| Basic Information | |
|---|---|
| Family ID | F064587 |
| Family Type | Metagenome |
| Number of Sequences | 128 |
| Average Sequence Length | 47 residues |
| Representative Sequence | IPLVKNGELRGSISVFDIITYLAECYPKATMNLPPLPAQVMDTVDGG |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.78 % |
| % of genes near scaffold ends (potentially truncated) | 98.44 % |
| % of genes from short scaffolds (< 2000 bps) | 89.84 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.344 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.188 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.781 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.67% β-sheet: 12.00% Coil/Unstructured: 65.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01558 | POR | 64.06 |
| PF01855 | POR_N | 16.41 |
| PF17147 | PFOR_II | 6.25 |
| PF00861 | Ribosomal_L18p | 0.78 |
| PF00182 | Glyco_hydro_19 | 0.78 |
| PF00571 | CBS | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 64.06 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 16.41 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 16.41 |
| COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.78 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.50 % |
| Unclassified | root | N/A | 37.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_62578 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300004114|Ga0062593_102010294 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300004153|Ga0063455_101197728 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300004479|Ga0062595_100421034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300005166|Ga0066674_10462061 | Not Available | 578 | Open in IMG/M |
| 3300005181|Ga0066678_10218164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1224 | Open in IMG/M |
| 3300005438|Ga0070701_10159047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1307 | Open in IMG/M |
| 3300005444|Ga0070694_100845452 | Not Available | 753 | Open in IMG/M |
| 3300005446|Ga0066686_10443098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300005454|Ga0066687_10930243 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005467|Ga0070706_100327027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1430 | Open in IMG/M |
| 3300005471|Ga0070698_100609851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1032 | Open in IMG/M |
| 3300005545|Ga0070695_100424646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1013 | Open in IMG/M |
| 3300005552|Ga0066701_10039797 | All Organisms → cellular organisms → Bacteria | 2515 | Open in IMG/M |
| 3300005552|Ga0066701_10872695 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005553|Ga0066695_10281426 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300005558|Ga0066698_10930470 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005559|Ga0066700_10816932 | Not Available | 626 | Open in IMG/M |
| 3300005569|Ga0066705_10764992 | Not Available | 578 | Open in IMG/M |
| 3300005576|Ga0066708_10215292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1210 | Open in IMG/M |
| 3300005618|Ga0068864_101013727 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005713|Ga0066905_101864421 | Not Available | 556 | Open in IMG/M |
| 3300005842|Ga0068858_100062775 | All Organisms → cellular organisms → Bacteria | 3435 | Open in IMG/M |
| 3300006031|Ga0066651_10739714 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006046|Ga0066652_101430909 | Not Available | 645 | Open in IMG/M |
| 3300006046|Ga0066652_101450170 | Not Available | 639 | Open in IMG/M |
| 3300006791|Ga0066653_10302538 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300006796|Ga0066665_11076503 | Not Available | 613 | Open in IMG/M |
| 3300006796|Ga0066665_11547713 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006797|Ga0066659_11873348 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300006800|Ga0066660_10103612 | Not Available | 2020 | Open in IMG/M |
| 3300007265|Ga0099794_10546706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300009088|Ga0099830_10695467 | Not Available | 837 | Open in IMG/M |
| 3300009088|Ga0099830_10783838 | Not Available | 786 | Open in IMG/M |
| 3300009089|Ga0099828_10238162 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300009089|Ga0099828_10814134 | Not Available | 836 | Open in IMG/M |
