| Basic Information | |
|---|---|
| Family ID | F064904 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MPQSLMSIIVLLSWLALPVALICIVDDWFLRPQRLIAAAAPP |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.26 % |
| % of genes near scaffold ends (potentially truncated) | 80.47 % |
| % of genes from short scaffolds (< 2000 bps) | 70.31 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.938 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.562 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.781 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF06421 | LepA_C | 94.53 |
| PF05768 | Glrx-like | 1.56 |
| PF00009 | GTP_EFTU | 0.78 |
| PF13365 | Trypsin_2 | 0.78 |
| PF17188 | MucB_RseB_C | 0.78 |
| PF02910 | Succ_DH_flav_C | 0.78 |
| PF03144 | GTP_EFTU_D2 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0481 | Translation elongation factor EF-4, membrane-bound GTPase | Translation, ribosomal structure and biogenesis [J] | 94.53 |
| COG0695 | Glutaredoxin | Posttranslational modification, protein turnover, chaperones [O] | 1.56 |
| COG3118 | Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family | Posttranslational modification, protein turnover, chaperones [O] | 1.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.72 % |
| Unclassified | root | N/A | 38.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_102123999 | Not Available | 1269 | Open in IMG/M |
| 3300001661|JGI12053J15887_10061180 | Not Available | 2092 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101706940 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005164|Ga0066815_10110443 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005332|Ga0066388_106410704 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005436|Ga0070713_100556424 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300005439|Ga0070711_101412540 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005447|Ga0066689_10061657 | Not Available | 2048 | Open in IMG/M |
| 3300005533|Ga0070734_10446025 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005844|Ga0068862_101320973 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005952|Ga0080026_10269579 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006176|Ga0070765_101310914 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009174|Ga0105241_10009366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7198 | Open in IMG/M |
| 3300009551|Ga0105238_10287837 | Not Available | 1625 | Open in IMG/M |
| 3300010048|Ga0126373_11672018 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300010360|Ga0126372_11473724 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300010361|Ga0126378_12613311 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300011120|Ga0150983_15850082 | Not Available | 630 | Open in IMG/M |
| 3300012205|Ga0137362_10827672 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300012349|Ga0137387_10391663 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300012387|Ga0134030_1160313 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300012683|Ga0137398_10807139 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012917|Ga0137395_10197706 | Not Available | 1398 | Open in IMG/M |
| 3300014322|Ga0075355_1206532 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300017645|Ga0182749_1014574 | Not Available | 3880 | Open in IMG/M |
