359 | Not Available | 598 | Open in IMG/M |
| 3300010354|Ga0129333_11651104 | Not Available | 522 | Open in IMG/M |
| 3300010388|Ga0136551_1000183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17784 | Open in IMG/M |
| 3300010388|Ga0136551_1019725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1318 | Open in IMG/M |
| 3300010885|Ga0133913_10622721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2831 | Open in IMG/M |
| 3300010885|Ga0133913_13225156 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300011268|Ga0151620_1003476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5874 | Open in IMG/M |
| 3300011268|Ga0151620_1030972 | All Organisms → Viruses → Predicted Viral | 1824 | Open in IMG/M |
| 3300012347|Ga0157142_1000002 | Not Available | 222825 | Open in IMG/M |
| 3300012352|Ga0157138_1009480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1608 | Open in IMG/M |
| 3300012664|Ga0157497_1000001 | Not Available | 122614 | Open in IMG/M |
| 3300013004|Ga0164293_10043191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3672 | Open in IMG/M |
| 3300013005|Ga0164292_10759959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300013285|Ga0136642_1000016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 117351 | Open in IMG/M |
| 3300013372|Ga0177922_11048973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300014801|Ga0119946_1010924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300018410|Ga0181561_10278419 | Not Available | 786 | Open in IMG/M |
| 3300019122|Ga0188839_1007692 | All Organisms → Viruses → Predicted Viral | 1340 | Open in IMG/M |
| 3300020048|Ga0207193_1232930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1413 | Open in IMG/M |
| 3300020141|Ga0211732_1032034 | All Organisms → Viruses → Predicted Viral | 1296 | Open in IMG/M |
| 3300020160|Ga0211733_10685849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4477 | Open in IMG/M |
| 3300020161|Ga0211726_10293882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
| 3300020172|Ga0211729_10638684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
| 3300020172|Ga0211729_11160203 | Not Available | 565 | Open in IMG/M |
| 3300020205|Ga0211731_10375378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300020205|Ga0211731_10488512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
| 3300020716|Ga0214207_1005788 | All Organisms → Viruses → Predicted Viral | 1893 | Open in IMG/M |
| 3300021131|Ga0214206_1009657 | Not Available | 1406 | Open in IMG/M |
| 3300021956|Ga0213922_1054645 | Not Available | 878 | Open in IMG/M |
| 3300021961|Ga0222714_10096081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1888 | Open in IMG/M |
| 3300021961|Ga0222714_10269788 | Not Available | 946 | Open in IMG/M |
| 3300021961|Ga0222714_10423454 | Not Available | 698 | Open in IMG/M |
| 3300021961|Ga0222714_10464327 | Not Available | 656 | Open in IMG/M |
| 3300021962|Ga0222713_10414347 | Not Available | 826 | Open in IMG/M |
| 3300021962|Ga0222713_10426236 | Not Available | 810 | Open in IMG/M |
