| Basic Information | |
|---|---|
| Family ID | F065060 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDA |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 97.66 % |
| % of genes near scaffold ends (potentially truncated) | 98.44 % |
| % of genes from short scaffolds (< 2000 bps) | 89.84 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.281 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.625 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.062 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.03% β-sheet: 0.00% Coil/Unstructured: 57.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00551 | Formyl_trans_N | 67.19 |
| PF01593 | Amino_oxidase | 5.47 |
| PF08818 | DUF1801 | 3.12 |
| PF13231 | PMT_2 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 3.12 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 3.12 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 3.12 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.28 % |
| All Organisms | root | All Organisms | 36.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001144|JGI12645J13327_100312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300001170|JGI12704J13340_1014196 | Not Available | 633 | Open in IMG/M |
| 3300005439|Ga0070711_101984310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300005468|Ga0070707_101075556 | Not Available | 770 | Open in IMG/M |
| 3300005541|Ga0070733_10447807 | Not Available | 862 | Open in IMG/M |
| 3300005542|Ga0070732_10295716 | Not Available | 972 | Open in IMG/M |
| 3300005554|Ga0066661_10568968 | Not Available | 676 | Open in IMG/M |
| 3300005591|Ga0070761_10351979 | Not Available | 893 | Open in IMG/M |
| 3300005598|Ga0066706_10141836 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300005712|Ga0070764_10331152 | Not Available | 886 | Open in IMG/M |
| 3300005921|Ga0070766_10054707 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
| 3300005921|Ga0070766_10433070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300006173|Ga0070716_100058894 | All Organisms → cellular organisms → Bacteria | 2212 | Open in IMG/M |
| 3300006173|Ga0070716_101720639 | Not Available | 518 | Open in IMG/M |
| 3300006174|Ga0075014_100298637 | Not Available | 848 | Open in IMG/M |
| 3300006176|Ga0070765_100069753 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
| 3300006797|Ga0066659_11242401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300006800|Ga0066660_11704323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300006804|Ga0079221_11317616 | Not Available | 569 | Open in IMG/M |
| 3300007788|Ga0099795_10302498 | Not Available | 704 | Open in IMG/M |
| 3300009524|Ga0116225_1071004 | Not Available | 1641 | Open in IMG/M |
| 3300009524|Ga0116225_1272550 | Not Available | 757 | Open in IMG/M |
| 3300009698|Ga0116216_10099343 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300009792|Ga0126374_10959717 | Not Available | 667 | Open in IMG/M |
| 3300010043|Ga0126380_10453571 | Not Available | 970 | Open in IMG/M |
| 3300010343|Ga0074044_10682639 | Not Available | 670 | Open in IMG/M |