| 3300017961|Ga0187778_10396851 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300017974|Ga0187777_10674117 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300020170|Ga0179594_10060949 | Not Available | 1295 | Open in IMG/M |
| 3300021170|Ga0210400_10256602 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300021171|Ga0210405_10570071 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300021361|Ga0213872_10428061 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300021384|Ga0213876_10115114 | Not Available | 1427 | Open in IMG/M |
| 3300021403|Ga0210397_10452210 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300021406|Ga0210386_11817736 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300021420|Ga0210394_11030709 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300021560|Ga0126371_10887277 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300021861|Ga0213853_10497049 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300022724|Ga0242665_10069578 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300023259|Ga0224551_1045957 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300023267|Ga0247771_1197335 | Not Available | 594 | Open in IMG/M |
| 3300024330|Ga0137417_1422002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4136 | Open in IMG/M |
| 3300025898|Ga0207692_10815584 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025900|Ga0207710_10417468 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300025910|Ga0207684_11389595 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300025915|Ga0207693_10767764 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300025929|Ga0207664_11860192 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300026295|Ga0209234_1227383 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300026306|Ga0209468_1051566 | Not Available | 1394 | Open in IMG/M |
| 3300027167|Ga0208096_101677 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300027388|Ga0208995_1044281 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300027460|Ga0207506_1018689 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027463|Ga0207627_103150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300027521|Ga0209524_1026445 | Not Available | 1208 | Open in IMG/M |
| 3300027565|Ga0209219_1000894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4984 | Open in IMG/M |
| 3300027616|Ga0209106_1000606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 5523 | Open in IMG/M |
| 3300027648|Ga0209420_1210844 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300027681|Ga0208991_1178466 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300027855|Ga0209693_10217901 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300028573|Ga0265334_10238470 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300028775|Ga0302231_10215910 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300028780|Ga0302225_10144855 | Not Available | 1152 | Open in IMG/M |
| 3300030524|Ga0311357_10936783 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300030617|Ga0311356_11011109 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300030618|Ga0311354_10729139 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300030906|Ga0302314_11919283 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031027|Ga0302308_10544623 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031446|Ga0170820_10601181 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031543|Ga0318516_10772911 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031545|Ga0318541_10025307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2889 | Open in IMG/M |
