NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065174

Metagenome / Metatranscriptome Family F065174

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065174
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 52 residues
Representative Sequence VGAIYPGEVTLKIASADIGTLEPFQAPPPETKWLPGKPPLTTRMSNWLRGKR
Number of Associated Samples 117
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.80 %
% of genes near scaffold ends (potentially truncated) 96.09 %
% of genes from short scaffolds (< 2000 bps) 92.19 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.625 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.188 % of family members)
Environment Ontology (ENVO) Unclassified
(23.438 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.812 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.50%    β-sheet: 0.00%    Coil/Unstructured: 82.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF09900DUF2127 3.91
PF00027cNMP_binding 3.12
PF08241Methyltransf_11 2.34
PF00877NLPC_P60 2.34
PF04828GFA 1.56
PF01872RibD_C 1.56
PF12681Glyoxalase_2 1.56
PF03631Virul_fac_BrkB 1.56
PF02776TPP_enzyme_N 1.56
PF09413DUF2007 1.56
PF00909Ammonium_transp 1.56
PF01243Putative_PNPOx 1.56
PF01741MscL 1.56
PF05235CHAD 1.56
PF00480ROK 0.78
PF12740Chlorophyllase2 0.78
PF02357NusG 0.78
PF13649Methyltransf_25 0.78
PF00690Cation_ATPase_N 0.78
PF07883Cupin_2 0.78
PF05257CHAP 0.78
PF01855POR_N 0.78
PF030614HBT 0.78
PF02126PTE 0.78
PF01545Cation_efflux 0.78
PF01906YbjQ_1 0.78
PF03734YkuD 0.78
PF00561Abhydrolase_1 0.78
PF14534DUF4440 0.78
PF03706LPG_synthase_TM 0.78
PF13427DUF4111 0.78
PF03861ANTAR 0.78
PF00248Aldo_ket_red 0.78
PF00160Pro_isomerase 0.78
PF00230MIP 0.78
PF02371Transposase_20 0.78
PF13302Acetyltransf_3 0.78
PF00471Ribosomal_L33 0.78
PF07859Abhydrolase_3 0.78
PF07228SpoIIE 0.78
PF02423OCD_Mu_crystall 0.78
PF04075F420H2_quin_red 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 2.34
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 1.56
COG5607CHAD domain, binds inorganic polyphosphatesFunction unknown [S] 1.56
COG3791Uncharacterized conserved proteinFunction unknown [S] 1.56
COG3025Inorganic triphosphatase YgiF, contains CYTH and CHAD domainsInorganic ion transport and metabolism [P] 1.56
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 1.56
COG1970Large-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 1.56
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.56
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 1.56
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 1.56
COG0267Ribosomal protein L33Translation, ribosomal structure and biogenesis [J] 0.78
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.78
COG4231TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunitEnergy production and conversion [C] 0.78
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.78
COG0250Transcription termination/antitermination protein NusGTranscription [K] 0.78
COG3707Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domainsTranscription [K] 0.78
COG3547TransposaseMobilome: prophages, transposons [X] 0.78
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.78
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 0.78
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 0.78
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.78
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.78
COG1735Predicted metal-dependent hydrolase, phosphotriesterase familyGeneral function prediction only [R] 0.78
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.78