| 3300010360|Ga0126372_11994233 | Not Available | 627 | Open in IMG/M |
| 3300010360|Ga0126372_12279577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300010371|Ga0134125_12976343 | Not Available | 514 | Open in IMG/M |
| 3300011271|Ga0137393_10444203 | Not Available | 1112 | Open in IMG/M |
| 3300012189|Ga0137388_10030050 | All Organisms → cellular organisms → Bacteria | 4220 | Open in IMG/M |
| 3300014489|Ga0182018_10066493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2164 | Open in IMG/M |
| 3300014654|Ga0181525_10730821 | Not Available | 556 | Open in IMG/M |
| 3300015245|Ga0137409_10264358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1523 | Open in IMG/M |
| 3300016294|Ga0182041_10836885 | Not Available | 824 | Open in IMG/M |
| 3300016404|Ga0182037_10538261 | Not Available | 984 | Open in IMG/M |
| 3300017938|Ga0187854_10329775 | Not Available | 648 | Open in IMG/M |
| 3300017955|Ga0187817_10280244 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300017994|Ga0187822_10403645 | Not Available | 504 | Open in IMG/M |
| 3300017995|Ga0187816_10381049 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300017999|Ga0187767_10177170 | Not Available | 658 | Open in IMG/M |
| 3300018026|Ga0187857_10250742 | Not Available | 815 | Open in IMG/M |
| 3300018062|Ga0187784_11410323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300018086|Ga0187769_11031629 | Not Available | 622 | Open in IMG/M |
| 3300018090|Ga0187770_11431027 | Not Available | 562 | Open in IMG/M |
| 3300020582|Ga0210395_10951357 | Not Available | 637 | Open in IMG/M |
| 3300020582|Ga0210395_11325082 | Not Available | 526 | Open in IMG/M |
| 3300021170|Ga0210400_11611550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300021401|Ga0210393_11346371 | Not Available | 571 | Open in IMG/M |
| 3300021402|Ga0210385_11079827 | Not Available | 616 | Open in IMG/M |
| 3300021404|Ga0210389_10245930 | Not Available | 1399 | Open in IMG/M |
| 3300021404|Ga0210389_11536585 | Not Available | 505 | Open in IMG/M |
| 3300021406|Ga0210386_11619749 | Not Available | 537 | Open in IMG/M |
| 3300021407|Ga0210383_10124457 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
| 3300021407|Ga0210383_11029158 | Not Available | 697 | Open in IMG/M |
| 3300021420|Ga0210394_11218173 | Not Available | 646 | Open in IMG/M |
| 3300021432|Ga0210384_10164124 | Not Available | 1995 | Open in IMG/M |
| 3300021432|Ga0210384_10591786 | Not Available | 997 | Open in IMG/M |
| 3300021433|Ga0210391_10242803 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300021474|Ga0210390_10086065 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
| 3300021475|Ga0210392_10941392 | Not Available | 646 | Open in IMG/M |
| 3300021476|Ga0187846_10014150 | All Organisms → cellular organisms → Bacteria | 3784 | Open in IMG/M |
| 3300021477|Ga0210398_11410222 | Not Available | 544 | Open in IMG/M |
| 3300021560|Ga0126371_11144129 | Not Available | 916 | Open in IMG/M |
| 3300022557|Ga0212123_10732978 | Not Available | 604 | Open in IMG/M |