| 3300009089|Ga0099828_10958426 | Not Available | 763 | Open in IMG/M |
| 3300009100|Ga0075418_11672711 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300009137|Ga0066709_101367312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
| 3300009162|Ga0075423_10339045 | Not Available | 1576 | Open in IMG/M |
| 3300009174|Ga0105241_12342716 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300009176|Ga0105242_13022534 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010043|Ga0126380_10223791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
| 3300010044|Ga0126310_11813151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300010045|Ga0126311_10467609 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300010047|Ga0126382_10944758 | Not Available | 750 | Open in IMG/M |
| 3300010371|Ga0134125_10570682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1251 | Open in IMG/M |
| 3300010399|Ga0134127_12149625 | Not Available | 637 | Open in IMG/M |
| 3300010400|Ga0134122_11997031 | Not Available | 618 | Open in IMG/M |
| 3300010401|Ga0134121_11309556 | Not Available | 730 | Open in IMG/M |
| 3300010401|Ga0134121_11482084 | Not Available | 693 | Open in IMG/M |
| 3300010403|Ga0134123_11039335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300011196|Ga0137482_101686 | Not Available | 2022 | Open in IMG/M |
| 3300011271|Ga0137393_11530280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300011271|Ga0137393_11785362 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300011431|Ga0137438_1060168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1134 | Open in IMG/M |
| 3300012096|Ga0137389_10118216 | Not Available | 2132 | Open in IMG/M |
| 3300012189|Ga0137388_10483842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1149 | Open in IMG/M |
| 3300012189|Ga0137388_10529609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1095 | Open in IMG/M |
| 3300012200|Ga0137382_11085882 | Not Available | 572 | Open in IMG/M |
| 3300012202|Ga0137363_11251943 | Not Available | 629 | Open in IMG/M |
| 3300012204|Ga0137374_10664445 | Not Available | 787 | Open in IMG/M |
| 3300012206|Ga0137380_11652449 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012208|Ga0137376_10153139 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300012208|Ga0137376_11503096 | Not Available | 564 | Open in IMG/M |
| 3300012209|Ga0137379_10946818 | Not Available | 766 | Open in IMG/M |
| 3300012212|Ga0150985_103461427 | Not Available | 526 | Open in IMG/M |
| 3300012285|Ga0137370_10722143 | Not Available | 619 | Open in IMG/M |
| 3300012359|Ga0137385_10339923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1286 | Open in IMG/M |
| 3300012685|Ga0137397_10889914 | Not Available | 660 | Open in IMG/M |
| 3300012685|Ga0137397_11198290 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012917|Ga0137395_10498154 | Not Available | 877 | Open in IMG/M |
| 3300012917|Ga0137395_10534309 | Not Available | 846 | Open in IMG/M |
| 3300012922|Ga0137394_10093999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2519 | Open in IMG/M |
| 3300012922|Ga0137394_10963671 | Not Available | 710 | Open in IMG/M |
| 3300012930|Ga0137407_10919573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 828 | Open in IMG/M |
| 3300012971|Ga0126369_10556683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1212 | Open in IMG/M |
| 3300012971|Ga0126369_12241343 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300013308|Ga0157375_13237859 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300014487|Ga0182000_10177415 | Not Available | 796 | Open in IMG/M |
| 3300014870|Ga0180080_1094853 | Not Available | 528 | Open in IMG/M |
| 3300015053|Ga0137405_1358800 | All Organisms → cellular organisms → Bacteria | 4240 | Open in IMG/M |
| 3300015069|Ga0167633_101735 | All Organisms → cellular organisms → Bacteria | 5049 | Open in IMG/M |
| 3300015085|Ga0167632_1004942 | Not Available | 1945 | Open in IMG/M |
| 3300015245|Ga0137409_11044827 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300015371|Ga0132258_10820346 | All Organisms → cellular organisms → Bacteria | 2346 | Open in IMG/M |
