| Basic Information | |
|---|---|
| Family ID | F065516 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAITTFIDRSP |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.40 % |
| % of genes near scaffold ends (potentially truncated) | 18.11 % |
| % of genes from short scaffolds (< 2000 bps) | 70.87 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.890 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (14.173 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.283 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (43.307 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.56% β-sheet: 0.00% Coil/Unstructured: 44.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 33.86 |
| PF00873 | ACR_tran | 5.51 |
| PF01370 | Epimerase | 3.15 |
| PF00072 | Response_reg | 2.36 |
| PF01041 | DegT_DnrJ_EryC1 | 2.36 |
| PF12146 | Hydrolase_4 | 1.57 |
| PF03352 | Adenine_glyco | 1.57 |
| PF00689 | Cation_ATPase_C | 1.57 |
| PF07748 | Glyco_hydro_38C | 0.79 |
| PF01230 | HIT | 0.79 |
| PF03992 | ABM | 0.79 |
| PF04794 | YdjC | 0.79 |
| PF13673 | Acetyltransf_10 | 0.79 |
| PF07676 | PD40 | 0.79 |
| PF12697 | Abhydrolase_6 | 0.79 |
| PF07690 | MFS_1 | 0.79 |
| PF04545 | Sigma70_r4 | 0.79 |
| PF13185 | GAF_2 | 0.79 |
| PF13335 | Mg_chelatase_C | 0.79 |
| PF02527 | GidB | 0.79 |
| PF04655 | APH_6_hur | 0.79 |
| PF00561 | Abhydrolase_1 | 0.79 |
| PF16363 | GDP_Man_Dehyd | 0.79 |
| PF01738 | DLH | 0.79 |
| PF00155 | Aminotran_1_2 | 0.79 |
| PF01569 | PAP2 | 0.79 |
| PF00583 | Acetyltransf_1 | 0.79 |
| PF01055 | Glyco_hydro_31 | 0.79 |
| PF08544 | GHMP_kinases_C | 0.79 |
| PF01321 | Creatinase_N | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 2.36 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 2.36 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 2.36 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 2.36 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 2.36 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 2.36 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.57 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 1.57 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.79 |
| COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0383 | Alpha-mannosidase | Carbohydrate transport and metabolism [G] | 0.79 |
| COG1501 | Alpha-glucosidase/xylosidase, GH31 family | Carbohydrate transport and metabolism [G] | 0.79 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.79 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.04 % |
| Unclassified | root | N/A | 14.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_346381 | Not Available | 854 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10197923 | Not Available | 505 | Open in IMG/M |
| 3300002120|C687J26616_10074095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1130 | Open in IMG/M |
| 3300003319|soilL2_10181606 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300003319|soilL2_10274092 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300003461|P42013CM_1069166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 712 | Open in IMG/M |
| 3300003994|Ga0055435_10097955 | Not Available | 772 | Open in IMG/M |
| 3300004778|Ga0062383_10069308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1440 | Open in IMG/M |
| 3300004779|Ga0062380_10161052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 884 | Open in IMG/M |
| 3300005289|Ga0065704_10418205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 734 | Open in IMG/M |
| 3300005294|Ga0065705_10343625 | Not Available | 968 | Open in IMG/M |
| 3300005294|Ga0065705_10857423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 590 | Open in IMG/M |
| 3300005295|Ga0065707_11056077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 525 | Open in IMG/M |