| 3300025414|Ga0208935_1047573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300025432|Ga0208821_1013479 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
| 3300025612|Ga0208691_1018574 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300025915|Ga0207693_10505438 | Not Available | 943 | Open in IMG/M |
| 3300025928|Ga0207700_10404372 | Not Available | 1197 | Open in IMG/M |
| 3300026551|Ga0209648_10598307 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300026839|Ga0207764_114328 | Not Available | 730 | Open in IMG/M |
| 3300026869|Ga0207821_1017913 | Not Available | 709 | Open in IMG/M |
| 3300026928|Ga0207779_1036315 | Not Available | 573 | Open in IMG/M |
| 3300027000|Ga0207803_1030749 | Not Available | 643 | Open in IMG/M |
| 3300027117|Ga0209732_1009352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1633 | Open in IMG/M |
| 3300027297|Ga0208241_1042460 | Not Available | 714 | Open in IMG/M |
| 3300027545|Ga0209008_1040129 | Not Available | 1076 | Open in IMG/M |
| 3300027562|Ga0209735_1064309 | Not Available | 791 | Open in IMG/M |
| 3300027568|Ga0208042_1191056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300027609|Ga0209221_1076346 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300027625|Ga0208044_1066777 | Not Available | 1105 | Open in IMG/M |
| 3300027667|Ga0209009_1035747 | Not Available | 1231 | Open in IMG/M |
| 3300027667|Ga0209009_1135479 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300027783|Ga0209448_10027537 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
| 3300027842|Ga0209580_10085973 | Not Available | 1509 | Open in IMG/M |
| 3300027854|Ga0209517_10014578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8022 | Open in IMG/M |
| 3300027854|Ga0209517_10529368 | Not Available | 637 | Open in IMG/M |
| 3300027854|Ga0209517_10569351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300027855|Ga0209693_10317327 | Not Available | 759 | Open in IMG/M |
| 3300027862|Ga0209701_10514597 | Not Available | 648 | Open in IMG/M |
| 3300027867|Ga0209167_10473312 | Not Available | 685 | Open in IMG/M |
| 3300027879|Ga0209169_10228908 | Not Available | 973 | Open in IMG/M |
| 3300028017|Ga0265356_1005595 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300028037|Ga0265349_1030130 | Not Available | 508 | Open in IMG/M |
| 3300028047|Ga0209526_10140347 | Not Available | 1694 | Open in IMG/M |
| 3300028047|Ga0209526_10565049 | Not Available | 733 | Open in IMG/M |
| 3300028759|Ga0302224_10203352 | Not Available | 785 | Open in IMG/M |
| 3300028792|Ga0307504_10251018 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300028800|Ga0265338_10220792 | Not Available | 1416 | Open in IMG/M |
| 3300028906|Ga0308309_10103435 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
| 3300028906|Ga0308309_11013546 | Not Available | 719 | Open in IMG/M |
| 3300030020|Ga0311344_11269892 | Not Available | 550 | Open in IMG/M |
| 3300030646|Ga0302316_10344561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300030687|Ga0302309_10196292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300030847|Ga0075405_12129848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300030940|Ga0265740_1041879 | Not Available | 542 | Open in IMG/M |