| 3300031561|Ga0318528_10809962 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031573|Ga0310915_10607009 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300031640|Ga0318555_10658680 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031668|Ga0318542_10015105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3044 | Open in IMG/M |
| 3300031668|Ga0318542_10233746 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300031680|Ga0318574_10491148 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300031720|Ga0307469_10447801 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300031720|Ga0307469_12233774 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031723|Ga0318493_10104669 | Not Available | 1424 | Open in IMG/M |
| 3300031740|Ga0307468_100105778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1687 | Open in IMG/M |
| 3300031751|Ga0318494_10935063 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031753|Ga0307477_10843434 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031769|Ga0318526_10315023 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031771|Ga0318546_10215460 | Not Available | 1315 | Open in IMG/M |
| 3300031779|Ga0318566_10052208 | Not Available | 1944 | Open in IMG/M |
| 3300031793|Ga0318548_10030385 | Not Available | 2365 | Open in IMG/M |
| 3300031796|Ga0318576_10405114 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031799|Ga0318565_10044948 | Not Available | 2036 | Open in IMG/M |
| 3300031831|Ga0318564_10150011 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300031832|Ga0318499_10290278 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031880|Ga0318544_10340689 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031894|Ga0318522_10132261 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300031897|Ga0318520_10242117 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300031942|Ga0310916_11716558 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032008|Ga0318562_10164568 | Not Available | 1280 | Open in IMG/M |
| 3300032009|Ga0318563_10074396 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1768 | Open in IMG/M |
| 3300032025|Ga0318507_10130330 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300032043|Ga0318556_10573392 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300032174|Ga0307470_10691413 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300032180|Ga0307471_100694980 | Not Available | 1181 | Open in IMG/M |
| 3300032205|Ga0307472_100142825 | Not Available | 1734 | Open in IMG/M |
| 3300032805|Ga0335078_10299009 | Not Available | 2165 | Open in IMG/M |
| 3300033489|Ga0299912_10231674 | Not Available | 1576 | Open in IMG/M |