| 3300005440|Ga0070705_100104545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1796 | Open in IMG/M |
| 3300005577|Ga0068857_100689008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 970 | Open in IMG/M |
| 3300005829|Ga0074479_10743711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales | 5602 | Open in IMG/M |
| 3300005829|Ga0074479_10949375 | All Organisms → cellular organisms → Bacteria | 4232 | Open in IMG/M |
| 3300005833|Ga0074472_10535973 | All Organisms → cellular organisms → Bacteria | 3404 | Open in IMG/M |
| 3300005844|Ga0068862_101128845 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300006844|Ga0075428_100485513 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300006844|Ga0075428_102496952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300006846|Ga0075430_100049702 | All Organisms → cellular organisms → Bacteria | 3539 | Open in IMG/M |
| 3300006847|Ga0075431_101551869 | Not Available | 620 | Open in IMG/M |
| 3300006865|Ga0073934_10015272 | All Organisms → cellular organisms → Bacteria | 8607 | Open in IMG/M |
| 3300006865|Ga0073934_10036534 | All Organisms → cellular organisms → Bacteria | 4563 | Open in IMG/M |
| 3300006880|Ga0075429_100823674 | Not Available | 813 | Open in IMG/M |
| 3300009053|Ga0105095_10267614 | Not Available | 938 | Open in IMG/M |
| 3300009081|Ga0105098_10000068 | All Organisms → cellular organisms → Bacteria | 29209 | Open in IMG/M |
| 3300009081|Ga0105098_10056386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cardiobacteriales → Cardiobacteriaceae → Cardiobacterium | 1613 | Open in IMG/M |
| 3300009091|Ga0102851_12947851 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009100|Ga0075418_10324857 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300009146|Ga0105091_10085791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1430 | Open in IMG/M |
| 3300009147|Ga0114129_11232031 | Not Available | 930 | Open in IMG/M |
| 3300009157|Ga0105092_10014595 | All Organisms → cellular organisms → Bacteria | 4124 | Open in IMG/M |
| 3300009166|Ga0105100_10798379 | Not Available | 585 | Open in IMG/M |
| 3300009168|Ga0105104_10005044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9052 | Open in IMG/M |
| 3300009168|Ga0105104_10046983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2360 | Open in IMG/M |
| 3300009168|Ga0105104_10401277 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300009817|Ga0105062_1129268 | Not Available | 517 | Open in IMG/M |
| 3300009821|Ga0105064_1130531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
| 3300009823|Ga0105078_1011134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 966 | Open in IMG/M |
| 3300009837|Ga0105058_1166794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
| 3300009873|Ga0131077_11535569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 546 | Open in IMG/M |
| 3300010040|Ga0126308_11146233 | Not Available | 549 | Open in IMG/M |
| 3300010399|Ga0134127_10078841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2820 | Open in IMG/M |
| 3300011431|Ga0137438_1097852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 891 | Open in IMG/M |
| 3300011441|Ga0137452_1015863 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon | 2305 | Open in IMG/M |
| 3300011442|Ga0137437_1161487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 776 | Open in IMG/M |
| 3300011442|Ga0137437_1249860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 613 | Open in IMG/M |
| 3300011444|Ga0137463_1007348 | All Organisms → cellular organisms → Bacteria | 3709 | Open in IMG/M |
| 3300012204|Ga0137374_10015716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8711 | Open in IMG/M |
| 3300012204|Ga0137374_10154114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2046 | Open in IMG/M |