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.78
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.78
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.78
COG0674Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunitEnergy production and conversion [C] 0.78
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.62 %
UnclassifiedrootN/A34.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908006|FWIROz_GKA24FP02H8BR5Not Available505Open in IMG/M
2170459009|GA8DASG01ARE6KAll Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
2189573002|GZIGXIF01B7JBSNot Available504Open in IMG/M
3300000886|AL3A1W_1301740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia797Open in IMG/M
3300000956|JGI10216J12902_105162363Not Available850Open in IMG/M
3300001532|A20PFW1_1004557Not Available906Open in IMG/M
3300001535|A3PFW1_10133149Not Available1112Open in IMG/M
3300001538|A10PFW1_11484328Not Available1024Open in IMG/M
3300004114|Ga0062593_101183304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium801Open in IMG/M
3300005169|Ga0066810_10135116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300005187|Ga0066675_11243975Not Available551Open in IMG/M
3300005329|Ga0070683_101006574All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300005355|Ga0070671_101220139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300005435|Ga0070714_101861422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300005436|Ga0070713_101097147All Organisms → cellular organisms → Bacteria → Terrabacteria group769Open in IMG/M
3300005468|Ga0070707_100277894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1628Open in IMG/M
3300005468|Ga0070707_101271054Not Available702Open in IMG/M
3300005468|Ga0070707_101866311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300005537|Ga0070730_11028582Not Available513Open in IMG/M
3300005547|Ga0070693_100488706Not Available871Open in IMG/M
3300005558|Ga0066698_10430827All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300005559|Ga0066700_10739504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Eremiobacterota → unclassified Candidatus Eremiobacteraeota → Candidatus Eremiobacteraeota bacterium670Open in IMG/M
3300005568|Ga0066703_10212528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1175Open in IMG/M
3300005575|Ga0066702_10762263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300005576|Ga0066708_10754418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300005598|Ga0066706_11002598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300005616|Ga0068852_102499959Not Available536Open in IMG/M
3300006163|Ga0070715_10263910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium906Open in IMG/M
3300006175|Ga0070712_100125299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1939Open in IMG/M
3300006175|Ga0070712_100753115All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300006175|Ga0070712_101850857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300006577|Ga0074050_11949286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300006581|Ga0074048_12031148All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300006606|Ga0074062_12012869Not Available661Open in IMG/M
3300006638|Ga0075522_10387663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300006791|Ga0066653_10127177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1205Open in IMG/M
3300006800|Ga0066660_11551902Not Available523Open in IMG/M
3300009090|Ga0099827_11324129Not Available627Open in IMG/M