| 3300034125|Ga0370484_0009478 | Not Available | 2055 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.25% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.78% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.78% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017645 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C Kraft MG (version 2) | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300023267 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L197-509C-6 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300027167 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF034 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027460 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes) | Environmental | Open in IMG/M |
| 3300027463 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-C (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1021239992 | 3300000955 | Soil | MPQSLMSIIVLLSWLALPVALICIVDDWFLRPQRLIAA |
| JGI12053J15887_100611802 | 3300001661 | Forest Soil | MFQIIVILSWLALPVGLLVIVDDWFIRPRRQIAASPQ |
| JGIcombinedJ26739_1017069402 | 3300002245 | Forest Soil | MLDMLMPLLVLLSWLALPVAVICVVDDWLLRPQRAARLG |
| Ga0066815_101104432 | 3300005164 | Soil | MLQSLMPLIILMSWLALPVTLICIVDDWFLRPRRTLAAAPGAQVVRDGTFMT |
| Ga0066388_1064107042 | 3300005332 | Tropical Forest Soil | MLQALMPTIVVLSWLALPVTILCIIDDWFLRPRRALAALPAGAGGGE |
| Ga0070713_1005564241 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQLLMQIIVFLSWLALPVGVLCIADDWFLRPRRQILAAPQEARDPP |
| Ga0070711_1014125401 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQLLMQIIVFLSWLALPVGVLCIADDWFLRPRRQILAAPQEAR |
| Ga0066689_100616572 | 3300005447 | Soil | MLQTLMPLIVLLSWLALPVTVVCIVDDWLLRPQRAIAASAR |
| Ga0070734_104460252 | 3300005533 | Surface Soil | MQMLMPIAYYLSLLAIPVGLFCIYDDWFVRPRRQVAAAPQEA |
| Ga0070686_1004628652 | 3300005544 | Switchgrass Rhizosphere | MFQIIVILSWLALPIGLLVIADDWFIRPRRQIAASPQPPADPLLMRTAYMLLPLFIGAAVLRLLL |
| Ga0068852_1015163991 | 3300005616 | Corn Rhizosphere | MFFQIIALLSWLAIPAGLLVIIDDWFIRPRRQIAASPAPPA |
| Ga0068863_1021910151 | 3300005841 | Switchgrass Rhizosphere | MIFQIIGLLSWLAIPVGLIVIIDDWFIRPRRQIAASP |
| Ga0068862_1013209731 | 3300005844 | Switchgrass Rhizosphere | MQMLMKLIMLLSWAAIPVAIICVVDDWFLRPKRQLAA |
| Ga0080026_102695791 | 3300005952 | Permafrost Soil | MLMQIIVGLSWLALPVALVCLIDDLFLRPRRQIAALPQPVRDPPLAAA |
| Ga0070765_1013109142 | 3300006176 | Soil | MFMQIIVALSWLALPVGLVCLADDWFLRPRRQIAALPQPARDPP |
| Ga0105241_100093669 | 3300009174 | Corn Rhizosphere | MLQSLMPLIVLMSWLALPVTLICIVDDWFLRPRRTLA |
| Ga0105237_107555092 | 3300009545 | Corn Rhizosphere | MQILVILSWLALPIGLLVIADDWFIRPSRQIAASPQPPVDPPVMRIAYLLLPLFIGAAVL |
| Ga0105238_102878372 | 3300009551 | Corn Rhizosphere | MLMQIIVLLSWLALPVGVLCVVDDWFLRPRRQIAAA |
| Ga0126373_116720182 | 3300010048 | Tropical Forest Soil | MSAIVLLSWLAVPVGLVCIVDDWFLRPQRLIAAPTPPR |
| Ga0126372_114737242 | 3300010360 | Tropical Forest Soil | MLQALMPTIVVLSWLALPVTLICIVDDWFLRPRRALAPVPAREPPPEA |
| Ga0126378_126133112 | 3300010361 | Tropical Forest Soil | MSVIVVLSWLALPVAVACIVDDWFLRPRRVIAASAPP |
| Ga0126361_102053901 | 3300010876 | Boreal Forest Soil | MLQIIALLSWLALPVGLIVIADDWFFRPRRQIAASPAPPVDPPLMKTLYMLLP |
| Ga0150983_158500822 | 3300011120 | Forest Soil | MQIVVLLSWLALPVGVLCIVDDWFLRPRRQIAAAPQEARDPPAIS |
| Ga0137393_116099462 | 3300011271 | Vadose Zone Soil | MFQIIVILSWLALPIGLLVIADDWFIRPRRQIAAAPQPPADPPLMRTAYM |
| Ga0137362_108276722 | 3300012205 | Vadose Zone Soil | MQMLMPIVVFLSWLALPVGLLCIADDWFLRPRRQI |
| Ga0137381_107482532 | 3300012207 | Vadose Zone Soil | MLFQIIVILSWLALPVGLLVIADDWFIRPRRQIAASPQPPTDPALI |
| Ga0137387_103916632 | 3300012349 | Vadose Zone Soil | MLQTLMPFIVLLSWLALPVTLICILDDWLLRPRRV |