| 3300031231|Ga0170824_101023463 | Not Available | 560 | Open in IMG/M |
| 3300031249|Ga0265339_10362776 | Not Available | 681 | Open in IMG/M |
| 3300031525|Ga0302326_10477783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1898 | Open in IMG/M |
| 3300031573|Ga0310915_11012537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300031708|Ga0310686_105524800 | Not Available | 601 | Open in IMG/M |
| 3300031708|Ga0310686_105938863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1435 | Open in IMG/M |
| 3300031718|Ga0307474_11629449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300031753|Ga0307477_10142659 | Not Available | 1671 | Open in IMG/M |
| 3300031753|Ga0307477_10157915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1581 | Open in IMG/M |
| 3300031754|Ga0307475_11525705 | Not Available | 512 | Open in IMG/M |
| 3300031912|Ga0306921_11479869 | Not Available | 743 | Open in IMG/M |
| 3300031939|Ga0308174_10704613 | Not Available | 843 | Open in IMG/M |
| 3300031947|Ga0310909_11238828 | Not Available | 602 | Open in IMG/M |
| 3300031962|Ga0307479_10166189 | All Organisms → cellular organisms → Bacteria | 2167 | Open in IMG/M |
| 3300032160|Ga0311301_10084803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6433 | Open in IMG/M |
| 3300032180|Ga0307471_101346645 | Not Available | 875 | Open in IMG/M |
| 3300032892|Ga0335081_10487460 | Not Available | 1555 | Open in IMG/M |
| 3300032892|Ga0335081_11952819 | Not Available | 628 | Open in IMG/M |
| 3300032893|Ga0335069_10005595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 18435 | Open in IMG/M |
| 3300033004|Ga0335084_10820590 | Not Available | 944 | Open in IMG/M |
| 3300034199|Ga0370514_200173 | Not Available | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.12% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.12% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.34% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.34% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.78% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.78% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.78% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.78% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.78% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001144 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 | Environmental | Open in IMG/M |
| 3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12645J13327_1003122 | 3300001144 | Forest Soil | LAEDLKFELAILATVQGFYQKLLRDLLGGEIPLPGG |
| JGI12704J13340_10141962 | 3300001170 | Forest Soil | VEDLKFELAILATVHGFYQKLLRDLLGGEIPLPAGLDDASLRHTEDDLPE |
| Ga0070711_1019843101 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEDLRFELAILATVQGFYQKLLRDTLGGDVPIPSGLDED |
| Ga0070707_1010755561 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LLSGACLAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGL |
| Ga0070733_104478071 | 3300005541 | Surface Soil | LAEDLRFELAILATVQGLYQKLLKDTLGGEVPIPHGLDEDALRHSDRELP |