3300009093|Ga0105240_12314754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300009137|Ga0066709_103736888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300009137|Ga0066709_103841129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300009662|Ga0105856_1064813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1033Open in IMG/M
3300010166|Ga0126306_10322654Not Available1194Open in IMG/M
3300010322|Ga0134084_10119512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium859Open in IMG/M
3300010326|Ga0134065_10403567Not Available549Open in IMG/M
3300010379|Ga0136449_103496938All Organisms → cellular organisms → Bacteria → Terrabacteria group598Open in IMG/M
3300010401|Ga0134121_13193033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300010403|Ga0134123_10041376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3421Open in IMG/M
3300010880|Ga0126350_10712557Not Available621Open in IMG/M
3300011119|Ga0105246_10377460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1170Open in IMG/M
3300011997|Ga0120162_1040015All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300012014|Ga0120159_1023796All Organisms → cellular organisms → Bacteria → Terrabacteria group2210Open in IMG/M
3300012209|Ga0137379_10470221Not Available1166Open in IMG/M
3300012211|Ga0137377_11954583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300012285|Ga0137370_10086290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1749Open in IMG/M
3300012350|Ga0137372_10501954All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300012351|Ga0137386_10964184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300012479|Ga0157348_1014517All Organisms → cellular organisms → Bacteria → Terrabacteria group605Open in IMG/M
3300012514|Ga0157330_1002240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1387Open in IMG/M
3300012683|Ga0137398_10157756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1476Open in IMG/M
3300012891|Ga0157305_10165632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300012897|Ga0157285_10078130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria869Open in IMG/M
3300012905|Ga0157296_10014591All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300012915|Ga0157302_10089874Not Available949Open in IMG/M
3300012930|Ga0137407_11260297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300012982|Ga0168317_1124015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300012986|Ga0164304_10159705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1430Open in IMG/M
3300012988|Ga0164306_11858841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300012989|Ga0164305_10225429Not Available1336Open in IMG/M
3300012989|Ga0164305_11219746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria653Open in IMG/M
3300013765|Ga0120172_1092781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium737Open in IMG/M
3300013766|Ga0120181_1060217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium844Open in IMG/M
3300013766|Ga0120181_1117452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300013768|Ga0120155_1044457All Organisms → cellular organisms → Bacteria → Terrabacteria group1345Open in IMG/M
3300013772|Ga0120158_10320275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300014031|Ga0120173_1050976Not Available597Open in IMG/M
3300014058|Ga0120149_1114451Not Available728Open in IMG/M
3300014166|Ga0134079_10099384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1108Open in IMG/M
3300014498|Ga0182019_10313541All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300014501|Ga0182024_12443963Not Available565Open in IMG/M