| 3300012228|Ga0137459_1167879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 647 | Open in IMG/M |
| 3300012353|Ga0137367_10112928 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300012675|Ga0137337_1059206 | Not Available | 601 | Open in IMG/M |
| 3300014882|Ga0180069_1006935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2274 | Open in IMG/M |
| 3300014882|Ga0180069_1027320 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300015259|Ga0180085_1196314 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300017997|Ga0184610_1164452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 733 | Open in IMG/M |
| 3300018028|Ga0184608_10113571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1142 | Open in IMG/M |
| 3300018052|Ga0184638_1028780 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
| 3300018053|Ga0184626_10022271 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
| 3300018053|Ga0184626_10204813 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300018053|Ga0184626_10281024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 693 | Open in IMG/M |
| 3300018054|Ga0184621_10032783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1669 | Open in IMG/M |
| 3300018056|Ga0184623_10093093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1391 | Open in IMG/M |
| 3300018059|Ga0184615_10001580 | All Organisms → cellular organisms → Bacteria | 12276 | Open in IMG/M |
| 3300018059|Ga0184615_10311388 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300018061|Ga0184619_10377661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 645 | Open in IMG/M |
| 3300018075|Ga0184632_10027825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2407 | Open in IMG/M |
| 3300018078|Ga0184612_10085135 | Not Available | 1652 | Open in IMG/M |
| 3300018081|Ga0184625_10336732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 785 | Open in IMG/M |
| 3300018084|Ga0184629_10034857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2206 | Open in IMG/M |
| 3300018084|Ga0184629_10139335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1222 | Open in IMG/M |
| 3300018084|Ga0184629_10681006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
| 3300020003|Ga0193739_1010727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2407 | Open in IMG/M |
| 3300020003|Ga0193739_1043019 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300020003|Ga0193739_1094324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 757 | Open in IMG/M |
| 3300020068|Ga0184649_1112940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geotalea → Geotalea uraniireducens | 2638 | Open in IMG/M |
| 3300021073|Ga0210378_10067296 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300021090|Ga0210377_10083454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2155 | Open in IMG/M |
| 3300021090|Ga0210377_10146007 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300021090|Ga0210377_10441561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 763 | Open in IMG/M |
| 3300021090|Ga0210377_10675019 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300025119|Ga0209126_1028210 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300025165|Ga0209108_10381174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 694 | Open in IMG/M |
| 3300025167|Ga0209642_10031166 | Not Available | 3114 | Open in IMG/M |
| 3300025310|Ga0209172_10024772 | All Organisms → cellular organisms → Bacteria | 4170 | Open in IMG/M |
| 3300025310|Ga0209172_10148161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1288 | Open in IMG/M |
| 3300025313|Ga0209431_10019379 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon | 5230 | Open in IMG/M |
| 3300025313|Ga0209431_10055217 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
| 3300025314|Ga0209323_10089729 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon | 2086 | Open in IMG/M |