| Ga0070732_102957161 | 3300005542 | Surface Soil | LAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDALRHSEREL |
| Ga0066661_105689681 | 3300005554 | Soil | LAEDLKFDLAILATVQGFYQKLMAETLGGDVPVPSGLDADALRHSE |
| Ga0070761_103519792 | 3300005591 | Soil | VEDLKFELAILATVHGFYQKLLRDLLGGEIPLPAGLD |
| Ga0066706_101418363 | 3300005598 | Soil | LAEDLKFELAILATVQGFYQKLMRDCLGGDVPVPKGLDEDALRHSE |
| Ga0070764_103311521 | 3300005712 | Soil | LLSGARLAEDLRFELAILATVQGFYQKLMRDALGGDV |
| Ga0070766_100547074 | 3300005921 | Soil | LLSGARLAEDLRFELSILATVQGFYQKLMRDALGGDVPIPSGLDEDA |
| Ga0070766_104330702 | 3300005921 | Soil | LAEDLKFELSILATVQGFYQTLLQDSLGGDVPIPSGLDEVSL |
| Ga0070716_1000588943 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LYSGAGLAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDALRHSE |
| Ga0070716_1017206391 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEDLGFELAILATVQGFYQKLMVEPLGGEVPVPSGLDED |
| Ga0075014_1002986371 | 3300006174 | Watersheds | LAEDLRFELAILATVQGFYQKLMVDALGGEVPVPRGLDEDALRH |
| Ga0070765_1000697534 | 3300006176 | Soil | LAEDLKFELAILATVQGFYQKLLRDSLGGDVPIPSG |
| Ga0066659_112424011 | 3300006797 | Soil | LAEDLRFELAILATVQGFYQKLLRDTLGGDVPIPSGLDEDALRH |
| Ga0066660_117043232 | 3300006800 | Soil | LAEDLRFELAILATVQGFYQKLMLDSLGGEVPVPSGLDEVSLRHSDEGLP* |
| Ga0079221_113176162 | 3300006804 | Agricultural Soil | LAEDLRFELAILATVQGFYQKLMVRSLGGEVPVPSGLDEDALRHSER |
| Ga0099795_103024982 | 3300007788 | Vadose Zone Soil | LSEDLKFELSILATVQGFYQKLMWASLGGDVPIPAGLD |
| Ga0116225_10710043 | 3300009524 | Peatlands Soil | LAEDLRFELSILATVQGFYQKLMRDALGGDVPIPSGLDED |
| Ga0116225_12725503 | 3300009524 | Peatlands Soil | LAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDALRHSERELPTKL |
| Ga0116216_100993431 | 3300009698 | Peatlands Soil | LAEDLKFELAILATVQGFYQKLLRDSLGGDVPIPSGLDEVSL |
| Ga0126374_109597171 | 3300009792 | Tropical Forest Soil | LAEDLRFELAILATVQGFYQKLMRDSLGGDVPIPSGLDEDALRHTERELPN |
| Ga0126380_104535712 | 3300010043 | Tropical Forest Soil | LAEDLRFELAILATVQGFYQRLLKDTLGGEVPIPKGLDEDALRH |
| Ga0074044_106826392 | 3300010343 | Bog Forest Soil | LADDLRFELAILATVQGFYQKLMRDTLGGDVPIPSGLD |
| Ga0126372_119942331 | 3300010360 | Tropical Forest Soil | LAEDLRFELAILATVQGFYQKLLRDTLGGDVPIPSGLDEDALRHTE |
| Ga0126372_122795771 | 3300010360 | Tropical Forest Soil | LAEDLRFELAILATVQGFYQKLLHDTLGGEVPIPDGLDEDALRHSERE |
| Ga0134125_129763431 | 3300010371 | Terrestrial Soil | LLGGQDLAEDLRFELAILATVQGFYQKLLRNTLGGEVPIP |
| Ga0137393_104442032 | 3300011271 | Vadose Zone Soil | LAEDLRFELAILATVQGFYQKLMQDSLGGEVPIPSGLD |
| Ga0137388_100300501 | 3300012189 | Vadose Zone Soil | LAEDLKFELSILATVQGFYQKLMWAGLGGDVPIPAGLDEDSLR |
| Ga0182018_100664931 | 3300014489 | Palsa | LAEDLKFELAILATVQGFYQKLMRDSLGGDVPIPSGLDE |
| Ga0181525_107308211 | 3300014654 | Bog | LAEDLRFELAILATVQGFYQKLMRDSLGGDVPIPSG |
| Ga0137409_102643581 | 3300015245 | Vadose Zone Soil | LAEDLRFELAILATVQGFYQKLMRDSLGGDVPIPSGLDEVSL |
| Ga0182041_108368851 | 3300016294 | Soil | LAEDLRFELAILATVQGFYQKLLKDALGGEVPIPNGLD |