3300014827|Ga0120171_1038184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1588Open in IMG/M
3300014827|Ga0120171_1060855Not Available1090Open in IMG/M
3300015373|Ga0132257_102577573Not Available661Open in IMG/M
3300016371|Ga0182034_11066445Not Available700Open in IMG/M
3300017947|Ga0187785_10023838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2184Open in IMG/M
3300018027|Ga0184605_10511744Not Available521Open in IMG/M
3300018431|Ga0066655_10189352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1262Open in IMG/M
3300018468|Ga0066662_12523445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium542Open in IMG/M
3300019789|Ga0137408_1080132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1508Open in IMG/M
3300019879|Ga0193723_1163311Not Available586Open in IMG/M
3300021418|Ga0193695_1043186All Organisms → cellular organisms → Bacteria → Terrabacteria group978Open in IMG/M
3300023064|Ga0247801_1078990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300024284|Ga0247671_1033680Not Available784Open in IMG/M
3300025505|Ga0207929_1005200All Organisms → cellular organisms → Bacteria → Terrabacteria group2599Open in IMG/M
3300025916|Ga0207663_10187815Not Available1481Open in IMG/M
3300025935|Ga0207709_10683853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300025944|Ga0207661_10618679All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300026328|Ga0209802_1271598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300026829|Ga0207580_1000038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1528Open in IMG/M
3300027846|Ga0209180_10516118Not Available668Open in IMG/M
3300027907|Ga0207428_10459409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia928Open in IMG/M
3300028793|Ga0307299_10370933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300028819|Ga0307296_10031906All Organisms → cellular organisms → Bacteria2778Open in IMG/M
3300028819|Ga0307296_10804949All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300028824|Ga0307310_10548900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300028828|Ga0307312_10604703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium725Open in IMG/M
3300028828|Ga0307312_10683292All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300028880|Ga0307300_10182489All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300028884|Ga0307308_10018587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3172Open in IMG/M
3300031122|Ga0170822_11322617Not Available952Open in IMG/M
3300031226|Ga0307497_10131940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1015Open in IMG/M
3300031226|Ga0307497_10223203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium828Open in IMG/M
3300031231|Ga0170824_127585974Not Available501Open in IMG/M
3300031544|Ga0318534_10335632Not Available871Open in IMG/M
3300031546|Ga0318538_10638713Not Available577Open in IMG/M
3300031670|Ga0307374_10487167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300031723|Ga0318493_10156950Not Available1181Open in IMG/M
3300031751|Ga0318494_10776063Not Available561Open in IMG/M
3300031793|Ga0318548_10318311Not Available764Open in IMG/M
3300031805|Ga0318497_10404737Not Available763Open in IMG/M
3300032067|Ga0318524_10519355Not Available625Open in IMG/M
3300032089|Ga0318525_10404738Not Available699Open in IMG/M
3300032828|Ga0335080_10756185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1008Open in IMG/M
3300032954|Ga0335083_10006586All Organisms → cellular organisms → Bacteria14457Open in IMG/M