| 3300021962|Ga0222713_10479617 | Not Available | 748 | Open in IMG/M |
| 3300021963|Ga0222712_10055323 | All Organisms → Viruses → Predicted Viral | 2937 | Open in IMG/M |
| 3300021963|Ga0222712_10086266 | All Organisms → Viruses → Predicted Viral | 2229 | Open in IMG/M |
| 3300021963|Ga0222712_10092357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2136 | Open in IMG/M |
| 3300021963|Ga0222712_10279189 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300022752|Ga0214917_10170326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
| 3300023174|Ga0214921_10129352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1785 | Open in IMG/M |
| 3300023174|Ga0214921_10263424 | Not Available | 997 | Open in IMG/M |
| 3300023174|Ga0214921_10471813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300024277|Ga0255207_1003034 | Not Available | 3330 | Open in IMG/M |
| 3300024277|Ga0255207_1016288 | Not Available | 1237 | Open in IMG/M |
| 3300024311|Ga0255211_1023109 | Not Available | 1154 | Open in IMG/M |
| 3300024346|Ga0244775_10003195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17517 | Open in IMG/M |
| 3300024346|Ga0244775_10255661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1459 | Open in IMG/M |
| 3300024346|Ga0244775_10594619 | Not Available | 898 | Open in IMG/M |
| 3300024346|Ga0244775_10890677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300024496|Ga0255151_1044512 | Not Available | 737 | Open in IMG/M |
| 3300024509|Ga0255175_1048610 | Not Available | 797 | Open in IMG/M |
| 3300024567|Ga0256307_1021372 | Not Available | 1552 | Open in IMG/M |
| 3300025392|Ga0208380_1059469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300025445|Ga0208424_1005089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1465 | Open in IMG/M |
| 3300025476|Ga0208495_1017576 | Not Available | 1350 | Open in IMG/M |
| 3300025732|Ga0208784_1088343 | Not Available | 932 | Open in IMG/M |
| 3300026402|Ga0255304_1042721 | Not Available | 557 | Open in IMG/M |
| 3300027659|Ga0208975_1171353 | Not Available | 595 | Open in IMG/M |
| 3300027710|Ga0209599_10075740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300027749|Ga0209084_1010003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5806 | Open in IMG/M |
| 3300027770|Ga0209086_10102369 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300027785|Ga0209246_10016333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2769 | Open in IMG/M |
| 3300027805|Ga0209229_10064635 | All Organisms → Viruses → Predicted Viral | 1638 | Open in IMG/M |
| 3300027805|Ga0209229_10407806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300027836|Ga0209230_10003851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6299 | Open in IMG/M |
| 3300027896|Ga0209777_10596081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300028083|Ga0255190_1059125 | Not Available | 569 | Open in IMG/M |
| 3300031951|Ga0315904_11116180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300033979|Ga0334978_0004098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8093 | Open in IMG/M |
