| Basic Information | |
|---|---|
| Family ID | F064751 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MVIAAVPDAAPPVVRTMVVLVDVAAGVEVAVKDVTVLAMEDTVPKK |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 56.25 % |
| % of genes near scaffold ends (potentially truncated) | 39.84 % |
| % of genes from short scaffolds (< 2000 bps) | 99.22 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (31.250 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.906 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.438 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.11% β-sheet: 0.00% Coil/Unstructured: 91.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 31.25% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 19.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.38% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.59% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.25% |
| Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine | 6.25% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.34% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.34% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.56% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.56% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.78% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.78% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.78% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004788 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006378 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009864 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, surface; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011012 | Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs | Environmental | Open in IMG/M |
| 3300012471 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012712 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012757 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012761 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012769 | Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012776 | Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012962 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013313 | Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs re-assembly | Environmental | Open in IMG/M |
| 3300016681 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES152 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016699 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018599 | Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dT | Environmental | Open in IMG/M |
| 3300018610 | Metatranscriptome of marine microbial communities from Baltic Sea - LD35M_ls2 | Environmental | Open in IMG/M |
| 3300018665 | Metatranscriptome of marine microbial communities from Baltic Sea - LD30M_ls2 | Environmental | Open in IMG/M |
| 3300019113 | Metatranscriptome of marine microbial communities from Baltic Sea - GS845_ls3 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300024530 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024535 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024548 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024551 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024554 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024564 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026410 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026422 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300028077 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028096 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028097 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028255 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028266 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029699 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0007742_100294381 | 3300004788 | Freshwater Lake | VRVMVIAAVPDAAPPVVRTMVVLADVAAALEVAVKDGTLLAMEPTVPKK* |
| Ga0007764_100604151 | 3300004797 | Freshwater Lake | MVIAAAPDAAPVVVRTMVVLVPVAAGVEVAAKFVTLLAMEDTVPTK* |
| Ga0007764_100604153 | 3300004797 | Freshwater Lake | PDAAPVVVRTMVVLVPVAAGVEVAAKFVTLLAMEDTIPKK* |
| Ga0068885_10501112 | 3300005565 | Freshwater Lake | MVIAEVPDATPPPVVRTMVVLVDVALPEVAVKDPTLLAMEVTDPKK* |
| Ga0078894_113507392 | 3300005662 | Freshwater Lake | MVIAAMPDATSPPVVRTMVVLVDIALPEVAVKLLTVLVMELTVPKK* |
| Ga0075498_13557221 | 3300006378 | Aqueous | VIAEVPVAAPAVVRTMVVLVDMAAGEEVAVKDVTPLAMEETVPKK* |
| Ga0102913_12993481 | 3300007560 | Estuarine | MVIAAVPDAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVTVPKK* |
| Ga0102922_11992663 | 3300008021 | Estuarine | QAPASSSRLDAAPPVVRTMLVLEASAAGVEVAVKLFTPLAMEVTVPKK* |
| Ga0114340_12695012 | 3300008107 | Freshwater, Plankton | MVIAEVPDATPPVVRTMVVLEPSAAGLEVAVKLLTVLVMEPTVPKK* |
| Ga0114344_12530062 | 3300008111 | Freshwater, Plankton | PVATPPPVVRTTVVLAAAAAGAEVAVKDTTLLAMEVTDPKK* |
| Ga0114344_12548062 | 3300008111 | Freshwater, Plankton | MVIAEVPDATPPVVRTMVVLEAPAAGLEVAVKLLTVLAMEVTDPKK* |
| Ga0114346_13308841 | 3300008113 | Freshwater, Plankton | VMVIAEVPDATPPVVRTMVVLEPSAAGLEVAVKLLTVLVMEPTVPKK* |
| Ga0114346_13308843 | 3300008113 | Freshwater, Plankton | MVIAEVPDATPPVVRTMVVLEPSAAGLEVAVKLLTVL |
| Ga0114346_13350962 | 3300008113 | Freshwater, Plankton | MVIAEVPDAAPPVVSTMVVLPDVALPEVAVKDRTLLAMELTDPKK* |
| Ga0114354_12875383 | 3300008119 | Freshwater, Plankton | MVIAEVPDATPPVVRTMVVLEASAAGLEVAVKLLTVLAMEPTVPKK* |
| Ga0114337_13445252 | 3300008262 | Freshwater, Plankton | MVIAPAPDTAPVVVRTMVVLVPVAASVEVAAKFVTPLAMEDTVPTK* |
| Ga0114966_107891351 | 3300009161 | Freshwater Lake | AVPDAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVTVPKK* |