3300033475|Ga0310811_11118769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.19%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost11.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.59%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.12%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.34%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.56%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.56%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.56%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.56%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.56%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.78%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.78%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.78%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.78%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.78%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.78%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.78%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.78%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.78%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908006Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2EnvironmentalOpen in IMG/M
2170459009Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001532Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011997Permafrost microbial communities from Nunavut, Canada - A15_80cm_18MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012479Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.yng.030610EnvironmentalOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012982Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfieldEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014031Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014827Permafrost microbial communities from Nunavut, Canada - A3_80cm_18MEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300025505Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026829Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FWIROz_031080502124908006SoilGEVTLKIASADIGTLEPFHAPPPETKWLPGKAPLSTRMSKWLRGKR
F47_064837202170459009Grass SoilLKIASADIGTLEPFQTPPPETKWLPGKPPLATRMSKWLRGKR
FE1_066337202189573002Grass SoilKIASAEADTLEPFQAPPPETKWLPGKAPGRLSRWMRGGR
AL3A1W_130174013300000886PermafrostIASADIGTLEPFQAPPPETKWLPGKAPLATRMSKWLRGKR*
JGI10216J12902_10516236313300000956SoilIYPGEVTLKIASADIGRLEPFQAPPPETKWLPEKAPLATRMSNWLRGKR*
A20PFW1_100455713300001532PermafrostVGAIYPGEVTLKIASAATGTLEPFQAPPPETTFRPGKAPLATRMSKWLRGK*
A3PFW1_1013314913300001535PermafrostQVGAIHPGEVTLKIASADTGTLEPFQAPPPQTTWLPGKASLTTRMSNWLRGKR*
A10PFW1_1148432813300001538PermafrostGAIYPGEVTLKITSADTAKLEPFQAPPPQTKWLPGKAPLSTRMSTWLRGKR*
Ga0062593_10118330413300004114SoilGEVTLKIASAGIGALEPFQAPPETKWLPGKVPLMTRISNSLRGRR*
Ga0066810_1013511613300005169SoilRYVPGEQVGAIYPGEVTLKIASADIGTLEPFRTPPPETKWLPGKPPLTTRMSNWLRGKR*
Ga0066675_1124397513300005187SoilGEQVGAIYPGEVTLKIASAEIGTLEPFQAPPPETKWLPGKTPIATRMSNWLRGKR*
Ga0070683_10100657433300005329Corn RhizosphereEQVGAIYPGEVTLKISSADIGTLEPFHAPPPETKWLPGKAPLSTRMSKWLRGKR*
Ga0070671_10122013923300005355Switchgrass RhizospherePGEQVGAIYPGEVTLKIASGDAGILEVFHAPPPQTKWLPGKAPLSTRMSKWLRGKR*
Ga0070714_10186142223300005435Agricultural SoilKHILYVPGEQVGMIYPGEVNLKISSADAVKLEPFVAAPAETKWTPGKAPLATRLSNFLRGKR*
Ga0070713_10109714713300005436Corn, Switchgrass And Miscanthus RhizosphereIRYVPGEQVGQIFPGRVTLKIRSSDLRTLEPFRAPPPETRWTAGKAPLSTRVSNWFRGKR
Ga0070707_10027789413300005468Corn, Switchgrass And Miscanthus RhizosphereIYPGEVTLKLASADAGTLEPFRAPPPETTWRPGKEPLATRMSRWLRGDRR*