| 3300033993|Ga0334994_0352329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300034022|Ga0335005_0198888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1244 | Open in IMG/M |
| 3300034022|Ga0335005_0213823 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| 3300034050|Ga0335023_0013528 | All Organisms → Viruses → Predicted Viral | 4776 | Open in IMG/M |
| 3300034066|Ga0335019_0820985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 523 | Open in IMG/M |
| 3300034082|Ga0335020_0062910 | Not Available | 1930 | Open in IMG/M |
| 3300034093|Ga0335012_0409724 | Not Available | 661 | Open in IMG/M |
| 3300034116|Ga0335068_0201586 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 8.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.87% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.87% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.09% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 6.30% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.51% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.72% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.15% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.15% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 3.15% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 3.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.36% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.36% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.57% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.57% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.57% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.57% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.79% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.79% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.79% |
| Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.79% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.79% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.79% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001239 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012347 | Freshwater microbial communities from Fish Creek, Ontario, Canada - S48 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012664 | Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014801 | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024277 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300024311 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024509 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d | Environmental | Open in IMG/M |
| 3300024567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025476 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14M (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026402 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028083 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_00231611 | 3300000176 | Freshwater | MNEDERAGWWAVVCLLMVGAAAYFTIFMIVFSLLKHFFGVE* |
| Draft_102663083 | 3300000558 | Hydrocarbon Resource Environments | VNEGERAGLWAVAYLLIVGVTAYFTIFMIIFSIIKTLVGVE* |