| 3300025318|Ga0209519_10497619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 684 | Open in IMG/M |
| 3300025319|Ga0209520_10713377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 563 | Open in IMG/M |
| 3300025324|Ga0209640_10148529 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300026116|Ga0207674_10412020 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300027163|Ga0209878_1018438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 944 | Open in IMG/M |
| 3300027379|Ga0209842_1066233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 639 | Open in IMG/M |
| 3300027675|Ga0209077_1004269 | All Organisms → cellular organisms → Bacteria | 3778 | Open in IMG/M |
| 3300027675|Ga0209077_1087703 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300027722|Ga0209819_10004230 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon | 4556 | Open in IMG/M |
| 3300027722|Ga0209819_10060362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1307 | Open in IMG/M |
| 3300027722|Ga0209819_10181510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 735 | Open in IMG/M |
| 3300027731|Ga0209592_1196605 | Not Available | 711 | Open in IMG/M |
| 3300027743|Ga0209593_10013479 | All Organisms → cellular organisms → Bacteria | 3360 | Open in IMG/M |
| 3300027743|Ga0209593_10049027 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300027743|Ga0209593_10097688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1083 | Open in IMG/M |
| 3300027778|Ga0209464_10160274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 793 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10072964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1166 | Open in IMG/M |
| 3300027843|Ga0209798_10108596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1409 | Open in IMG/M |
| 3300027887|Ga0208980_10785935 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300027909|Ga0209382_10994590 | Not Available | 875 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10107157 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10196930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 663 | Open in IMG/M |
| 3300031099|Ga0308181_1039617 | Not Available | 855 | Open in IMG/M |
| 3300031576|Ga0247727_10035318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 6686 | Open in IMG/M |
| 3300031576|Ga0247727_10403151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1103 | Open in IMG/M |
| 3300031873|Ga0315297_10166614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1800 | Open in IMG/M |
| 3300031873|Ga0315297_10452019 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300031949|Ga0214473_10763388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1047 | Open in IMG/M |
| 3300032053|Ga0315284_10059462 | All Organisms → cellular organisms → Bacteria | 5227 | Open in IMG/M |
| 3300032156|Ga0315295_11237571 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300032401|Ga0315275_11214925 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300033417|Ga0214471_10162622 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300033487|Ga0316630_11169202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 681 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 14.