Ga0070707_10127105423300005468Corn, Switchgrass And Miscanthus RhizosphereGLAVRSEHAGSVLYVPGEVVAAIVPGEVTLKIASAQTETLGPFHEPPREITILPEKAPLAVRISTWFRGKR*
Ga0070707_10186631123300005468Corn, Switchgrass And Miscanthus RhizosphereAIYPGQVTLKIASADIGTLEPFQAPPPETKWLPGKAPLTIRMSNWLRGKR*
Ga0070730_1102858213300005537Surface SoilTLKIASAEADSLEPFQAPPPETKWLPGKAPLAGRLSKWMRGGR*
Ga0070693_10048870623300005547Corn, Switchgrass And Miscanthus RhizosphereIYPGEVTLTIASADIAALEPFRAPPPETTWRPGKAPLTTRMSNWLRGRR*
Ga0066698_1043082733300005558SoilRYVPGEQVAAIYPGEVTLKIPSPDIGTLELFQAPPPETKWLPGKAPLATRISNWLRGKR*
Ga0066700_1073950413300005559SoilYVPGEQVGAIYPSEVTLKIASADTGTLEPFRAPPPETKWLPGKAPLGTRMSNWLRGKR*
Ga0066703_1021252813300005568SoilRVLYVPGEQVGAIYPGEVTLKIAAADAGTLNPFQAPPPETKWAPGKAPLATRMSNWLRGKR*
Ga0066702_1076226323300005575SoilGEVTLKIASADIGTLEPFHAPPPETKWLPGKAPLSTRMLKWLRGKR*
Ga0066708_1075441813300005576SoilGAIYPGEVTLKIAAADAGTLNPFQAPPPETKWAPGKAPLATRMSNWLRGKR*
Ga0066706_1100259833300005598SoilKLSSADTGTLEPFQAPPPETTWRPGKEPLATRMSRWLRGDRR*
Ga0068852_10249995933300005616Corn RhizosphereAVSSGEPSRLLYVPGEQVGAIHPGEVTLKIASAETSTLGEFRPPPPETELRPRRQPLTTRLTNWLRGQR*
Ga0070715_1026391033300006163Corn, Switchgrass And Miscanthus RhizosphereYVPGEQVGAIYPGEVTLKIASADIGTLEPFHAPPPETKWLPGKAPLSTRMSKWLRGKR*
Ga0070712_10012529913300006175Corn, Switchgrass And Miscanthus RhizosphereASADIGTLEPFHAPPPETKWLPGKAPLSTRMSKWLRGKR*
Ga0070712_10075311533300006175Corn, Switchgrass And Miscanthus RhizosphereDVGTLEPFRAPPPETKWVAGKAPLSTRLSNWLRGKR*
Ga0070712_10185085723300006175Corn, Switchgrass And Miscanthus RhizosphereISSADIGTLEPFHAPPPETKWVPGKAPLSTRVSKWLRGKR*
Ga0074050_1194928613300006577SoilVGAIYPGEVTLKIASADIGTLEPFQAPPPETKWLPGKPPLTTRMSNWLRGKR*
Ga0074048_1203114813300006581SoilGLIYSGRVTLKIASAATGALEPFQAPPPETKWLPGKAPGRLSRWMRGGR*
Ga0074062_1201286913300006606SoilVPGEQVGLIYSGRVTLKIASAATGALEPFQAPPPETKWLPGKAPGRLSRWMRGGR*
Ga0075522_1038766313300006638Arctic Peat SoilILYVPGEQVAIIYAGEVNLKISSTDAGKLEPFVAAPPEAKWLPGKQSLSTRSSNLLRRKP
Ga0066653_1012717713300006791SoilTQIRYVPGEQVGAIYPGEVTLKIASAEIGTLEPFQAPPPETKWLPGKTPIATRMSNWLRGKR*
Ga0066660_1155190223300006800SoilAIYPSEVTLKIASADTGTLEPFRAPPPETKWLPGKAPLGTRMSNWLRGKR*
Ga0075421_10250097013300006845Populus RhizosphereQPTQIRYVPGEQVAAIYPGEVTLKIASAGIGALEPFRAPPPETKWLPGKLPLTTRISNWLRGRR*
Ga0099827_1132412923300009090Vadose Zone SoilASADTGTLEPFQAPPPETKWLPGKAPLATRMSKWLRGRR*
Ga0105240_1231475423300009093Corn RhizospherePGEQVAAIYPGEVTLKIASAGIGALEPFQAPPPETKWLPGKVPLTTRMSNWLRGRR*
Ga0066709_10373688813300009137Grasslands SoilRQIRYVPGEQVAAIYPGEVNLKIASADIGTLEPFQAPPPETKWLPGKAPLASRMSNWLRGKR*
Ga0066709_10384112923300009137Grasslands SoilRQIRYVPGEQVAAIYPGEVNLKIASADIGTLEPFQAPPPETKWLPGKAPLASRMSNCLRGRR*
Ga0105856_106481333300009662Permafrost SoilAIYPGEVTLKIASADAGALAPFQAPPPETTWRPGKAPLGARISSWLRGKR*
Ga0126306_1032265423300010166Serpentine SoilAEQLGAIYPGEVTLKIASADTGTLEPFQGPPPETKWLPGKEPLASRMSKWLRGKR*
Ga0134084_1011951233300010322Grasslands SoilIYPGEVTLKIPSADIGTLELFQARPPETKWLPGKAPLATRISNWLRGKR*
Ga0134065_1040356713300010326Grasslands SoilVTLKIPSADIGSLEQFQAPPPETKWLPGKAPLASRISNWLRGKR*
Ga0136449_10349693823300010379Peatlands SoilDLGTLEPFQAPPPETKWTPGKAPISTRLSNWLRGKR*
Ga0134121_1319303323300010401Terrestrial SoilVPGEQVGAIYPGEVTLKISSADIGTLEPFHAPPPETKWLPGKAPLSTRMSKWL
Ga0134123_1004137663300010403Terrestrial SoilIRYVPGEQVGAIFPGEVTLKIASADIGTLEPFHAPPPETKWVPGKAPLSTRVSKWLRGKR
Ga0126350_1071255713300010880Boreal Forest SoilSAEIGKLEPFQTPPPQTTWLPGKAPLTTRMSNWLRGKR*
Ga0105246_1037746013300011119Miscanthus RhizosphereVGAIYPGEVTLTIASADIAALESFRAPPPETTWRPGKAPLTTRMSNWLRGRR*
Ga0120162_104001513300011997PermafrostAIYPGEVNLKIASADTAALEPFHAPPPETKFLPGKAPLTMRISKWLQGKR*