| Draft_103288023 | 3300001239 | Hydrocarbon Resource Environments | MNEGGRAGLWAVAYLLIVGVTAYFTIFMIIFSIIKTLVGVE* |
| Draft_103705342 | 3300001580 | Hydrocarbon Resource Environments | MTEGERAGWWAVAYLLIVGAAAYFTIFMVVFSFIKQYLGD* |
| Draft_102637312 | 3300001605 | Hydrocarbon Resource Environments | MTEGDRAGWWAIVYLLMVGAAAYFTMFVLIFSFVRQLFWN* |
| Draft_103267674 | 3300001605 | Hydrocarbon Resource Environments | MNEGEKSAVWVTVCLLMVGTAAYFTIFMIIFNFVKQLFWS* |
| B570J29032_1098412307 | 3300002408 | Freshwater | MTDGDRAGWWAVVYLLMVGAAAYFTMFMVIFSFIKQMFWS* |
| Ga0031655_103079882 | 3300003852 | Freshwater Lake Sediment | MTSGDRAGWWAIAYLLMVGAAAYFTIFMIVFSFVKKLFWS* |
| Ga0007787_106897591 | 3300004240 | Freshwater Lake | MNEGERAGWWAVAYLLIVGAAAYFTIFMIIFSFAKKLFWS* |
| Ga0007794_101837742 | 3300004774 | Freshwater | MNEGEQAGRWAIVYLLMVGAAAYFSIVMIVFSFVKKLFWS* |
| Ga0071116_10042766 | 3300005077 | Sinkhole | MNEGERAGWWAVVYLLMVGAAAYFTIFMIIFSFVKKLFLELK* |
| Ga0049081_100241937 | 3300005581 | Freshwater Lentic | MSPGDRAGWWAVVLLLMLGATAYFNIFMIVFSFLGVKP* |
| Ga0049081_102297642 | 3300005581 | Freshwater Lentic | MTEGERAGLWAVVYLLMVGAAAYFTMFMIIFSFVKKLFWS* |
| Ga0049080_100242735 | 3300005582 | Freshwater Lentic | MSEGDRAGWWAVVLLLMLGATAYFSIFMIVFSFLRS* |
| Ga0049080_100309122 | 3300005582 | Freshwater Lentic | MTEGERAGRWAIVFLLMVGAAGYFTIFMIIFSFVKKLFWS* |
| Ga0049080_101720681 | 3300005582 | Freshwater Lentic | MNEGDRAGWWAVAILLMVGAAVYFTIFMIVFSFVKETFRS* |
| Ga0078894_103326566 | 3300005662 | Freshwater Lake | MSSGDRAGWWAVVYLLMIGAAAYFTIFMIIFSFIRKLFWS* |
| Ga0079957_10036484 | 3300005805 | Lake | MTDGERAGWWAVVYLLMVGVAAYFTMFMVIFSFIKQMFWS* |
| Ga0079957_10543103 | 3300005805 | Lake | MSPADRAGVWAIVYLLITGATAYFTIFMIVVSFIRQQFWS* |
| Ga0079957_10939463 | 3300005805 | Lake | MTEGDRAGLWAIVYLLLLGAAAYFTIFMVIFSFLRQIFWS* |
| Ga0079957_11952303 | 3300005805 | Lake | MTDGDRAGWWAIAYLLMVGAAAYFTMFMVIFSFIKQYLGD* |
| Ga0070744_100273481 | 3300006484 | Estuarine | MSEGDRAGWWAIVYLLMVGAAAYFTIFMIIFSFVKKLFWS* |
| Ga0070744_100914803 | 3300006484 | Estuarine | MSEGDRAGWWAIVYLLMLGVTAYFSIFMIIFSFVKKLFWS* |
| Ga0070744_102192822 | 3300006484 | Estuarine | MNQRMSEGDRAGWWAIIYLLMVGAAAYFTIFMIIFSFVKKLFWS* |
| Ga0075471_101139705 | 3300006641 | Aqueous | MTDGDKAGWWAMAYLLMVGAAAYFTIFMVIFSFIKQMFWS* |
| Ga0075471_101703645 | 3300006641 | Aqueous | MTEGERAGRWAVALLLLVGVAAYFTIFMVIFSFVKQYLGD* |
| Ga0075471_101784675 | 3300006641 | Aqueous | MTEGDRAGWWAVVYLLMVGVAAYFTMFMVIFSFVKQYLGD* |
| Ga0075471_102501444 | 3300006641 | Aqueous | MTEGERAGRWAVALLLMVGAAAYFTMFMVIFSFIKQYLGD* |
| Ga0070749_107225292 | 3300006802 | Aqueous | MTEGERAGWWAIVYLLIVGAAAYFTIFAVIFSFLKQMCWS* |
| Ga0075464_108954501 | 3300006805 | Aqueous | AGWWAVAYLLMVGAAAYFTIFMIVFSFVKKLFWS* |
| Ga0075473_102155603 | 3300006875 | Aqueous | MTEGERAGWLAVVYLLMVGAAAYFTIFMVIFSFVKQYLGD* |
| Ga0075472_105044712 | 3300006917 | Aqueous | MSEGARAGWWAVAYLLIVGAAAYFTIFMIVFSFVKKLFWS* |
| Ga0102978_10636961 | 3300007177 | Freshwater Lake | MTDGDKAGWWAVVYLLMVGAAAYFTMFMVIFSFLKQTFWS* |