| Ga0182037_105382612 | 3300016404 | Soil | LAEDLRFELAILATVQGFYQKLLKDALGGEVPIPNG |
| Ga0187854_103297752 | 3300017938 | Peatland | LAEDLKFELAILATVQGFYQKLLKDLLGAEIPVPSGLDEL |
| Ga0187817_102802442 | 3300017955 | Freshwater Sediment | LAEDLRFELAILATVQGFYQKLMSDTLGGELPVPRGLDEDALRHSERELPN |
| Ga0187822_104036452 | 3300017994 | Freshwater Sediment | LAEDLRFELAILATVQGFYQKLLRDTLGGEVPIPSGLD |
| Ga0187816_103810491 | 3300017995 | Freshwater Sediment | LAEDLRFELAILATVQGFYQKLMSDTLGGELPVPRGLDEDALRH |
| Ga0187767_101771702 | 3300017999 | Tropical Peatland | LAEDLRFELAILATVQGFYQKLLVDTLGGEVPIPSGLDEDT |
| Ga0187857_102507422 | 3300018026 | Peatland | LAEDLKFELAILATVQGFYQKLLKDLLGAEIPVPSGLDELALRHTDRDLP |
| Ga0187784_114103231 | 3300018062 | Tropical Peatland | LAEDLRFELAILATVQGFYQKLLGDVLGGELPVPKGLEEEALRYS |
| Ga0187769_110316292 | 3300018086 | Tropical Peatland | MSSGERLADDLRFELAILATVQGFYQKLMGEALGG |
| Ga0187770_114310271 | 3300018090 | Tropical Peatland | LRERFLAEDLRFELAILATVQGFYQKLLRDSLGGDIPIPGGLDEESLRHSEDL |
| Ga0210395_109513572 | 3300020582 | Soil | LAEDLKFELAILATVQGFYQKLLRDSLGGDVPIPSGLDEVSLRHSEGDLP |
| Ga0210395_113250822 | 3300020582 | Soil | LCSGACLAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDALR |
| Ga0210400_116115501 | 3300021170 | Soil | LAEDLRFELAILATVQGFYQRLLRDTLGGDVPIPSGLDEDALRHSEREL |
| Ga0210393_113463712 | 3300021401 | Soil | LAEDLKFELAILATVQGFYQKLLEDLLGSEVPIPSGLDEAA |
| Ga0210385_110798271 | 3300021402 | Soil | LGEDLRFELAILATVQGLYQKLLKDTLGGDVPIPSGLDEDA |
| Ga0210389_102459303 | 3300021404 | Soil | LLSGARLAEDLRFELAILATVQGFYQRLMRDALGGDVPIPSGLD |
| Ga0210389_115365851 | 3300021404 | Soil | LAEDLKFELAILATVQGFYQKLLQDSLGGEVPVPRGLDEVSLRQSENL |
| Ga0210386_116197491 | 3300021406 | Soil | LAEDLKFELAILATVQGFYQKLLRDQLGGDVPIPSGL |
| Ga0210383_101244574 | 3300021407 | Soil | LAEDLKFELAILATVQGFYQKLLRDSLGGDVPIPSGLDEVSLRHS |
| Ga0210383_110291582 | 3300021407 | Soil | LAEDIRFELAILATVQGFYQKLMRESLGGDVPIPSGLDEEALRAGR |
| Ga0210394_112181732 | 3300021420 | Soil | LAEDLKFELAILATVQGFYQKLLRDSLGGDVPIPSGLDEV |
| Ga0210384_101641241 | 3300021432 | Soil | LAEDLRFELAILATVQGFYQKLMVESLGGEVPVPSGLDEDA |
| Ga0210384_105917861 | 3300021432 | Soil | LAEDLRFELAILATVQGFYQKLMRDSLGGDVPIPSGLDEVS |
| Ga0210391_102428031 | 3300021433 | Soil | LAEDIRFELAILATVQGFYQKLMRESLGGDVPIPSGLDEEALRAGRELTTTL |
| Ga0210390_100860651 | 3300021474 | Soil | LAEDLKFELAILATVQGFYQKLLRDSLGGDVPIPSGLDEVSLRHSEGDLPE |
| Ga0210392_109413922 | 3300021475 | Soil | LCSGACLAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDA |
| Ga0187846_100141501 | 3300021476 | Biofilm | LAEDLRFELAILATVQGFYQKLMRDALGGEVPIPSG |
| Ga0210398_114102222 | 3300021477 | Soil | LLSGARLAEDLRFELSILATVQGFYQKLMRDALGGDVPIPSGL |
| Ga0126371_111441291 | 3300021560 | Tropical Forest Soil | LAEDLRFELAILATVQGFYQKLLKDTLGGDVPIPKGLDED |
| Ga0212123_107329782 | 3300022557 | Iron-Sulfur Acid Spring | LAEDLKFELAILATVQGFYQKLLEDLLGSEVPIPSGLDEAALRH |
| Ga0208935_10475732 | 3300025414 | Peatland | LAEDIRFELAILATVQGFYQKLMRESLGGDVPIPSGLDEEALRAGRE |
| Ga0208821_10134791 | 3300025432 | Peatland | MGRISLAERFLAEDLKFELAILATVQGFYQKLLRDLLGGEIPVPSGLDELA |