| Ga0134030_11603132 | 3300012387 | Grasslands Soil | MLQTLMPLIVLLSWLALPVTVVCIVDDWLLRPQRSIAASART |
| Ga0137398_108071391 | 3300012683 | Vadose Zone Soil | MLQTLMPLIVLLSWLALPVTLVCIVDDWLLRPRRV |
| Ga0137395_101977061 | 3300012917 | Vadose Zone Soil | MLQTLMPLIVLLSWLALPVTVVCIVDDWLLRPRRVIASGLQTVRDG |
| Ga0137394_109033622 | 3300012922 | Vadose Zone Soil | MFQIIVILSWLALPIGLLVIVDDWFIRPRRQIAASPQPPTDP |
| Ga0137359_112022121 | 3300012923 | Vadose Zone Soil | MLQTISNVAWFFSWLAIPVGLLVIIDDWFIRPRRQVAASPQPPVDPPLMRAAYMLLPL |
| Ga0137413_115129161 | 3300012924 | Vadose Zone Soil | MFQIIVILSWLALPIGLLVIADDWFFRSRRQIAASPQPPVDPPLMRAAYL |
| Ga0137410_107955841 | 3300012944 | Vadose Zone Soil | MFQILFNVSWLYSWLAIPVGLLVIMDDWFVRPRRQIAASPQPPVDPPLMRTAYMLLPLFI |
| Ga0157369_105628841 | 3300013105 | Corn Rhizosphere | MFFQIIALLSWLAIPAGLLVIIDDWFIRPRRQIAASPAPPADPALM |
| Ga0163162_114817002 | 3300013306 | Switchgrass Rhizosphere | MFFQMIGYLSWLAIPVGLIVIIDDWFIRPRRQVAASPAPPAD |
| Ga0075355_12065322 | 3300014322 | Natural And Restored Wetlands | MLQTLMPLVVILSWLALPVTLICIVDDWFLRPRRALDSGPQVVRDS |
| Ga0137418_108657841 | 3300015241 | Vadose Zone Soil | MFQILFNVSWLFSWLAIPVGLLVIIDDWFRRTRRQIAASPQPPVDPPLMRVAYLLLP |
| Ga0182749_10145745 | 3300017645 | Compost | MLMNLVVLLSWLAIPVGLIAIVDDWFLRPRRQLAAAP |
| Ga0187778_103968512 | 3300017961 | Tropical Peatland | MLQSLMPIVAVLSWLALPAALVCIVDDWFLRPRRLIAAATAPRD |
| Ga0187777_106741171 | 3300017974 | Tropical Peatland | MPQSLMPIIVLLSWLALPVALVCIVDDWFLRPRRLIAAATAPRDPP |
| Ga0193751_12353471 | 3300019888 | Soil | MFQIIVILSWLALPIGLLVIADDWFIRPRRQIAASPQPPADPPLMRTAY |
| Ga0179594_100609492 | 3300020170 | Vadose Zone Soil | MLQTLMPLIVLLSWLALPVTLVCIVDDWLLRPRRVIASGLQTVR |
| Ga0210400_102566021 | 3300021170 | Soil | MLMQIIVPLSWLALPVGLLCIVDDWFLRPRRQIAAAPQEPR |
| Ga0210405_105700712 | 3300021171 | Soil | MMTSLMPFIVLLSWLALPVGVICVVDDWLLRPRRPPAAAD |
| Ga0213872_104280611 | 3300021361 | Rhizosphere | MPQSLMSVIVLLSWLALPVALICIVDDWFLRPQRLIAASAPPHDAP |
| Ga0213876_101151141 | 3300021384 | Plant Roots | MTMLMQLAAVLAWLALPVGLLVIGDDWFVRPGRQIAAAP |
| Ga0210397_104522102 | 3300021403 | Soil | MLQTLSPLILLLSWLALPVTLVCMVDDWLLRPPGTI |
| Ga0210386_118177361 | 3300021406 | Soil | MPQSLMSVIVLLSWLALPVALICIVDDWFLRPQRLIAAPAPPHDAPLMTFL |
| Ga0210394_110307091 | 3300021420 | Soil | MLQTLMPIIVFLSWLALPVTLICVVDDWFLRPRRAAAVA |
| Ga0126371_108872771 | 3300021560 | Tropical Forest Soil | MLQALMPTIVVLSWLALPVTILCVIDDWFLRPRRALAALSAAPGHG |
| Ga0213853_104970492 | 3300021861 | Watersheds | MTNLMPLITLLAWLAVPAGLICITDDWLLRPRRAPGA |
| Ga0242658_11998142 | 3300022530 | Soil | MFQIIAFLSWLALPVGLIVIADDWFIRPRRQIAASPAPPVDPPLMK |
| Ga0242665_100695782 | 3300022724 | Soil | MSGTSLMPLIVVLSWLALPAGLVCVADDWLLRPRRA |
| Ga0242654_102219292 | 3300022726 | Soil | MFQIIVIVSWLALPIGLLVIVDDWFIRPRRQIAASPQPPSDPP |
| Ga0224551_10459572 | 3300023259 | Soil | MFMQIIVALSWLALPVGLFCMVDDWFLRPRRQLESASQP |
| Ga0247771_11973351 | 3300023267 | Plant Litter | MQLVVLLSWLALPAAVLCIADDWFMRPKRQIAAAPAPARDPPLVALAYYAL |
| Ga0137417_142200213 | 3300024330 | Vadose Zone Soil | LQTIELLSWLALPVGLIVIVDDWFLRSRRQIAASPA |
| Ga0207656_102633402 | 3300025321 | Corn Rhizosphere | MFFQIIALLSWLAIPAGLLVIIDDWFIRPRRQIAASPAPPADPALMKML |
| Ga0207692_108155841 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQSLMSIIVLLSWLALPVALICIVDDWFLRPQRLIAAAAP |