| 3300015374|Ga0132255_106125323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300018051|Ga0184620_10272167 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300018054|Ga0184621_10247515 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300018059|Ga0184615_10621648 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300018429|Ga0190272_11796754 | Not Available | 639 | Open in IMG/M |
| 3300018431|Ga0066655_10445471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 855 | Open in IMG/M |
| 3300018465|Ga0190269_11044174 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300018920|Ga0190273_12342359 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300019360|Ga0187894_10043592 | Not Available | 2711 | Open in IMG/M |
| 3300020062|Ga0193724_1117839 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300020170|Ga0179594_10183036 | Not Available | 782 | Open in IMG/M |
| 3300021086|Ga0179596_10105986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1285 | Open in IMG/M |
| 3300022534|Ga0224452_1195615 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300022694|Ga0222623_10093824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1166 | Open in IMG/M |
| 3300025901|Ga0207688_10147479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1388 | Open in IMG/M |
| 3300025907|Ga0207645_10859939 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300025911|Ga0207654_11147144 | Not Available | 566 | Open in IMG/M |
| 3300025922|Ga0207646_10779421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300025925|Ga0207650_11870821 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300025930|Ga0207701_10140892 | Not Available | 2141 | Open in IMG/M |
| 3300025931|Ga0207644_10502685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1000 | Open in IMG/M |
| 3300025935|Ga0207709_11198368 | Not Available | 626 | Open in IMG/M |
| 3300025938|Ga0207704_11452514 | Not Available | 588 | Open in IMG/M |
| 3300025981|Ga0207640_10584311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 943 | Open in IMG/M |
| 3300026023|Ga0207677_11391757 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300026335|Ga0209804_1247182 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300026376|Ga0257167_1008089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1349 | Open in IMG/M |
| 3300026481|Ga0257155_1003973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1779 | Open in IMG/M |
| 3300026507|Ga0257165_1087228 | Not Available | 576 | Open in IMG/M |
| 3300026538|Ga0209056_10486276 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300027647|Ga0214468_1181127 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027846|Ga0209180_10222391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1088 | Open in IMG/M |
| 3300027862|Ga0209701_10064428 | All Organisms → cellular organisms → Bacteria | 2330 | Open in IMG/M |
| 3300027875|Ga0209283_10698513 | Not Available | 634 | Open in IMG/M |
| 3300027903|Ga0209488_10099691 | Not Available | 2176 | Open in IMG/M |
| 3300028381|Ga0268264_12014112 | Not Available | 586 | Open in IMG/M |
| 3300031720|Ga0307469_11825610 | Not Available | 588 | Open in IMG/M |
| 3300031720|Ga0307469_12178727 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300031740|Ga0307468_102127811 | Not Available | 541 | Open in IMG/M |
| 3300032342|Ga0315286_10781202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 968 | Open in IMG/M |
| 3300034000|Ga0334918_037834 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300034393|Ga0334914_036315 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.41% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.12% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.34% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.34% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.56% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.78% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011196 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 17 - S13.2.60.2.a - transect 2, repeat 2, age 113 years, surface depth) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015069 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake | Environmental | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300034000 | Biocrust microbial communities from Mojave Desert, California, United States - 14HMC | Environmental | Open in IMG/M |