| Ga0126448_11253882 | 3300009466 | Meromictic Pond | MVIAAVPDATPPPVVRTMVVLVDVAIPDVAVKDVTVLAMELTDPKK* |
| Ga0132193_1069872 | 3300009864 | Meromictic Pond | MVIAVVPDATPPPVVRTMVVLVDVAVPDVAVKDVTVLAMELTDPKK* |
| Ga0129333_116683892 | 3300010354 | Freshwater To Marine Saline Gradient | MVIAPAPDTAPVVVRTMVVLVPVAAGVEVAAKFVTPLAMEDTVPTK* |
| Ga0150979_11159612 | 3300011012 | Marine | MVIAAVPDAAPPVVSTMVVLAAVAAGVEVAVKDVTVLAMEDTVPKK* |
| Ga0150979_11159621 | 3300011012 | Marine | MVIAAVPDAAPPVVSTMVVLVAVAAGVEVAVKDETLLVMELTDPKK* |
| Ga0150979_11159631 | 3300011012 | Marine | VPDAAPPVVSTMVVLVAVAAGVEVAVKDETLLVMPLTDPKK* |
| Ga0150979_11159632 | 3300011012 | Marine | MVIAAVPDAAPPVVSTMVVLVAVAAGVEVAVKDETVLVMPLTDPKK* |
| Ga0150979_11159781 | 3300011012 | Marine | APSLSPVKVMVIDEVPDAAPPVVSTMVVLVAVAAGVEVAVKDVTLLLTEDTVPKK* |
| Ga0150979_11159803 | 3300011012 | Marine | MVIDEVPDAAPPVVSTMVVLVAVAAGVEVAVKDVTLLLTEDTVPKK* |
| Ga0150979_11159832 | 3300011012 | Marine | MVIDEVPDAAPPVVSTMVVLVAVAAGVEVAVKDVTVLAMEDTVPKK* |
| Ga0129334_10464171 | 3300012471 | Aqueous | MVIAEVPDAAPAVVRTMVVLVDVAAGVEVAVKDTMLLAMEATVPKK* |
| Ga0129334_10464173 | 3300012471 | Aqueous | MVIAEVPDAAPAVVRTMVVLVDVAEGVEVAVKDTMLLAMEAT |
| Ga0157627_12030671 | 3300012706 | Freshwater | MVIAAVPDAAPPVVRTMVVLVDVAAGVEVAVKDVTVLAMEDTVPKK* |
| Ga0157623_10032722 | 3300012707 | Freshwater | MVIAAVPEEAPPVVSSMVVLVDVAAGVEVAVKDVTVLAIEVTDPKK* |
| Ga0157623_10205143 | 3300012707 | Freshwater | MVIAEVPDAAPEVVRTMVVLVDVAAGVDVAAKDVTLLVMEATVPKK* |
| Ga0157623_10350132 | 3300012707 | Freshwater | MVIAEVPDATPPPVVRTMVVLEAPAAGLEVAVKLLTSLAMEPTVPKK* |
| Ga0157623_10752973 | 3300012707 | Freshwater | MVIAEVPDAAPPVVSTMVVLAAVAAGVEVAVKDVTLLEMEDTVPKK* |
| Ga0157623_11936312 | 3300012707 | Freshwater | MVMAAVPVAAPPVVSTIDVLVAVAAGVEEAVNVVTVLAMEDTVPKK* |
| Ga0157598_10105422 | 3300012712 | Freshwater | IAAVPDAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVTVPKK* |
| Ga0157598_11809431 | 3300012712 | Freshwater | MVIAEVPDATPPPVVRTMVVLVDVAAGVEVAVKDVTVLAMEDTVPKK* |
| Ga0157601_12164341 | 3300012714 | Freshwater | AAVPDAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVTVPKK* |
| Ga0157599_11609542 | 3300012715 | Freshwater | MVIAAVPDAAPPVVMTMVVLVDVAAGVEVAVKDVTVLAMEDTVPKK* |
| Ga0157609_11926681 | 3300012717 | Freshwater | AAVPDAAPPVVRTMVVLKAPAAGVEVAVKDVTVLVMEDTVPKK* |
| Ga0157609_11926682 | 3300012717 | Freshwater | MVIAAVPDAAPPVVRTMVVLKAPAAGVEVAVKDVTVLVMEDTV |
| Ga0157612_10019311 | 3300012721 | Freshwater | MVIAAVPDAAPPVVRTMVVLKAPAAGVEVAVKDVTVLVMEDTVPRK* |
| Ga0157612_12300292 | 3300012721 | Freshwater | MVIAALPDATPPPVVRTMVVLVDVALPEVAVKDVTVLAMELTDPKK* |
| Ga0157630_10316712 | 3300012722 | Freshwater | MVIAAVPDAAPPVVRTMVVLKAPAAGVEVAVKDVTVLAMEDTVPKK* |
| Ga0157630_12291262 | 3300012722 | Freshwater | MVIAEVPDAAPPVVSTMVVLAAVAAGVEVAVKDVTLLLTEDTVPKK* |