| Ga0207710_104174682 | 3300025900 | Switchgrass Rhizosphere | MPQLLMQIIVILSWLALPVGVLCIADDWFLRPRRQ |
| Ga0207684_113895952 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQSLMSVIVLLSWLALPVALICIVDDWFLRPQRLIAAPAPPHDAPLM |
| Ga0207695_101540241 | 3300025913 | Corn Rhizosphere | MFFQIIALLSWLAIPAGLLVIIDDWFIRPRRQIAASPAPPADP |
| Ga0207693_107677642 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQSLMSIIVLLSWLALPVALICIVDDWFLRPQRLI |
| Ga0207664_118601921 | 3300025929 | Agricultural Soil | MPQMLMQIIVLLSWLALPVGVLCVVDDWFLRPRRQIAAAPQ |
| Ga0207711_115577241 | 3300025941 | Switchgrass Rhizosphere | MFFQIIALLSWLAIPAGLLVIIDDWFIRPRRQIAASPAPPADPALMKTLY |
| Ga0207641_107594631 | 3300026088 | Switchgrass Rhizosphere | MFQIIVILSWLALPIGLLVIADDWFIRPRRQIAASPQPPADPLLMRTAY |
| Ga0207675_1016485191 | 3300026118 | Switchgrass Rhizosphere | MFFQIIALLSWLAIPAGLLVIIDDWFIRPRRQIAASPAPPADPAL |
| Ga0209234_12273831 | 3300026295 | Grasslands Soil | MLQTLMPLIVLLSWLALPVTVVCIVDDWLLRPQRSIAASA |
| Ga0209468_10515662 | 3300026306 | Soil | MLETLMPLIVLLSWLALPVTLICIVDDWLLRPRRVIASGRQTVPDA |
| Ga0208096_1016771 | 3300027167 | Forest Soil | MPQFLMPIVIALSWLALPVTLLCVIDDWFLRPRRALT |
| Ga0208995_10442812 | 3300027388 | Forest Soil | MLQTLMPFIVLLSWLALPVTLVCIVDDWLLRPRRLIAAGAQARPEAL |
| Ga0207506_10186891 | 3300027460 | Soil | MLQSLMPLIILMSWLALPVTLICIVDDWFLRPRRTLAAAPGAQVVRD |
| Ga0207627_1031501 | 3300027463 | Soil | MSQLMPIVVFLSWLSLPVLIVCIFDDWFLRPRRTLAAVA |
| Ga0209524_10264452 | 3300027521 | Forest Soil | MLQTLMPFIVLLSWLALPVTLVCIVDDWLLRPRRVIAAGAQAGRDAP |
| Ga0209219_10008941 | 3300027565 | Forest Soil | MLQTLMPLIVLLSWLALPVTLVCIVDDWLLRPRRVIATGAQAGRDAPLM |
| Ga0209331_11657302 | 3300027603 | Forest Soil | MFQIIVILSWLALPVGLLVIVDDWFIRPRRQIAASPQPPADPPL |
| Ga0209106_10006068 | 3300027616 | Forest Soil | MLQTLMPFIVLLSWLALPVTLVCIVDDWLLRPRRVIASGLQ |
| Ga0209420_12108442 | 3300027648 | Forest Soil | MLTSLMPVIVLLSWLAVPVMLVCVVDDWFLRPQRTIAAAQ |
| Ga0208991_11784662 | 3300027681 | Forest Soil | MLQTLMPLIVLLSWLALPVTLVCIVDDWLLRPRRVIASGLR |
| Ga0209693_102179012 | 3300027855 | Soil | MTNLMSLLVPLAWLALPVGLICIVDDWLLRPRRAPGTPDSP |
| Ga0268264_100632794 | 3300028381 | Switchgrass Rhizosphere | MFQIIVILSWLALPIGLLVIADDWFIRPRRQIAASPQPPADPLLMRTAYMLLPLFIG |
| Ga0265334_102384702 | 3300028573 | Rhizosphere | MPELLMQIIKLLSWLALPVGVLCIVDDWFLRPGRQIAAAPQEARDP |
| Ga0302231_102159102 | 3300028775 | Palsa | MFMQIIVALSWLALPVGLICLVDDWFLRPRRQTAALPQPSRDP |
| Ga0302225_101448552 | 3300028780 | Palsa | MFMLIVVALSWLALPVGLVCLVDDWFLRPRRQIAALP |
| Ga0311357_109367831 | 3300030524 | Palsa | MLMQIIVFLSWLALPVGILCVIDDWFLRPRREIAASPQP |
| Ga0311356_110111091 | 3300030617 | Palsa | MLMQIISALSWLALPVGLVCLIDDWFVRPRRQISALPHAVADPPLI |
| Ga0311354_107291392 | 3300030618 | Palsa | MQMLMPIAVFLSWLALPVGLLCIADDWFFRPRRQIAASP |
| Ga0302314_119192832 | 3300030906 | Palsa | MQMLMPIVVFLSWLALPVGLLCIADDWFFRPRRQIAASPQ |
| Ga0302308_105446231 | 3300031027 | Palsa | MFMQIIVALSWLALPVGLVCLADDWFLRPRRQIAALPQP |
| Ga0170820_106011811 | 3300031446 | Forest Soil | MLQSLKPLIDLLSWLALPATLICIVDDWFLRPRRALSAPPGAQAAPD |
| Ga0318516_107729112 | 3300031543 | Soil | MPQSLMSIIVLLSWLALPVALICIVDDWFLRPQRLIAAAAPPQDAPFMTFLY |
| Ga0318541_100253074 | 3300031545 | Soil | MPQSLVSVIVLLSWLALPVALVCIVDDWFLRPRRLIAAAAPPHDAPLMTFLY |