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 13.39% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 9.45% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.30% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 4.72% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.72% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 3.15% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.15% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.15% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.36% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.57% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.57% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.79% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.79% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.79% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.79% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300000228 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66 | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003461 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P4 sample | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012163 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2 | Environmental | Open in IMG/M |
| 3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012675 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2 | Environmental | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300025119 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0023.00000050 | 2162886013 | Switchgrass Rhizosphere | MDMSAIADWCTILFLLWYGLKTFVPALGKGYGAIIGGIIALAAALATFIDRSP |
| TB_PC08_66DRAFT_101979232 | 3300000228 | Groundwater | MDYSVIADWFTILFFFWFGLKKFVPALDKGAYPTIGAIIALGAAIFTAMSA* |
| C687J26616_100740952 | 3300002120 | Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVSTFIDRSP* |
| soilL2_101816062 | 3300003319 | Sugarcane Root And Bulk Soil | MSSSGIVDWLTILFFAWFGLKVFVPALNKGFFTILGGIIALAAAIAIILDTSP* |
| soilL2_102740921 | 3300003319 | Sugarcane Root And Bulk Soil | MDYSIIADWFTILFLLWFGLKQFIPALDKGFFPYVGGAIALAAALFTALST* |
| P42013CM_10691661 | 3300003461 | Ore Pile And Mine Drainage Contaminated Soil | MDMSAIADWFTILFFLWFGLKNFIPALDKGFFATIGAIIALFAAVFIFLSP* |
| Ga0055435_100979551 | 3300003994 | Natural And Restored Wetlands | MDLSIVADWFVVLFFLWYGLKQFIPALNKGIFQYVGGIIIALA |
| Ga0062383_100693082 | 3300004778 | Wetland Sediment | MGMPAIADWYTILFFLSFGLKTFIPALDKGFFSTLAAIIALPATVTTFIDRNP* |
| Ga0062380_101610522 | 3300004779 | Wetland Sediment | MDLSVVADWFTILFLLWYGLKQFIPALGKGFFPYVGGVLALAAALFTALST* |
| Ga0065704_104182052 | 3300005289 | Switchgrass Rhizosphere | MDMSTIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAITTIIDTSP* |
| Ga0065705_103436252 | 3300005294 | Switchgrass Rhizosphere | MDMSAIADWCTILFLLWYGLKTFVPALGKGYGAIIGGIIALAAALATFIDRSP* |
| Ga0065705_108574231 | 3300005294 | Switchgrass Rhizosphere | MDMSTIADWCTILFFLWFGLKTFIPALDKGFFSTLGGLIALAAAITTIIDTSP* |
| Ga0065707_110560772 | 3300005295 | Switchgrass Rhizosphere | MSMSTIADWFTILFFLWFGLKTFIPALDKGLSSSLGGILALAA |
| Ga0070705_1001045452 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTFIDTSP* |
| Ga0068857_1006890082 | 3300005577 | Corn Rhizosphere | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAITTIIDTSP* |
| Ga0074479_107437115 | 3300005829 | Sediment (Intertidal) | MDMSAIADWCTILFLLWYGLKTLIPALGKGYFSTLGGILALAAAITTILDRSA* |
| Ga0074479_109493752 | 3300005829 | Sediment (Intertidal) | MNMSTIADWCTILFLLWFGLKTFIPALDKGFFSTLGGILALAAALTTFLDRSA* |
| Ga0074472_105359733 | 3300005833 | Sediment (Intertidal) | MDMPAIADWCTISFFLSFGLKTFIPALDEVFFSTLAGIIALPATVTTFIDRNP* |
| Ga0068862_1011288452 | 3300005844 | Switchgrass Rhizosphere | MDMSAISDWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTFIDTSP* |
| Ga0075428_1004855132 | 3300006844 | Populus Rhizosphere | MSMSGIVDWLTILFFVWFGLRVFVPSLQKGYFSILGGIIALAAAIALILDTSP* |
| Ga0075428_1024969522 | 3300006844 | Populus Rhizosphere | MDYSVIADWLTIAFFLWFGLKKFLPALDQGFFPTLGAILALGAAIFTALST* |
| Ga0075430_1000497021 | 3300006846 | Populus Rhizosphere | MDYSVIADWLTIAFFLWFGLKKFLPALDQGFFPTLGAILALGAAIFTAL |
| Ga0075431_1015518691 | 3300006847 | Populus Rhizosphere | MDWSAIADWMTILFLLWYGLKTFVPALNKGTATYIGGILALAAAITTFVDRSP* |
| Ga0073934_100152726 | 3300006865 | Hot Spring Sediment | MSVSGIVDWLTILFFLWVGLKLVVPTLNKDRGFFNILGGIIALAAAIAIILDTSP* |