| Ga0157630_12437772 | 3300012722 | Freshwater | MVIVEVPDAAPEVVRTMVVLVDVAAGVDVAAKDVTLLVMEATVPKK* |
| Ga0157611_11863372 | 3300012724 | Freshwater | MVIAEVPDATPPPVVRTMAVLEASAAGLEVAVKDVTLLAMEPTVPKK* |
| Ga0157625_12854611 | 3300012729 | Freshwater | MVIAEVPDATPPPVVRTMVVLVDVALPEVAVKDVTVLAMELTDPKK* |
| Ga0157616_10428502 | 3300012731 | Freshwater | MVIAEVPDATPPPVVRTMVVLEAPAAGLEVAVKDVTLLAMEPTVPKK* |
| Ga0157606_13999892 | 3300012733 | Freshwater | MVIAEVPDATPPPVVRTMAVLEAPAAGLEVAVKDVTLLAMEPTVPKK* |
| Ga0157615_10430481 | 3300012734 | Freshwater | METAAVAVAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVTVPKK* |
| Ga0157628_11844012 | 3300012757 | Freshwater | MVIAAVPEEAPPVVSTMVVLVDVAAGVEVAVKDVTVLAIEVTDPKK* |
| Ga0157626_11031211 | 3300012759 | Freshwater | VRVMVIAAVPDAAPPVVRTMLVLEASAAGVEVAVKLFTPLAMEVTVPKK* |
| Ga0157626_11031212 | 3300012759 | Freshwater | MVIAAVPDAAPPVVRTMLVLEASAAGVEVAVKLFTPLA |
| Ga0157626_11140603 | 3300012759 | Freshwater | ALPVTAPPVVSTMEVLVAVAAVVEAAVKDVTLLLTEDTVPKK* |
| Ga0157626_11706881 | 3300012759 | Freshwater | MVIAALPDATPPPVVRTMVVLADVALPEVAVKDVTVLAMEVTDPKK* |
| Ga0157626_12028092 | 3300012759 | Freshwater | MVIAEVPDATPPVVRTMVVLEAPAAGLEVAVKLLTVLAMEPTVPKK* |
| Ga0138288_10335521 | 3300012761 | Freshwater Lake | VAAPPVVRTMVVLVAVAAGVEVAVKLPTPLAIDVTDPRK* |
| Ga0138288_10335522 | 3300012761 | Freshwater Lake | MVMGEVPVAAPPVVRTMVVLVAVAAGVEVAVKLPTPLAIDVTDPRK* |
| Ga0138279_12504182 | 3300012769 | Freshwater Lake | MVIAAVPDGAPPVVRTMVVLTDVAAGVEVAVKSAMLLVIEATDPKK* |
| Ga0138287_11758682 | 3300012772 | Freshwater Lake | PSVSPVRVIVTAAVPVATPPPVVRTTVVLAAAAAGAEVAVKDTTLLAMEVTDPKK* |
| Ga0138290_12398211 | 3300012773 | Freshwater Lake | RPVRVMVIAAVPDGTPPPVVSTMVVLADVASPEVAVKDVTVLAMEETVPKK* |
| Ga0138283_10640951 | 3300012774 | Freshwater Lake | MVIAAVPDTAPPVVRTMAVLVDVAVPEVAVKDPTPLAMELTDPKK* |
| Ga0138283_11311561 | 3300012774 | Freshwater Lake | MVIAAVPDGTPPPVVSTMVVLADVASTEVAVKDVTVLAMEETVPKK* |
| Ga0138283_13156801 | 3300012774 | Freshwater Lake | MVIAAVPDAAPPVVRTRVVLVDVTVAEVAVKAVTGLLAMEVTDPKK* |
| Ga0138275_12529373 | 3300012776 | Freshwater Lake | GGMVRVMVIAVVPDATPPPVVRTMVVLVDVAVPEVAVKDVTPLAMELTDPKK* |
| Ga0138284_13282811 | 3300012779 | Freshwater Lake | MVIAAVPDAAPAVVRTRAVLVAVTAAEVAVKLATLLAMEVTVPKK* |
| Ga0129335_10085091 | 3300012962 | Aqueous | MVIAAVPDAAPPVVSTMVVLVDVAAGVEVAVKDPTVLAMELTDPKK* |
| Ga0129335_10766291 | 3300012962 | Aqueous | MVIAEVPDSTPLPVVRTMVVLEAPAAGLEVAVKLFTVLAMEPTVPKK* |
| Ga0170791_158134921 | 3300013295 | Freshwater | MVIAAVPDGTPPPVVSTMVVLADVAAPEVAVKDVTVLAMEETVPKK* |
| Ga0173629_100451263 | 3300013313 | Marine | APSLSPVKVMVIDEVPDAAPPVVSTMVVLVAVAAGVEVAVKDETLLVMELTDPKK* |
| Ga0180043_1544571 | 3300016681 | Freshwater | MVIAAVPDAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVTVPK |
| Ga0180043_1544572 | 3300016681 | Freshwater | AVPDAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVTVPKK |
| Ga0180058_10150532 | 3300016699 | Freshwater | MVIAALPVTAPPVVSTMEVLVAVAAVVEAAVKDVTLLEMEDTVPKK |
| Ga0180058_11730902 | 3300016699 | Freshwater | MVIAEVPDAAPEVVRTMVVLVDVAAGVDVAAKDVTLLVMEATVPKK |
| Ga0188834_10006342 | 3300018599 | Freshwater Lake | MVIDEVPDAAPPVVSTMVVLAAVAAGVEVAVKDVTLLLTEDTVPKK |
| Ga0188834_10167862 | 3300018599 | Freshwater Lake | MVIAALPDTAPPVVRTMVVLEDVAAGVEVAVKDVTVLAMEDTDPKK |
| Ga0188884_10109642 | 3300018610 | Freshwater Lake | MVIDEVPDAAPPVVSTMVVLVAVAAGVEVAVKDVTLLLTEDTVPKK |
| Ga0188882_10186272 | 3300018665 | Freshwater Lake | MVIAALPVTAPPVVSTMEVLVAVAAGVEVAVKDVMLLEMEDTVPKK |
| Ga0188871_10109002 | 3300019113 | Freshwater Lake | MVIAAVPDATPPPVVRTMVVLVDVAVPDVAVKDVTVLAMELTDPKK |
| Ga0194134_103622492 | 3300020179 | Freshwater Lake | MVIAEVPDATPPVVRTMVVLEAPAAGLEVAVKLLTVLAMEVTDPKK |
| Ga0194128_105588541 | 3300020197 | Freshwater Lake | MVIAPAPDTAPVVVRTMVVLVPVAAGVEVAAKFVTPLAMED |
| Ga0194128_105588543 | 3300020197 | Freshwater Lake | IAEVPDAAPVVVRTMVVLVPVAAGVEVAAKFVTPLAMEDTVPKK |
| Ga0211731_102005322 | 3300020205 | Freshwater | MVIAEVPDATPPVVRTMLVLEPSAAGLEAAVKLLTVLVMEPTVPKK |
| Ga0211731_102005324 | 3300020205 | Freshwater | MVIAEVPDATPPVVRTMVVLVDVALPEVAVKDGTLLAMELTDPKK |
| Ga0194126_105031944 | 3300020603 | Freshwater Lake | SPVRVMVIAEVPDATPPVVRTMVVLVDVALPEVAVKDGTLLAMEVTDPKK |
| Ga0194130_106729611 | 3300021376 | Freshwater Lake | IAEVPDATPPVVRTMVVLEAPAAGLEVAVKLLTVLAMEVTDPKK |
| Ga0222712_105174411 | 3300021963 | Estuarine Water | EVPDATPPVVRTMVVLEAPAAGLEVAVKLLTVLAMEVTDPKK |
| Ga0222712_105174413 | 3300021963 | Estuarine Water | MVIAEVPDATPPVVRTMVVLVDVALPEVAVKDGTLLAMEVTDPKK |
| Ga0256322_10527762 | 3300024530 | Freshwater | VSPVSVMVIATVPDAAPPVVRTIVVFAEVTLPEVAVNDVTPLAMEVTDPKK |
| Ga0255303_10158843 | 3300024535 | Freshwater | MVIGEMPDTTPPVVSTIMVLKAVAAGVEVAVKDPTVLVMEETDPKK |
| Ga0256342_11101402 | 3300024548 | Freshwater | MIICALPDAAPVVVRTMVVLVLVAAPEVAAKDETVLAMEDTVPTK |
| Ga0255302_10425582 | 3300024551 | Freshwater | MVIAEVPDTAPAVVRTMVVLAAVAAGVEVAVKDVTVLAMEDTVPKK |
| Ga0255302_11074742 | 3300024551 | Freshwater | MVIAAIPVTAPPVVRTMVVLEDVAAGLEVAVKDGTVLAMEDTVPKK |
| Ga0255242_11306372 | 3300024554 | Freshwater | VKVMVIWVIPVPTPPPVVRTMVVLCGVAEPEVAVKEGTVLAMELTDPKK |
| Ga0255237_11541061 | 3300024564 | Freshwater | AVPVATPPPVVRTTVVLAAAAAGAEVAVKDTTLLAMEVTDPKK |
| Ga0255238_11322652 | 3300024568 | Freshwater | CAAPRVNPVRVMVIAAVPDAAPPVVRTMVVLVDVAAGEEVAVKDVTPLAMELTVPKK |
| Ga0256302_11656343 | 3300024571 | Freshwater | CEVPVAAPPVVRTMVVLVAVAAGVEVAVKPLTPLAIDVTDPRK |
| Ga0256302_11661422 | 3300024571 | Freshwater | MVIAEVPDAAPVVVRTMVVLVPVAAGVEVAAKFVTPLAMEDTVPTK |
| Ga0256325_10626201 | 3300026410 | Freshwater | MVIAAVPDAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVT |
| Ga0256325_10626202 | 3300026410 | Freshwater | VIAAVPDAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVTVPKK |
| Ga0255308_10430672 | 3300026422 | Freshwater | MVAAAVPEAAPAVVRTVVLLEDAAGVEVAVKDVTVLAMELTDPKK |
| Ga0255308_10446492 | 3300026422 | Freshwater | VSPVSVMVIAAVPDAAPPVVRTIVVFAEVTLPEVAVNDVTPLAMEVTDPKK |
| Ga0209134_103295241 | 3300027764 | Freshwater Lake | MVIAPAPDTAPVVVRTMVVLVPVAAGVEVAAKFVTPLA |
| Ga0209134_103295243 | 3300027764 | Freshwater Lake | RVMVIAPAPDTAPVVVRTMVVLVPVAAGVEVAAKFVTPLAMEDTVPTK |
| Ga0209229_105296441 | 3300027805 | Freshwater And Sediment | MVIAPAPDTAPVVVRTMVVLVPVAASVEVAAKFVTPLAMEDTVP |
| Ga0256323_10537542 | 3300028077 | Freshwater | MVIAAVPVATPPPVVRTIEVFVAIAGVEVAVRDVTVLAMEVTDPKK |
| Ga0256362_10687451 | 3300028096 | Freshwater | MVIAEVPDTAPAVVRTMVVLVAVAAGVEVAVKDVTVLAMEDTVPKK |
| Ga0256362_10687453 | 3300028096 | Freshwater | VIAEVPDTAPAVVRTMVVLVAVAAGVEVAVKDVTVLAMEDTVPKK |
| Ga0255261_10778642 | 3300028097 | Freshwater | AAVPVATPPPVVRTTVVLAAAAAGAEVAVKDTTLLAMEVTDPKK |
| Ga0255261_10795141 | 3300028097 | Freshwater | AAVPDAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVTVPKK |
| Ga0255261_10795142 | 3300028097 | Freshwater | MVIAAVPDAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVTVP |
| Ga0255234_11559932 | 3300028113 | Freshwater | MVIAAVPDAAPAVVRTIEVFVAIAGVEVAVKDVTVLVMELTDPKK |
| Ga0255226_10554032 | 3300028255 | Freshwater | MVIAPAPDTAPVVVRTMVVLVPVAAGVEVAAKFVTPLATEDTVPTK |
| Ga0255227_10774972 | 3300028266 | Freshwater | MVIAPAPDTAPVVVRTMVVLVPVAAGVEVAAKFVTPLAMEDTVPTK |
| Ga0255233_10963581 | 3300029699 | Freshwater | MVIAEVPDATPPVVSTMVVLVDVALPEVAVKAGTLLALELTDPKK |
| Ga0255233_10963583 | 3300029699 | Freshwater | WVSPVRVMVIAEVPDATPPVVRTMVVLEAPAAGLEVAVKLLTVLAMEVTDPKK |
| Ga0315904_113297881 | 3300031951 | Freshwater | MVIAEMPDSTPLPVVRTMVVLEAPAAALEVAVKLFTVLAMEPTVPKK |
| Ga0315904_113297883 | 3300031951 | Freshwater | VMVIAEVPDSTPLPVVRTMVVLEAPAAALEVAVKLFTVLAMEPTVPKK |
| Ga0315905_115823481 | 3300032092 | Freshwater | MVIAEVPDATPPVVRTMVVLEAPAAGLEVAVKLLTVLAM |
| Ga0334977_0559741_232_372 | 3300033978 | Freshwater | MVIAAVPDAAPPVVRTMLVLEASAAGVEVAVKLFTPLAMEVTVPKK |
| Ga0334979_0517074_277_417 | 3300033996 | Freshwater | MVIAAVPDAAPPVVRTMLVLEAFAAGVEVAVKLFTPLAMEVTVPKK |
| Ga0334979_0684235_274_417 | 3300033996 | Freshwater | MVIAEVPDATPPPVVRTMVVLEAPAAGLEVAVKLLTSLAMEPTVPKK |
| Ga0335021_0632077_225_362 | 3300034023 | Freshwater | MVIAEVPDAAPPVVSTMVVLADVALPEVAVKDVTVLAMELTDPKK |
| Ga0334987_0852211_219_359 | 3300034061 | Freshwater | MVIAAVPDATPPPVVRTMAVLVDVAIPDVAVKDVTVLAMELTDPKK |
| Ga0335068_0561245_231_374 | 3300034116 | Freshwater | MVIAEVPDSTPLPVVRTMVVLEAPAAGLEVAVKLFTVLAMESTVPKK |
| Ga0335016_0596759_185_325 | 3300034166 | Freshwater | MVIAEVPDATPPVVRTMVVLEAPAAGLEVAVKLLTVLAMEPTVPKK |
| Ga0335065_0817396_144_284 | 3300034200 | Freshwater | MVIAEVPDATPPVVRTMVVLEPSAAGLEVAVKLLTVLVMEPTVPKK |
| ⦗Top⦘ |