| Ga0318528_108099621 | 3300031561 | Soil | MPQSLMSVIVVLSWLALPVAVACIVDDWFLRPRRVIAASAPPHD |
| Ga0310915_106070092 | 3300031573 | Soil | MPQSLMSVIVLLSWLALPVALICIVDDWFLRPRRLIAAPVPPQDAPL |
| Ga0318555_106586801 | 3300031640 | Soil | MPQSLLSVIVLLSWLALPVALVCIVDDWFLRPRRLIAAAAPPHDAPLMTFLYSA |
| Ga0318542_100151054 | 3300031668 | Soil | MPQSLMSVIVLLSWLALPVALICIVDDWFLRPRRL |
| Ga0318542_102337462 | 3300031668 | Soil | MPQSLVSVIVLLSWLALPVALVCIVDDWFLRPRRLIAAA |
| Ga0318574_104911482 | 3300031680 | Soil | MPQSLLSVIVLLSWLALPVALVCIVDDWFLRPRRLIAAAAPPHDAP |
| Ga0307469_104478011 | 3300031720 | Hardwood Forest Soil | MLQSLKPLIDLLSWLALPATLICIVDDWFLRPRRALS |
| Ga0307469_122337741 | 3300031720 | Hardwood Forest Soil | MFMNFIVLLSWLAIPVGMLAVIDDWFLRPRRQLSP |
| Ga0318493_101046692 | 3300031723 | Soil | MPQSLVSVIVLLSWLALPVALVCIVDDWFLRPRRLIAAAAPPQDSPLMTFLY |
| Ga0307468_1001057783 | 3300031740 | Hardwood Forest Soil | MPQSLMSIIVLLSWLALPVALICIVDDWFLRPQRLIAAAAPP |
| Ga0318494_109350631 | 3300031751 | Soil | MSVIVVLSWLALPVAVACIVDDWFLRPRRVIAASAPPHDSPLMTF |
| Ga0307477_108434342 | 3300031753 | Hardwood Forest Soil | MLQSLMPIIVLLSWLALPVTVVCVVDDWFLRPRRALSKAQPPRDAP |
| Ga0307475_113696341 | 3300031754 | Hardwood Forest Soil | MFFQIIVILSWLALPVGILVIVDDWFIRPRRQIAASPQPPVD |
| Ga0318526_103150231 | 3300031769 | Soil | MPQSLMSVIVMLSWLALPVALICIVDDWFLRPQRLIAA |
| Ga0318546_102154602 | 3300031771 | Soil | MPQSLLSVIVLLSWLALPVALVCIVDDWFLRPRRLIAAAAPPHDAPLMTFLY |
| Ga0318566_100522081 | 3300031779 | Soil | MPQSLISVIVLLSWLALPVALVCIVDDWFLRPRRLIAAAAPPH |
| Ga0318548_100303851 | 3300031793 | Soil | MPQSLISVIVLLSWLALPVALVCIVDDWFLRPTCS |
| Ga0318576_104051142 | 3300031796 | Soil | MSVIVLLSWLALPVALICIVDDWFLRPRRSAAAPVP |
| Ga0318565_100449481 | 3300031799 | Soil | MPQSLMSIIVLLSWLALPVALICIVDDWFLRPQRLIAAAAPPQDAPFM |
| Ga0318564_101500111 | 3300031831 | Soil | MPQSLMSIIVLLSWLALPVALICIVDDWFLRPQRLIAAAAPPQDAPFMTFLYS |
| Ga0318499_102902782 | 3300031832 | Soil | MPQSLVSVIVLLSWLALPVGLVCIVDDWFLRPRRLIASP |
| Ga0318544_103406891 | 3300031880 | Soil | MPQSLVSVIVLLSWLALPVALVCIVDDWFLRPRRLIAAAAPPHDAPLM |
| Ga0318522_101322612 | 3300031894 | Soil | MPQSLISVIVLLSWLALPVALVCIVDDWFLRPRRLIAAAAPPHDAPLMTFLYS |
| Ga0318520_102421171 | 3300031897 | Soil | MPQSLISVIVLLSWLALPVALVCIVDDWFLRPRRLIAAAAPPHDAP |
| Ga0310916_117165582 | 3300031942 | Soil | MPQSLVSVIVLLSWLALPVGLVCIVDDWFLRPRRL |
| Ga0318562_101645681 | 3300032008 | Soil | MPQSLMSIIVLLSWLALPVALICIVDDWFLRPQRLIAAAAPPQDAPFMT |
| Ga0318563_100743962 | 3300032009 | Soil | MPQSLISVIVLLSWLALPVALVCIVDDWFLRPTCSTAR |
| Ga0318507_101303301 | 3300032025 | Soil | MPQSLISVIVLLSWLALPVALVCIVDDWFLRPRRLIAAAAPPHDAPLMTFLY |
| Ga0318556_105733922 | 3300032043 | Soil | MPQSLISIIVLLSWLALPVALVCIVDDWFLRPRRLIAAPAPPHDAPLMTF |
| Ga0307470_106914132 | 3300032174 | Hardwood Forest Soil | MPQSLMSIIVLLSWLALPVALICIVDDWFLRPQRL |
| Ga0307471_1006949801 | 3300032180 | Hardwood Forest Soil | MPQSLMSIIVLLSWLALPVALICIVDDWFLRPQRLIAAAAPPQD |
| Ga0307472_1001428252 | 3300032205 | Hardwood Forest Soil | MPQSLMSVIVLLSWLALPVALICIVDDWFLRPQRLIAAPAPPHDAPLMTF |
| Ga0335078_102990093 | 3300032805 | Soil | MLQSLMPIITLLSWLALPVSLVCIVDDWFLRPRRALSAAGAGTAAPA |
| Ga0299912_102316742 | 3300033489 | Soil | MPPMLLQLIMVLSWVALPVSVICVVDDWFIRPRRQLKAAPNP |
| Ga0370484_0009478_1929_2054 | 3300034125 | Untreated Peat Soil | MFMQIIVALSWLALPVALLCVVDDWFLRPRRQIAAAAQPVRD |
| ⦗Top⦘ |