| Ga0102978_13507364 | 3300007177 | Freshwater Lake | MTEGDKAGWWAIVYLLMVGAAAYFTMFTIVISFFEKLFWS* |
| Ga0102828_10293612 | 3300007559 | Estuarine | MSEGEQAGWWAVAYLLIVGAAAYFSIFMIVFSFVKKLFWS* |
| Ga0108970_1055161611 | 3300008055 | Estuary | MSEADRAGWRAVAYLLMMGAAAYFTIVMIIFSFVKKLFWS* |
| Ga0114340_1000005210 | 3300008107 | Freshwater, Plankton | MNEGERAGCWAIVYLLMIGATAYFTIFMIVFSFVKKLFWS* |
| Ga0104242_10630542 | 3300008962 | Freshwater | MTEGDRAGLWAIAYLLLVGAAAYFTIFMVVFSFVKKLIWN* |
| Ga0114962_100139676 | 3300009151 | Freshwater Lake | MNEGEQAGRRAIVYLLMMGAAAYFTIVMIIFSFVKDIFWS* |
| Ga0114966_100996355 | 3300009161 | Freshwater Lake | MMTEGEQAGRWAIVYLLMAGAAAYFTIVMIVFSFVKDIFWS* |
| Ga0114982_11030692 | 3300009419 | Deep Subsurface | MSEGERAGRYAIVYLLIVGAAAYFTIFMIIFSFVKKLFWS* |
| Ga0114964_100048792 | 3300010157 | Freshwater Lake | MMNEGEQAGRWAIVYLLMVGAAAYFSIVMIVFSFVKKLFWS* |
| Ga0114967_1001857612 | 3300010160 | Freshwater Lake | MSEADRAGWWAIVYLLMVGAAAYFTIFMIAFSFVKKLFWS* |
| Ga0114967_103518901 | 3300010160 | Freshwater Lake | MMTEGEQAGRWAIVYLLMAGAAAYFTIVMIIFSFVKDKFRS* |
| Ga0129333_1000734811 | 3300010354 | Freshwater To Marine Saline Gradient | MSEGDRAGVWVVVYLLMVGAAAYFTIFMVIFSFLIK* |
| Ga0129333_102843564 | 3300010354 | Freshwater To Marine Saline Gradient | MTEADRAGWWAVVYLLMVGAAAYFTIFMVIFSFVKKLFWS* |
| Ga0129333_107224084 | 3300010354 | Freshwater To Marine Saline Gradient | MTDGDRAGRWAVALLLLVGVAAYFTIFMVIFSFVKQYLGD* |
| Ga0129333_111789262 | 3300010354 | Freshwater To Marine Saline Gradient | MNEGDRAGWWAIVYLLMVGAAAYFTMFMVIFSFIKRMFWS* |
| Ga0129333_113123592 | 3300010354 | Freshwater To Marine Saline Gradient | MTEGDRAGWWAVVYLLMVGVAAYFTMFMVIFSFIKQMFWS* |
| Ga0129333_116511042 | 3300010354 | Freshwater To Marine Saline Gradient | MTDGDRAGWWAVVYLLMVGAAAYFTMFIVIFSFIKQYLGD* |
| Ga0136551_100018326 | 3300010388 | Pond Fresh Water | MTEGDRAGVWAIVYLLMVGAAAYFTIFMIIFSFVKKLFWS* |
| Ga0136551_10197253 | 3300010388 | Pond Fresh Water | MTEGEKAGWWAIVYLLMVGAAAYFTIFMVIFSFIKRLFWS* |
| Ga0133913_106227218 | 3300010885 | Freshwater Lake | MTEGEQAGRWAIVYLLMAGAAAYFTIVMIVFSFVKDIFWS* |
| Ga0133913_132251562 | 3300010885 | Freshwater Lake | MSEGDRAGWRAVVYLLMAGAAAYFTIFMIVFSFVKDTFWS* |
| Ga0151620_10034763 | 3300011268 | Freshwater | MNEGERAGWWALAYLLMVGAAAYFTMFMVVFSFIKQYLGD* |
| Ga0151620_10309724 | 3300011268 | Freshwater | MTEGDRAGWWAVVYLLMVGAAAYFTMFMIVFSFVKKLFWS* |
| Ga0157142_1000002180 | 3300012347 | Freshwater | MSEGDRAGVWAIVYLLMVGAAAYFTIFMIMFSFVRKMFWG* |
| Ga0157138_10094803 | 3300012352 | Freshwater | MTEGDRAGVWAIVYLLMVGAAAYFTMFMVIFSFVKELFRG* |
| Ga0157497_100000115 | 3300012664 | Freshwater | MSEGDRAGVWAIVYLLMVGAAAYFTIFMIAFSFVRKMFWG* |
| Ga0164293_100431919 | 3300013004 | Freshwater | MTEGERAGWWAVVYLLMAGAAAYFTIFMIIFSYVKKLFWS* |
| Ga0164292_107599592 | 3300013005 | Freshwater | MTEGDQAGWRAVILLLIVGAAAYFTIVMIIFSFIKKLFWS* |
| Ga0136642_1000016128 | 3300013285 | Freshwater | MSEVDRAGWWAVVYLLMIGATAYFTIFMIVFGFVKKLFWS* |
| Ga0177922_110489732 | 3300013372 | Freshwater | MNEGDRAGWWAVAILLMVGAAVYFTIFMIVFSFVKETFWS* |