| Ga0073934_100365344 | 3300006865 | Hot Spring Sediment | MDFSTIADWMTILFFLWFGLKTLIPALDNRTSSLIGGIIALAAAISIFIDRSP* |
| Ga0075429_1008236741 | 3300006880 | Populus Rhizosphere | MDYSVIADWLTIAFFLWFGLKKFLPALDQGFFPTLGAILALGAAIFT |
| Ga0105095_102676142 | 3300009053 | Freshwater Sediment | MDLSIIADWFTVVFFLWFGLKIFIPALDKGVFQILGGVVALGAALFTALST* |
| Ga0105098_1000006818 | 3300009081 | Freshwater Sediment | MDMSAIADWMTILFFLWYGLKTFIPALQKGPSITIGGIIALAAAITIFLDSSP* |
| Ga0105098_100563862 | 3300009081 | Freshwater Sediment | MDTSAIADIVTILFFLWYALKTFIPALQKGYFSYLGGVLALIAVIVLFIDRSP* |
| Ga0102851_129478511 | 3300009091 | Freshwater Wetlands | MINPKISKGENSMDMSVIADWFTILFLLWFGLKHFIPSLDKGFMATVGAVIALAAAVFTA |
| Ga0075418_103248572 | 3300009100 | Populus Rhizosphere | MDWSTIADWTTILFFLWFGLKMLVPSLDKGFYSILGGIIALVAAISIFIDRSP* |
| Ga0105091_100857911 | 3300009146 | Freshwater Sediment | MDMSAIADWMTILFFLWYGLKVLIPALQKGFFLTLGGIIALAAAIAIFIDRSP* |
| Ga0114129_112320312 | 3300009147 | Populus Rhizosphere | MDMSTIADWCTILFFLWFGLKTLIPALGKGFFSTLGGIIALAAAITTFI |
| Ga0105092_100145954 | 3300009157 | Freshwater Sediment | MDMSAIADWMTILFFLWYGLKTFIPALQKGPSVTIGGIIALAAAITIFLDSSP* |
| Ga0105100_107983791 | 3300009166 | Freshwater Sediment | MDRSIIADWFTVVFFLWFGLKIFIPALDKGVFQILGGVVALGAALFTALST* |
| Ga0105104_100050446 | 3300009168 | Freshwater Sediment | MDLSIIADWFTIAFFLWFGLKYFIPALDKGFFPAVGAVIALAAAVFTALST* |
| Ga0105104_100469831 | 3300009168 | Freshwater Sediment | MSMSAIVDWLAILFFLWFGLKTFIPALSKGSLSILGGILALAAALSIILDRSP* |
| Ga0105104_104012771 | 3300009168 | Freshwater Sediment | MSAIADWMTILFFLWYGLKTFIPALQKGPSVTIGGIIALAAAITIFLDSSP* |
| Ga0105062_11292681 | 3300009817 | Groundwater Sand | MDMSTIADWMTILFFLWFGLKTLIPALDKGVSSIIGGIIALAAAISIYIDRSP* |
| Ga0105064_11305311 | 3300009821 | Groundwater Sand | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGG |
| Ga0105078_10111342 | 3300009823 | Groundwater Sand | LITKEKKIMDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAITTFIDRSP* |
| Ga0105058_11667942 | 3300009837 | Groundwater Sand | LITKEKKIMDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTFIDRSP* |
| Ga0131077_115355691 | 3300009873 | Wastewater | MNWSAIADWMTILFFLWYGLKMFIPALNQSPSNVIGGILAIAAAISIMLSP* |
| Ga0126308_111462332 | 3300010040 | Serpentine Soil | MDLSIIADWFTVLFFLWFGLKQFIPALNKGFSLYVGGVIALAAALFTALST* |
| Ga0134127_100788414 | 3300010399 | Terrestrial Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLAGIIALAAAVTTFIDTSP* |
| Ga0137438_10978521 | 3300011431 | Soil | MDMSAIADWCTILFFLWFGLKTFVPALDKGFFSTLGGIFALAAALTTILDRSG* |
| Ga0137452_10158633 | 3300011441 | Soil | MDMSVIADWCTILFFLWFGLKKFIPALDKDMFSTIGAILALAAAVFTALST* |
| Ga0137437_11614872 | 3300011442 | Soil | MDISVIADWFTILFFLWYGLKKLIPALDKGFLSTLGAVIALAAAVFTALST* |
| Ga0137437_12498602 | 3300011442 | Soil | MDYSTIADWFTILFFLWFGLKKFIPQLDQGFFSTLGAIIALAAAITTI |
| Ga0137463_10073483 | 3300011444 | Soil | MNMSTIADWCTILFLLWFGLKTFIPALDKGFFSTLGGIFALAAAITTILDRST* |
| Ga0137355_10498682 | 3300012163 | Soil | MDYSTIADWLTILFLLWFGLKKFIPALDKDIFSTIGAIFALAAAVFTALST* |
| Ga0137357_10352433 | 3300012168 | Soil | LWFGLKKFIPALDKDIFSTIGAIFALAAAVFTALST* |
| Ga0137374_100157162 | 3300012204 | Vadose Zone Soil | MDLSIVADWFTIVFFLWFGLKTFIPALDKGLFQIFGGVIALGAAIFTALST* |
| Ga0137374_101541142 | 3300012204 | Vadose Zone Soil | MIADWLTILFFLWFGLKTFIPALDKGYFAMLGGIIALGAAITIFIDRTP* |
| Ga0137459_11678792 | 3300012228 | Soil | MDYSTIADWFTIAFLLWFGLKKFIPALDKDIFSTIGAIIALAAAVFTALST* |
| Ga0137367_101129282 | 3300012353 | Vadose Zone Soil | MDLSIVADWFTIIFFLWFGLKTFIPALDKGLFQIFGGVIALGAAIFTALST* |
| Ga0137337_10592062 | 3300012675 | Soil | MDYSTIADWFTILFFLWFGLKKFIPALDEGYFSTLGAL |
| Ga0180069_10069354 | 3300014882 | Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFCSTLGGIIALAAAITTFIDRSP* |
| Ga0180069_10273202 | 3300014882 | Soil | MNMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTIIDTSP* |