| Ga0208691_10185743 | 3300025612 | Peatland | MGRISLAERFLAEDLKFELAILATVQGFYQKLLRDLLGGEIPVPSGLDELAL |
| Ga0207693_105054381 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEDLRFELAILATVQGFYQKLMKDALGGDVPIPRGLDEDALRHS |
| Ga0207700_104043721 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEDLRFELAILATVQGFYQKLLRDTLGGDVPIPSGLDEDALR |
| Ga0209648_105983071 | 3300026551 | Grasslands Soil | LSEDLKFELSILATVQGFYQKLMRDFLGGNVPVPSGLDEDSLRHTEGDLP |
| Ga0207764_1143281 | 3300026839 | Tropical Forest Soil | LAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDALRHSE |
| Ga0207821_10179131 | 3300026869 | Tropical Forest Soil | LAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDALRHSERELP |
| Ga0207779_10363152 | 3300026928 | Tropical Forest Soil | LAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDA |
| Ga0207803_10307491 | 3300027000 | Tropical Forest Soil | LAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDALRHSER |
| Ga0209732_10093521 | 3300027117 | Forest Soil | LAEDLKFELAILATVQGFYQKLLRDLLGGELPLPGGLDELALR |
| Ga0208241_10424602 | 3300027297 | Forest Soil | VEDLKFELAILATVHGFYQKLLRDLLGGEIPLPAGLDDASLRHTED |
| Ga0209008_10401291 | 3300027545 | Forest Soil | LAEDLKFELSILATVQGFYQKLLRDSLGGDVPIPSGLDEVSLRHSED |
| Ga0209735_10643091 | 3300027562 | Forest Soil | LAEDLRFELAILATVQGFYQKLMRDALGGEVPIPS |
| Ga0208042_11910561 | 3300027568 | Peatlands Soil | LAEDLRFELSILATVQGFYQKLMREALGGDVPIPSGLDEDALRTGRELPTTL |
| Ga0209221_10763462 | 3300027609 | Forest Soil | LAEDLKFELAILATVQGFYQKLLRDQLGGDVPVPSGLD |
| Ga0208044_10667771 | 3300027625 | Peatlands Soil | LLSGARLAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLD |
| Ga0209009_10357471 | 3300027667 | Forest Soil | LAEDLRFELAILATVQGFYQKLMRDALGGEVPIPSGLDEDALRHSERELPT |
| Ga0209009_11354792 | 3300027667 | Forest Soil | LAEDLRFELAILATVQGFYQKLMRDSLGGDVPIPSGLDEVSLRHHDEDL |
| Ga0209448_100275371 | 3300027783 | Bog Forest Soil | LLSGACLAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDED |
| Ga0209580_100859731 | 3300027842 | Surface Soil | LAEDLRFELAILATVQGFYQKLLRDTLGGDVPIPSGL |
| Ga0209517_100145787 | 3300027854 | Peatlands Soil | LLSGARLAEDLRFELAILATVQGFYQKLMRDALGGDVPIP |
| Ga0209517_105293681 | 3300027854 | Peatlands Soil | LAEDLKFELAILATVQGFYQKLLRDLLGGEVPVPSGL |
| Ga0209517_105693512 | 3300027854 | Peatlands Soil | LAEDLRFELAILATVQGFYQKLMTGTLGGEVPVPSGLDEDALRCSAR |
| Ga0209693_103173271 | 3300027855 | Soil | LLSGARLAEDLRFELSILATVQGFYQKLMRDALGGDVPIPS |
| Ga0209701_105145971 | 3300027862 | Vadose Zone Soil | LAEDLKFELAILATVQGFYQKLMRDCLGGDVPVPKGLDE |
| Ga0209167_104733121 | 3300027867 | Surface Soil | LAEDLRFELAILATVQGFYQKLLRDTLGGDVPIPSGLDE |
| Ga0209169_102289082 | 3300027879 | Soil | LLSGARLAEDLRFELSILATVQGFYQKLMRDALGGDVPIPSG |
| Ga0265356_10055953 | 3300028017 | Rhizosphere | LAEDLKFELAILATVQGFYQKLLEDLLGSEVPIPSGLDEA |
| Ga0265349_10301302 | 3300028037 | Soil | LAEDLKFELSILATVQGFYQKLMRDSLGGNVPVPS |
| Ga0209526_101403473 | 3300028047 | Forest Soil | LAEDLRFELAILATVQGFYQKLMRDSLGGDVPIPSGLDEVSLR |
| Ga0209526_105650492 | 3300028047 | Forest Soil | LAEDLRFELAILATVQGFYQKLMRDALGGEVPIPSGLDEDALRHSEREL |