| Ga0119946_10109243 | 3300014801 | Aquatic | MMSGEKAGWWAIVYLLMVGAAAYFTMFMVIFSFIKRMVWS* |
| Ga0181561_102784193 | 3300018410 | Salt Marsh | MTEGERAGWWAVAYLLLVGAAAYFTIFMVIFSFVKQTF |
| Ga0188839_10076922 | 3300019122 | Freshwater Lake | MTEGDRAGWWAIVYLLMVGAAAYFTMFMIIFSFVKKLFWS |
| Ga0207193_12329306 | 3300020048 | Freshwater Lake Sediment | MTDGDRAGWWAVVYLLMVGAAAYFTIFMVIFSLLNNI |
| Ga0211732_10320344 | 3300020141 | Freshwater | MNEGERAGWWAIVYLLMVGAAAYFTMFMIIFSFVKKLFWS |
| Ga0211733_1068584914 | 3300020160 | Freshwater | MTEGDRAGWWAVVLLVMLGATAYFTIFMIVFSFLRS |
| Ga0211726_102938825 | 3300020161 | Freshwater | MTEGERAGWWAVVYLLMVGAAAYFTMFMIIFSFVKKLFWS |
| Ga0211729_106386843 | 3300020172 | Freshwater | MTEGDRAGWWAVVYLLMVGAAAYFTMFMIIFSFVKKLFWS |
| Ga0211729_111602031 | 3300020172 | Freshwater | MTEGERAGRWAIVLLLIVGAAAYFTMFMIIFSFVKKLFWS |
| Ga0211731_103753783 | 3300020205 | Freshwater | MSEGDRAGWWAVVYLLMVGAAAYFTIIMVIFSFVKKLFWS |
| Ga0211731_104885123 | 3300020205 | Freshwater | MTEGERAGRWAIVYLLIVGAAAYFTMFMIIFSFVKKLFWS |
| Ga0214207_10057885 | 3300020716 | Freshwater | MNEDERAGWWAVVCLLMVGAAAYFTIFMIVFSLLKHFFGVE |
| Ga0214206_10096573 | 3300021131 | Freshwater | MTSGDQAGWWAIAYLLMVGAAAYFTIFMIVFSFVKKLFWS |
| Ga0213922_10546454 | 3300021956 | Freshwater | MTDGERAGWWAVAYLLMVGAAAYFTIFMIVFSFVKKLF |
| Ga0222714_100960812 | 3300021961 | Estuarine Water | MTEGDRAGWWAVVYLLMVGAAAYFTIFMIVFSFVKKMFWS |
| Ga0222714_102697882 | 3300021961 | Estuarine Water | MNEGERAGWWAVVYLLMVGAAVYFTIFAIVFSFVKKWVWG |
| Ga0222714_104234541 | 3300021961 | Estuarine Water | MNEGERAGWWALAYLLMVGAAAYFTMFMVVFSFIKQYLGD |
| Ga0222714_104643273 | 3300021961 | Estuarine Water | MTEGDRAGWWAIAYLLLVGAAAYFTIFMVVFSFVKKLIWS |
| Ga0222713_104143473 | 3300021962 | Estuarine Water | MTEGDRAGWWAVAYLLMVGAAAYFTIFMIAFSFVKKLWS |
| Ga0222713_104262363 | 3300021962 | Estuarine Water | MSEGDRAGWWAVVYLLMVGAAAYFTIFMIVFSFVKKLFWS |
| Ga0222713_104796172 | 3300021962 | Estuarine Water | MTEGERAGVWAIVYLLMVGAAAYFTIFAIAFSFVKQLFWS |
| Ga0222712_1005532311 | 3300021963 | Estuarine Water | MTEGEKAGWWAIAYLLMVGAAAYFTMFMIVFSFLKRLFWS |
| Ga0222712_100862669 | 3300021963 | Estuarine Water | MTEGDRAGWWAVVYLLMVGAAAYFTMFMIVFSFVKKLFWS |
| Ga0222712_100923572 | 3300021963 | Estuarine Water | MTDGDRAGWWAVALLLMVGAAAYFTMFMVIFSFIKQYLGD |
| Ga0222712_102791893 | 3300021963 | Estuarine Water | MSEGERAGWWAVAYLLMVGAAAYFTIFMIVFSFVKKLFWS |
| Ga0214917_101703265 | 3300022752 | Freshwater | MNEGERAGWWAVVYLLMVGAAAYFTIFMIVFSFVKTFFFGVE |
| Ga0214921_101293523 | 3300023174 | Freshwater | MTEGDRAGWWAIVYLLLVGAAAYFTIFMVVFSFVKKLIWG |
| Ga0214921_102634245 | 3300023174 | Freshwater | MTEGDRAGLWAIAYLLLVGAAAYFTIFMVVFSFVKKLIWG |
| Ga0214921_104718132 | 3300023174 | Freshwater | MTEGEKAGWWAIVYLLLVGAAAYFTIFMVVFSFVKKLIWS |
| Ga0255207_10030343 | 3300024277 | Freshwater | MTEGERAGRWAVALLLLVGVAAYFTIFMVIFSFVKQYLGD |
| Ga0255207_10162886 | 3300024277 | Freshwater | MTDGDKAGWWAMAYLLMVGAAAYFTIFMVIFSFIKQMFWS |
| Ga0255211_10231096 | 3300024311 | Freshwater | MTDGDKAGWWAMAYLLMVGAAAYFTIFMVIFSFIKQMF |
| Ga0244775_1000319520 | 3300024346 | Estuarine | MSEGDRAGWWAIVYLLMVGAAAYFTIFMIIFSFVKKLFWS |