| Ga0180085_11963141 | 3300015259 | Soil | MSAIADWCTILFFLWFGLKTFIPALDKGLFSTLGGIIALAAAITTFLDRSP* |
| Ga0184610_11644522 | 3300017997 | Groundwater Sediment | MTIAVHHKGEKIMDMSAISDWCTILFFLWFGLKTFIPALDKGFFSILGGIIALAAAVTTFIDSSP |
| Ga0184608_101135712 | 3300018028 | Groundwater Sediment | MDMSAIADWCTILFFLWFGLKTFIPALDKGLFSTLGGIIALAAAVTTFIDTSP |
| Ga0184638_10287802 | 3300018052 | Groundwater Sediment | MSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTFIDSSP |
| Ga0184626_100222714 | 3300018053 | Groundwater Sediment | MDMSAIADWCTILFLLWYGLKTLIPALNQGFSLTLGGIIALAAAITTFID |
| Ga0184626_102048132 | 3300018053 | Groundwater Sediment | MDMSAIADWSTILFLLWYGLKTLIPALNQGFSLTLGGILALAAAITTFIDRSP |
| Ga0184626_102810241 | 3300018053 | Groundwater Sediment | MSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTFIDRSP |
| Ga0184621_100327833 | 3300018054 | Groundwater Sediment | MDMSAISDWCTILFFLWFGLKTFIPALDKGFFSILGGIIALAAAVTTFIDSSP |
| Ga0184623_100930932 | 3300018056 | Groundwater Sediment | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTFIDRSP |
| Ga0184615_100015806 | 3300018059 | Groundwater Sediment | MDYSIIADWFTILFFLWFGLKKFIPALDQGIFPTVGAIIALGAAVFTIMST |
| Ga0184615_103113882 | 3300018059 | Groundwater Sediment | MDYSTIADWFTILFFLWFGLKNFIPALDKSYFSTLGALLALAAAITTILDRSA |
| Ga0184619_103776611 | 3300018061 | Groundwater Sediment | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAITTIIDTR |
| Ga0184632_100278252 | 3300018075 | Groundwater Sediment | MDMSAISDWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTFIDSSP |
| Ga0184612_100851352 | 3300018078 | Groundwater Sediment | MDMSAIADWCTILFLLWYGLKTLIPALNQGFSLTLGGIIALAAAITTFIDRSP |
| Ga0184625_103367322 | 3300018081 | Groundwater Sediment | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAITTFIDRSP |
| Ga0184629_100348572 | 3300018084 | Groundwater Sediment | MDMSIIADWFTIIFFLWFGLKKFIPALDKDIFSTFGAIIALAAAIFTALST |
| Ga0184629_101393352 | 3300018084 | Groundwater Sediment | MSMSTIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAITTILDRSA |
| Ga0184629_106810062 | 3300018084 | Groundwater Sediment | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTFIDTSP |
| Ga0193739_10107272 | 3300020003 | Soil | MSGSGIVDWLTILFFAWFGLRVFVPALNKGFFSILGGIIALAAAIAIILDTSP |
| Ga0193739_10430191 | 3300020003 | Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTIGGIIALAAAVTTFLDRSP |
| Ga0193739_10943241 | 3300020003 | Soil | MDWSTIADWMTILFFLWYGLKTFIPALNKGTAAYIGGAIALLAAISIFIDRSP |
| Ga0184649_11129401 | 3300020068 | Groundwater Sediment | ILFFLWFWLKNFIPALDKGYFSTLGALLALAAAITTILDRSA |
| Ga0210378_100672962 | 3300021073 | Groundwater Sediment | MTIAVHHKGEKIMDMSAISDWCTILFFLWFGLKTFIPAFDKGFFSTLGGIIALAAAVTTFIDSSP |
| Ga0210377_100834542 | 3300021090 | Groundwater Sediment | MKGDQSMDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAISTFIDRSP |
| Ga0210377_101460072 | 3300021090 | Groundwater Sediment | MQEGENAVDLSIVADWLTILFLLWYGLKQFIPALGKGSFPYVGGVIALAAALFTALST |
| Ga0210377_104415611 | 3300021090 | Groundwater Sediment | MDYSTIADWFTILFFLWFGLKKFIPALDKDYFSTLGALLALAAAITTILDRSA |
| Ga0210377_106750191 | 3300021090 | Groundwater Sediment | MDYSTIADWFTILFFLWFGLKNFIPALDKGYFSTLGALLALAAAITTILDRSA |
| Ga0209126_10282102 | 3300025119 | Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVSTFIDRSP |
| Ga0209108_103811741 | 3300025165 | Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAA |
| Ga0209642_100311661 | 3300025167 | Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIAL |
| Ga0209172_100247723 | 3300025310 | Hot Spring Sediment | MDFSTIADWMTILFFLWFGLKTLIPALDNRTSSLIGGIIALAAAISIFIDRSP |
| Ga0209172_101481612 | 3300025310 | Hot Spring Sediment | MSVSGIVDWLTILFFLWVGLKLVVPTLNKDRGFFNILGGIIALAAAIAIILDTSP |
| Ga0209431_100193794 | 3300025313 | Soil | MDYSTIADWFTIAFLLWFGLKKFIPALDNDIFSTLGAIIALAAAVFTILST |