| Ga0302224_102033522 | 3300028759 | Palsa | LLSGARLAEDLRFELAILATVQGFYQKLMRDALAGDVPIPSGLDEDA |
| Ga0307504_102510181 | 3300028792 | Soil | LAEDLRFELAILATVQGFYQKLLRDTLGGNVPIPSGLDED |
| Ga0265338_102207921 | 3300028800 | Rhizosphere | LAEDLRFELAILATVQGFYQKLLRDTLGGDVPIPRDLDEDALR |
| Ga0308309_101034354 | 3300028906 | Soil | LAEDLKFELAILATVQGFYQKLLRDSLGGDVPIPSGLDEVSLRHSEG |
| Ga0308309_110135462 | 3300028906 | Soil | LAEDIRFELAILATVQGFYQKLMRESLGGDVPIPSGLDEEALRAGRELTTTLT |
| Ga0311344_112698921 | 3300030020 | Bog | LAEDLKFELAILATVQGFYQKLLRDLLGGDVPLPSG |
| Ga0302316_103445611 | 3300030646 | Palsa | VGAFLSEDLKFELSILATVQGLYQKLLRDSLGGDVPIPSGL |
| Ga0302309_101962922 | 3300030687 | Palsa | LSEDLKFELSILATVQGLYQKLLRDSLGGDVPIPSGLDE |
| Ga0075405_121298482 | 3300030847 | Soil | LAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDALRHSERELPTTL |
| Ga0265740_10418792 | 3300030940 | Soil | LAEDIRFELAILATVQGFYQKLMRESLGGDVPIPSGLDEEALRAGREL |
| Ga0170824_1010234631 | 3300031231 | Forest Soil | LAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDALRHSERELPTT |
| Ga0265339_103627761 | 3300031249 | Rhizosphere | LAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDALRHS |
| Ga0302326_104777831 | 3300031525 | Palsa | LAEDIRFELAILATVQGFYQKLMRESLGGDVPIPSGLD |
| Ga0310915_110125371 | 3300031573 | Soil | LAEDLRFELAILATVQGFYQKLLKDALGGEVPIPNGLDE |
| Ga0310686_1055248001 | 3300031708 | Soil | LLSGARVAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSG |
| Ga0310686_1059388632 | 3300031708 | Soil | LAEDLKFELSILATVQGLYQRLMRDSLGGDVPIPTGLDEAALR |
| Ga0307474_116294491 | 3300031718 | Hardwood Forest Soil | LAEDLRFELAILATVQGFYQKLMVESLGGEVPVPSGLDED |
| Ga0307477_101426591 | 3300031753 | Hardwood Forest Soil | VSEDLKFELAILATVQGFYQKLLKDMLGGEVPVPDGLGELAL |
| Ga0307477_101579151 | 3300031753 | Hardwood Forest Soil | LAEDLRFELAILATVQGFYQKLMRDSLGGDVPIPSGLDEDALRHSER |
| Ga0307475_115257051 | 3300031754 | Hardwood Forest Soil | LAEDLKFELSILATVQGFYQKLMRDSLGGDVPIPSGLDEASLRQSE |
| Ga0306921_114798691 | 3300031912 | Soil | LAEDLRFELAILATVQGFYQKLMRDSLGGDVPIPSGL |
| Ga0308174_107046132 | 3300031939 | Soil | LAEDLRFELAILATVQGLYQKLLRDTLGGDVPIPTGLDDDALRHSDRE |
| Ga0310909_112388282 | 3300031947 | Soil | LAEDLRFELAILATVQGFYQRLLRDTLGGEVPIPSGL |
| Ga0307479_101661891 | 3300031962 | Hardwood Forest Soil | LAEDLKFELAILATVQGFYQKLLRDLLGGEVPLPGGLDELALRHT |
| Ga0311301_100848036 | 3300032160 | Peatlands Soil | LAEDLKFELAILATVQGFYQKLLRDSLGGDVPIPSGLDEVSLSHS |
| Ga0307471_1013466452 | 3300032180 | Hardwood Forest Soil | LAEDLRFELAILATVQGFYQKLMSDTLGGELPVPSGLDEDALRH |
| Ga0335081_104874601 | 3300032892 | Soil | LAEDLRFELAILATVQGFYQKLLRETLGGDVPIPRDLDEDAL |
| Ga0335081_119528191 | 3300032892 | Soil | LAEDLRFELAILATVQGFYQKLMSGALGGDVPIPNGL |
| Ga0335069_100055951 | 3300032893 | Soil | LAEDLRFELAILATVQGFYQKLLRETLGGDVPIPRDLDEDALRHTDRELPN |
| Ga0335084_108205902 | 3300033004 | Soil | LAEDLRFELAILATVQGFYQKLLRDTLGGDVPIPNGLDEDALRHSEHELP |
| Ga0370514_200173_386_520 | 3300034199 | Untreated Peat Soil | MAEDLRFELAILATVQGFYQKLMRDALGGDVPIPSGLDEDALRHS |
| ⦗Top⦘ |