| Ga0244775_102556613 | 3300024346 | Estuarine | MSEGDRAGVWAVAYLLMVGAAAYFTIVMIVFSFVKKLFWS |
| Ga0244775_105946193 | 3300024346 | Estuarine | MSEGDRAGWWAIVYLLMLGVTAYFSIFMIIFSFVKKLFWS |
| Ga0244775_108906773 | 3300024346 | Estuarine | MSEGDRAGWRAVVYLLMAGAAAYFTIFMIVFSFVKDTFWS |
| Ga0255151_10445121 | 3300024496 | Freshwater | MNEGERAGWWALAYLLMVGAAAYFTMFMVVFSFIKQ |
| Ga0255175_10486101 | 3300024509 | Freshwater | MTEGERAGWWAIAYILMVGASAYFTIFMIAFCFVKKMFWS |
| Ga0256307_10213726 | 3300024567 | Freshwater | MTSGDRAGWWAIAYLLMVGAAAYFTIFMIVFSFVKKLIWG |
| Ga0208380_10594692 | 3300025392 | Freshwater | MTSGDRAGWWAIAYLLMVGAAAYFTIFMIVFSFVKKLFWS |
| Ga0208424_10050895 | 3300025445 | Aqueous | MTEGERAGWWAIVYLLIVGAAAYFTIFAVIFSFLKQMCWS |
| Ga0208495_10175761 | 3300025476 | Freshwater | MNEGEQAGRWAIVYLLMVGAAAYFSIVMIVFSFVKKLFWS |
| Ga0208784_10883432 | 3300025732 | Aqueous | MTEGERAGRWAVALLLMVGAAAYFTMFMVIFSFIKQYLGD |
| Ga0255304_10427213 | 3300026402 | Freshwater | MTEGERAGWLAVVYLLMVGVAAYFTIFMVIFSFVKQYLGD |
| Ga0208975_11713532 | 3300027659 | Freshwater Lentic | MTEGERAGLWAVVYLLMVGAAAYFTMFMIIFSFVKKLFWS |
| Ga0209599_100757402 | 3300027710 | Deep Subsurface | MSEGERAGRYAIVYLLIVGAAAYFTIFMIIFSFVKKLFWS |
| Ga0209084_101000313 | 3300027749 | Freshwater Lake | MNEGEQAGRRAIVYLLMMGAAAYFTIVMIIFSFVKDIFWS |
| Ga0209086_101023693 | 3300027770 | Freshwater Lake | MTEGEQAGRWAIVYLLMAGAAAYFTIVMIVFSFVKDIFWS |
| Ga0209246_100163336 | 3300027785 | Freshwater Lake | MTEGDRAGWWAVVPLLIVGAAAYFTIFMIIFSFVKKLFWS |
| Ga0209229_100646353 | 3300027805 | Freshwater And Sediment | EGDRAGWWAVVYLLMVGAAAYFTMFMIIFSFVKKLFWS |
| Ga0209229_104078061 | 3300027805 | Freshwater And Sediment | MSEGERAGVWAIVYLLMVGVAAYFTMFMIIFSFVKKLFWS |
| Ga0209230_1000385110 | 3300027836 | Freshwater And Sediment | MSEGDRAGWWAVVYLLMIGAAAYFTIFMIIFSFVKKLFWS |
| Ga0209777_105960813 | 3300027896 | Freshwater Lake Sediment | MNEGERAGWWAVVCLLMVGAAAYFTIFMIVFSLLKHFFGVE |
| Ga0255190_10591251 | 3300028083 | Freshwater | TMTEGERAGRWAVALLLLVGVAAYFTIFMVIFSFVKQYLGD |
| Ga0315904_111161801 | 3300031951 | Freshwater | MTDGERAGRWAVALLLMVGAAAYFTMFMVIFSFIKQYLGD |
| Ga0334978_0004098_367_489 | 3300033979 | Freshwater | MTDGDRAGWWAVVYLLMVGAAAYFTMFMVIFSFIKQMFWS |
| Ga0334994_0352329_490_612 | 3300033993 | Freshwater | MNEGERAGWWAVVYLLMAGAAAYFTIFMIIFSYVKKLFWS |
| Ga0335005_0198888_111_233 | 3300034022 | Freshwater | MNEGERAGWWAVVYLLMAGAAAYFTIVMIIFSFIRKLFWS |
| Ga0335005_0213823_1009_1131 | 3300034022 | Freshwater | MTEGDRAGWWAVVYLLMAGAAAYFTIFMIIFSYVKKLFWS |
| Ga0335023_0013528_4295_4429 | 3300034050 | Freshwater | MNQRMSEGDRAGWWAVVYLLMVGAAAYFTIIMVIFSFVKKLFWS |
| Ga0335019_0820985_191_307 | 3300034066 | Freshwater | MTEGERAGRWAIVYLLIVGATAYFTIFMIIFSFVRQLF |
| Ga0335020_0062910_334_456 | 3300034082 | Freshwater | MTEGDRAGWWAIVYLLMLGVTAYFSIFMIIFSFVKKLFWS |
| Ga0335012_0409724_88_210 | 3300034093 | Freshwater | MNQGERAGWWAVAYLLLIGAAAYFTIFMLFFSFVKDTFWS |
| Ga0335068_0201586_284_406 | 3300034116 | Freshwater | MNEGERAGWWAVVYLLMVGATAYFTIVMIIFSFIRKLFWS |
| ⦗Top⦘ |