Ga0120159_102379613300012014PermafrostVTLKIASADTGTLEPFQAPPPETKWLPGKAPLATRMSKWLRGKR*
Ga0137379_1047022123300012209Vadose Zone SoilIASADIGTLEPFQAPPPETKWLPGKAPLATRMSTWLRGKR*
Ga0137377_1195458323300012211Vadose Zone SoilDIGTLEPFHAPPPETKWLPGKAPLSTRMSKWLRGKR*
Ga0137370_1008629013300012285Vadose Zone SoilGEQVGPIYPDQVTLKIASAEADTLEPFQAPPPETKWLPGKTPLGSRLSRWMRGGR*
Ga0137372_1050195413300012350Vadose Zone SoilTGTLELFQAPPPETKWLPGKAPLASRMSNWLRGKR*
Ga0137386_1096418423300012351Vadose Zone SoilPGEQVGPIYPGEVTLKIAAADAGTLEPFQAPPPETKWLPGKEPLATRMSRWLRGDRR*
Ga0157348_101451723300012479Unplanted SoilAIYPGEVTLKIASASIGALEPFQAPPPETKWVPGKVPLTTRMSNWLRGRR*
Ga0157330_100224013300012514SoilPGEVTLKIASASIGALEPFQAPPPETKWVPGKVPLTTRMSNWLRGRR*
Ga0137398_1015775633300012683Vadose Zone SoilVPGEQVGPIYPGQVTLKIPSAEADALEPFQAPPPETKWLPGKAPGRLSRWMRGGR*
Ga0157305_1016563213300012891SoilQIRYVPGEQVAAIYPGEVTLKIASAGIGALEPFQAPPPETKWLPGKVPLTTRMSNWLRGRR*
Ga0157285_1007813023300012897SoilYVPGEQVAAIYPGEVTLKIASAGIGALEPFQAPPPETKWLPGKVPLTTRMSNWLRGRR*
Ga0157296_1001459133300012905SoilGEQVAAIYPGEVTLKIASAGIGALEPFQAPPPETKWLPGKVPLTTRMSNWLRGRR*
Ga0157302_1008987423300012915SoilVAAIYPGEVTLKIASASIGALEPFQAPPPETKWVPGKVPLTTRMSNWLRGRR*
Ga0137407_1126029733300012930Vadose Zone SoilGEVTLKIASADTATLEPFQAPPPETTWRPGKEPLATRMSRWLRGDRR*
Ga0153915_1027216913300012931Freshwater WetlandsQPAQLRYVPGEKVGAIYPGEVTLTLASADLDVLEPFQAPPPETTWVPGPAPLATRISNWFRGRR*
Ga0168317_112401513300012982Weathered Mine TailingsYVPGEQVGAIYPGEVTLKIASADTGALEPFHESPPQTTFRPGNPPLATRLSNWLRGRR*
Ga0164304_1015970523300012986SoilGEVTLKIASADIGALEPFQAPPPETKWLPGKVPLTTRMSNWLRGKR*
Ga0164306_1185884113300012988SoilIRYVPGEQVGAIYPGEVSLKIASGDAGTLEPFHAPPPQTKWLPGKAAFSTRMSKWLRGKR
Ga0164305_1022542923300012989SoilEVTLTIASGDAGMLEPFHTPPPQTKWLPGKAPFSTRMSKWLRGKR*
Ga0164305_1121974623300012989SoilGEQVGAIYPGEVTLKIASADIGTLEPFHAPPPETKWLPGKAPLSTRMSKWLRGKR*
Ga0120172_109278123300013765PermafrostIRYVPGEQVGAIHPGEVTLKIASADIGTLEPFQAPPPETTWLPGKTPIATRMSNWLRGKR
Ga0120181_106021713300013766PermafrostPRQIRYVPGEQVGAIHPGEVTLKIASADIGTLEPFQAPPPETTWLPGKTPIATRMSNWLRGKR*
Ga0120181_111745213300013766PermafrostVPGEQVAAIFPGEVTLKIASAETDTLEPFSEPAPQTKILPQKAPLGIRISSWLRGKR*
Ga0120155_104445713300013768PermafrostGAIYPGEVTLKIASADTGTLEPFQAPPPETKWLPGKPPLATRMSKWLRGKR*
Ga0120158_1032027513300013772PermafrostADAGKLEPFEAPPPETKWVPGKEPLAARMSKWLRGGR*
Ga0120173_105097623300014031PermafrostGEVTLKIASAATGTLEPFQAPPPETTFRPGKAPLATRMSKWLRGK*
Ga0120149_111445113300014058PermafrostEKVGQIFPGQVTLKMGSSDLGTLEPFQAPPPETKWAPGKAPISTRLSNWLRGKR*
Ga0134079_1009938433300014166Grasslands SoilQVAAIYPGEVTLKIPSADIGTLEPFQAPPPETKWLPGKAPSRISNWLRGKR*
Ga0182019_1031354133300014498FenVAGEQVGAIYPGEVTLKISTAEAGTLPPFQAPPTETTWRPGKEPFMTRVGNLFRGKR*
Ga0182024_1244396313300014501PermafrostIASADTLGFEPFHPPPPETTWRPGKAPLSRRMSNWMRGRR*
Ga0120171_103818413300014827PermafrostGEVNLKIASADTAALEPFHAPPPETKFLPGKAPLTMRISKWLQGKR*
Ga0120171_106085513300014827PermafrostVGAIHPGEVTLKIASADTGTLEPFQAPPPQTTWLPGKAPLTTRMSNWLRGKR*
Ga0132257_10257757313300015373Arabidopsis RhizosphereIFVGRVTLKTGSRHLGALEPYQAPPPETKWTAGKAPLSTRLSNWLHGKR*
Ga0182034_1106644523300016371SoilEAGSQTRYVASEQVGQIFSGRVMLTIGSSDVSALGLFQAPPPETKWTPGKAPLSTRLSNWFRGKH
Ga0187785_1002383813300017947Tropical PeatlandPGEQVDAIYPGEVTLKIAFAEAGTLQPFQAPPPETTWRPGKAPLTKRLSNWLRGGR
Ga0184605_1051174423300018027Groundwater SedimentLYVPGEQVGAIHPGEVTLKIAAVDAGTLKPFQAPPPETKWTPGKAPLARRMSNWLRGKP
Ga0066655_1018935213300018431Grasslands SoilLVSGERVAAIYPGEVNLKIPSADIGSLELFRAPPPETKRLPVKAPLATRISTWLRGKR
Ga0066662_1252344523300018468Grasslands SoilRYVPGEQVGAIYPGEVTLKIASADTGLLEPFQAPPPETKWLPGKAPLATRMSK