| Ga0209431_100552172 | 3300025313 | Soil | MDMSVVADWFVILFFLWFGLKKFIPALDTGFFPTLGAILALGVALFTLLS |
| Ga0209323_100897292 | 3300025314 | Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFTTLGGIIALAAAVSTFIDRSP |
| Ga0209519_104976192 | 3300025318 | Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVSTFIDRSESDNASE |
| Ga0209520_107133771 | 3300025319 | Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVSTFIDR |
| Ga0209640_101485293 | 3300025324 | Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFTTLGGIIALAAAVTTFIDRSP |
| Ga0207674_104120202 | 3300026116 | Corn Rhizosphere | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAITTIIDTSP |
| Ga0209878_10184382 | 3300027163 | Groundwater Sand | LITKEKKIMDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTFIDRS |
| Ga0209842_10662332 | 3300027379 | Groundwater Sand | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTIIDTSP |
| Ga0209077_10042692 | 3300027675 | Freshwater Sediment | MDTSAIADIVTILFFLWYALKTFIPALQKGYFSYLGGVLALIAVIVLFIDRSP |
| Ga0209077_10877032 | 3300027675 | Freshwater Sediment | MTMSGVVDWLAILFFLWFGLKTFIPALNKAPLSIVGGILALAAALAIILDTSP |
| Ga0209819_100042304 | 3300027722 | Freshwater Sediment | LMDMSAIADWMTILFFLWYGLKTFIPALQKGPSVTIGGIIALAAAITIFLDSSP |
| Ga0209819_100603622 | 3300027722 | Freshwater Sediment | MDMSAIADWMTILFFLWYGLKTFIPALQKGPSITIGGIIALAAAITIFLDSSP |
| Ga0209819_101815101 | 3300027722 | Freshwater Sediment | MDMSAIADWMTILFFLWYGLKTFIPALQKGPSVTIGGIIA |
| Ga0209592_11966052 | 3300027731 | Freshwater Sediment | MDLSIIADWFTVVFFLWFGLKIFIPALDKGVFQILGGVVALGAALFTALST |
| Ga0209593_100134792 | 3300027743 | Freshwater Sediment | MDLSIIADWFTIAFFLWFGLKYFIPALDKGFFPAVGAVIALAAAVFTALST |
| Ga0209593_100490273 | 3300027743 | Freshwater Sediment | MDMSAIADWMTILFFLWYGLKTFIPALQKGPSVTIGGIIALAAAITIFLDSSP |
| Ga0209593_100976882 | 3300027743 | Freshwater Sediment | MSMSAIVDWLAILFFLWFGLKTFIPALSKGSLSILGGILALAAALSIILDRSP |
| Ga0209464_101602741 | 3300027778 | Wetland Sediment | MDLSVVADWFTILFLLWYGLKQFIPALGKGFFPYVGGVLALAAALFTALST |
| (restricted) Ga0233416_100729642 | 3300027799 | Sediment | MSILADWFTIIFFVWFGLKKFIPALDQGFFPTLGAIVALGAAVFTALST |
| Ga0209798_101085963 | 3300027843 | Wetland Sediment | MGMPAIADWYTILFFLSFGLKTFIPALDKGFFSTLAAIIALPATVTTFIDRNP |
| Ga0208980_107859351 | 3300027887 | Wetland | DWFTILFFLWFGLKKFIPILDKNVSQTIGAIIALAAAFFTLLST |
| Ga0209382_109945901 | 3300027909 | Populus Rhizosphere | MDWSAIADWMTILFLLWYGLKTFVPALNKGTATYIGGILALAAAITTFVDRSP |
| (restricted) Ga0233418_101071571 | 3300027995 | Sediment | MDYSIIADWFTIAFFLWFGLKKFIPALDKGFFPTVGAVIALFAGVFTIFSM |
| (restricted) Ga0233418_101969302 | 3300027995 | Sediment | MDMSVIADWFTIIFFAWFGLKKFIPALDQGFFPTLGAIIALGAAVFTALST |
| Ga0308181_10396172 | 3300031099 | Soil | MDMSAIADWCTILFFLWFGLKTFIPALDKGFFSTLGGIIALAAAVTTFI |
| Ga0247727_100353187 | 3300031576 | Biofilm | MDMSKIADWCTILFFLWFGLKKFVPALDKDIFSTLGAIIALAAAVFTALSI |
| Ga0247727_104031512 | 3300031576 | Biofilm | MDMSVVADWFTILFFAWFGLKKFIPALDQGFFPTLGAIIALGAAVFTALSA |
| Ga0315297_101666142 | 3300031873 | Sediment | MDYSIIADWFTILFFLWFGLKRFIPALDKRFLSALGAIIALLAAVFTALST |
| Ga0315297_104520192 | 3300031873 | Sediment | MDYSVIADWFTILFLLWFGLKRFIPALDKRFFSALGAIIALLAAVFTILST |
| Ga0214473_107633881 | 3300031949 | Soil | MDMSVVADWFVILFFLWFGLKKFIPALDTGFFPTLGAILALGVALFTFLS |
| Ga0315284_100594624 | 3300032053 | Sediment | MDLSTIADWFTILFFLWFGLKKFIPVLDKNLFQTIGAIIALLAAIFTFLSP |
| Ga0315295_112375711 | 3300032156 | Sediment | MDYSVIADWFTILFFLWFGLKRFIPALDKRFFSVLGALVALLAAVFTILST |
| Ga0315275_112149251 | 3300032401 | Sediment | MNLSTIADWFTILFFLWFGLKKFIPVLDKNLFQTIGAIIALLAAVFTFLSP |
| Ga0214471_101626224 | 3300033417 | Soil | MSAIADWCTILFFLWFGLKTFIPALDKGFFSALGGIIALAAAVTTFLDRSP |
| Ga0316630_111692021 | 3300033487 | Soil | MDLSVVADWLTVLFLAWFGLKKFIPALDQGIFATTGAVLALGAAV |
| ⦗Top⦘ |