Ga0137408_108013223300019789Vadose Zone SoilTQIRYVPGEQVGAIYPGEVTLKIASADIGTLEPFHAPPPETKWLPGKAPLSTRMSKWLRGKR
Ga0193723_116331123300019879SoilPGEVNLKIASAEAAALEPFTAAPPETKWLPGKAPLSTRLSNWLRGKR
Ga0193695_104318613300021418SoilIASADIGALEPFHAPPPETKWLPGKAPLSTRMSKWLRGKR
Ga0247801_107899013300023064SoilTQIRYVPGEQVAAIYPGEVTLKIASAGIGALEPFQAPPPETKWLPGKVPLTTRMSNWLRGRR
Ga0247671_103368013300024284SoilQPTRIRYVPGEQVGAIYPGQVTLKIASADIGALEPFRAPPPETTWRPGKAPLTTRMSNWLRGRR
Ga0207929_100520053300025505Arctic Peat SoilLMIASADTAKLEPFQASPPETKWLPGKAPLATRVSNWLQRKR
Ga0207663_1018781553300025916Corn, Switchgrass And Miscanthus RhizosphereIYPGEVTLKIASADIGTLVPFHAPPPETKWLPGKAPLSTRMSKWLRGKR
Ga0207709_1068385333300025935Miscanthus RhizosphereQVGLIYPGEVTLKIAFTDVGALEPFRAPPPETKWLPGKAPLATRFSNWLRGKR
Ga0207661_1061867913300025944Corn RhizosphereAVSSGESSRLLYVPGEQVGAIHPGEVTLKIASAETSTLGEFRPPPPETELRPRRQPLTTRLTNWLRGQR
Ga0209802_127159813300026328SoilYVPGEQVAAIFPGEVTLKIASAETDTLEPFSEPAPQTKILPQKAPLGLRISSWLRGKR
Ga0207580_100003813300026829SoilQIRYVPGEQVAAIYPGEVTLKIASAGIGALEPFQAPPPETKWLPGKVPLTTRMSNWLRGR
Ga0209180_1051611823300027846Vadose Zone SoilSAHVRYVPGEQVGAIYPGEVTLKIASAEADTLAPFSEPAPQTMILPQKAPLGLRISSWLRGKR
Ga0207428_1045940913300027907Populus RhizosphereGEQVAAIYPGEVTLKIASAGIGALEPFRAPPPETKWLPGKLPLTTRISNWLRGRR
Ga0307299_1037093313300028793SoilVRYVPGEQVAAIFPGEVTLKIASAETDTLEPFSEPAPQTKILPQKAPLGIRISSWLRRKR
Ga0307296_1003190653300028819SoilIYPGEVTLKIAFTDVGALEPFRAPPPETKWLPGKAPLATRISNWLRGKR
Ga0307296_1080494913300028819SoilYPGEVTLKIAFPDVGALQPFQAPPPETTWRPGKAPLTTRISNWLRGKR
Ga0307310_1054890013300028824SoilGLAVKSKQSAHVRYVPGEQVAAIFPGEVTLKIASAETDTLEPFSEPAPQTKILPQKAPLGIRISSWLRRKR
Ga0307312_1060470313300028828SoilHVRYVPGEQVAAIFPGEVTLKIASAETDTLEPFSEPAPQTKILPQKAPLGIRISSWLRGK
Ga0307312_1068329233300028828SoilGEVNLKIASEEAAALEPFTAAPPETKWLPGKAPLSTRLSNWLRGKR
Ga0307300_1018248923300028880SoilIRYVPGEQVGAIYPGEVTLKIESAGKGTLEPFQEPPPETKWVPGKAPLATRISNWLRGKR
Ga0307308_1001858713300028884SoilQVGAIYPGEVTLKIASTDIGTLETFHAPPPQTKWVPGKAPLSTRMSKWLRGKR
Ga0170822_1132261723300031122Forest SoilIYPGKVTLKFASTEADALEPYQAPPPETKWLPGKPPGRFSRWIRGGR
Ga0307497_1013194023300031226SoilYPGQVTLKIASAEADALEPFQAPPPETKWLPGKPPGRLSRWMRGGR
Ga0307497_1022320313300031226SoilVGQIFPGQVTLKIGSADVGALEPFQAPPPETKWVAGKAPLSTRLSNWLRGKR
Ga0170824_12758597413300031231Forest SoilPGRVTLKIASAEADALEPFQVPPPETKWLPGKPPGRLSRWMRGGR
Ga0302324_10173737523300031236PalsaQPAQIRYLPGEQVGAIYPGEVRLKIASADAANLELFRTPPPQTTWLPGKAPLTTRISSWLRGKR
Ga0318534_1033563213300031544SoilFDGLAVEAGSQTRYVASEQVGQIFSGRVMLTIGSSDVSALGLFQAPPPETKWTPGKAPLSTRLSNWFRGKH
Ga0318538_1063871323300031546SoilFSGRVMLTIGSSDVSALGLFQAPPPETKWTPGKAPLSTRLSNWFRGKH
Ga0307374_1048716713300031670SoilKISSADTGTLEPFQAPPPETAWRPGKPPLATRMSSWLRGRR
Ga0318493_1015695023300031723SoilTRYVASEQVGQIFSGRVMLTIGSSDVSALGLFQAPPPETKWTPGKAPLSTRLSNWFRGKH
Ga0318494_1077606323300031751SoilVSALGLFQAPPPETKWTPGKAPLSTRLSNWFRGKH
Ga0318548_1031831113300031793SoilEQVGQIFSGRVMLTIGSSDVSALGLFQAPPPETKWTPGKAPLSTRLSNWFRGKH
Ga0318497_1040473723300031805SoilGRVMLTIGSSDVSALGLFQAPPPETKWTPGKAPLSTRLSNWFRGKH
Ga0318524_1051935513300032067SoilSEQVGQIFSGRVMLTIGSSDVSALGLFQAPPPETKWTPGKAPLSTRLSNWFRGKH
Ga0318525_1040473813300032089SoilSSDVSALGLFQAPPPETKWTPGKAPLSTRLSNWFRGKH
Ga0335080_1075618543300032828SoilAIYPGEVTLKIASKDIGALEPFEAPPPETKWLPGKPPFSTRVSNWLRGKR
Ga0335083_10006586223300032954SoilSETRYVPGEQVGQIFAGRVILRIASNDAGALEPFRAPPPETKWTPGKAPLSTRLSNWFRGKH
Ga0310811_1111876913300033475SoilYPGEVTLKIASADIGTLEPFHAPPPETKWRPGKAPLSTRMSKWLRGKR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.