| 3300034393 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 10HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_00795820 | 2199352025 | Soil | AKSFRNVPRVKNGKLVGSISVFDVISYLAETYPKTTMNLPPIANQVMDSTDGG |
| Ga0062593_1020102941 | 3300004114 | Soil | ERSFRNIPLVKHGDLKGSISVFDIITYLAESYPKTTMNLPPMPAQIMDTVDGG* |
| Ga0063455_1011977282 | 3300004153 | Soil | DGQLIGSISVFDVITYLAESYPKETMNLPPVANQVMDTAEGG* |
| Ga0062595_1004210341 | 3300004479 | Soil | LVKNGELVGSISVFDIITYLAECYPKATMNLPPVPAQVMDTVDGG* |
| Ga0066674_104620611 | 3300005166 | Soil | MNERSFRNIPLVKKGELAGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG* |
| Ga0066678_102181642 | 3300005181 | Soil | HGELVGSISVFDIITYLAESYPQATMNLPPEPAQVMSTVDGG* |
| Ga0070701_101590472 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VDQGLLRGSISVFDIITYLAECYPKTTMNLPPLHQVMGTVDGG* |
| Ga0070694_1008454521 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LVKHGDLKGSISVFDIITYLAESYPKTTMNLPPMPAQIMDTVDGG* |
| Ga0066686_104430982 | 3300005446 | Soil | NEKSFRNIPLVDDGMFVGSISVFDIITYLAECYPKTTMNLPPLSAQVMDTVDGG* |
| Ga0066687_109302431 | 3300005454 | Soil | NIPLVRKGELIGSISVFDIITYLAESYPKTTMNLPPLPAQVMGSVDGG* |
| Ga0070706_1003270271 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | KSFRNIPLVDRGELVGSISVFDIITYLAECYPKATMNLPPLSAQVMDTVDGG* |
| Ga0070698_1006098512 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | EKSFRNIPLVRKGELVGSISVFDIITYLAECYPKETMNLPPLAQVMDTVEGG* |
| Ga0070695_1004246461 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | NNGKLVGSISVFDVISYLAETYPKATMNLPPKTDQIMDSTDGG* |
| Ga0066701_100397971 | 3300005552 | Soil | GSISVFDIITYLAECYPQATMNLPPEPAQVMSTVDGG* |
| Ga0066701_108726952 | 3300005552 | Soil | MNERSFRNIPLVKKGELAGSISVFDIITYLAECYPKATMNLPPLPAQVADSVEGG* |
| Ga0066695_102814262 | 3300005553 | Soil | LMNEKSFRNLPLVKQGELVGSISVFDIITYLAECYPKATMNLPPLAAQVMDTVDGG* |
| Ga0066698_109304702 | 3300005558 | Soil | PIVKNGELRGSISVFDIITYLAECYPKATMNLPPLPAQVMDTVDGG* |
| Ga0066700_108169322 | 3300005559 | Soil | PLVKKGELVGSISVFDIITYLAECYPKATMNLPPLPEQVMDTVDGG* |
| Ga0066705_107649922 | 3300005569 | Soil | SVFDIITYLAECYPKATMNLPPLPAQVMDTVDGG* |
| Ga0066708_102152922 | 3300005576 | Soil | VKKGELIGSISVFDIITYLAECYPKATMNLPPLPAQVMDTVDGG* |
| Ga0068864_1010137271 | 3300005618 | Switchgrass Rhizosphere | GSVSVFDVIGYLAESYPQTTMNLPPNPDQVMDSTEGG* |
| Ga0066905_1018644212 | 3300005713 | Tropical Forest Soil | ISVFDIITYLAESYPKTTMNLPPLPAQVMDTVDGG* |
| Ga0068858_1000627754 | 3300005842 | Switchgrass Rhizosphere | GLLRGSISVFDIITYLAECYPKTTMNLPPLHQVMGTVDGG* |
| Ga0066651_107397141 | 3300006031 | Soil | PLVDDGMFVGSISVFDIITYLAECYPKTTMNLPPLPAQVMDTVDGG* |
| Ga0066652_1014309092 | 3300006046 | Soil | LVDHGLLRGSISVFDIITYLAECYPKTTMNLPPLHQVMGTVDGG* |
| Ga0066652_1014501701 | 3300006046 | Soil | NIPLVQHGDLRGSISVFDIITYLAECYPKTTMNLPPLRQVMDTVDGG* |
| Ga0066653_103025381 | 3300006791 | Soil | NERSFRNIPLVDNGLLRGSISVFDIITYLAECYPKTTMNLPPLHQVMGSVDGG* |
| Ga0066665_110765031 | 3300006796 | Soil | NERSFRNIPLVKKGELAGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG* |
| Ga0066665_115477132 | 3300006796 | Soil | RLMNERSFRNIPLVKEGELAGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG* |
| Ga0066659_118733481 | 3300006797 | Soil | KDGKLVGSISVFDVISYLAESYPKTTMNLPPNPDQVMDSTDGG* |
| Ga0066660_101036122 | 3300006800 | Soil | ELKGSISVFDIITYLAECYPKATMNLPPLPAQVMDTVDGG* |
| Ga0099794_105467061 | 3300007265 | Vadose Zone Soil | RSFRNIPLVKKGELAGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG* |
| Ga0099830_106954672 | 3300009088 | Vadose Zone Soil | VRLMNERSFRNIPLVKNGELRGSISVFDIITYLAECYPKATMNLPPLPAQVMDTVDGG* |
| Ga0099830_107838382 | 3300009088 | Vadose Zone Soil | NERSFRNIPLVKKGELVGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG* |
| Ga0099828_102381622 | 3300009089 | Vadose Zone Soil | GSISVFDIITYLAECYPKATMNLPPLPAQVADSVEGG* |
| Ga0099828_108141341 | 3300009089 | Vadose Zone Soil | IPLVKKGELVGSISVFDIITYLAECYPKATMNLPPLPAQVAGTVDGG* |
| Ga0099828_109584261 | 3300009089 | Vadose Zone Soil | VRLMNESCNLKLPLLKKGELAGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG* |
| Ga0075418_116727111 | 3300009100 | Populus Rhizosphere | VKHGDLKGSISVFDIITYLAESYPKTTMNLPPLPAQIMDTVDGG* |
| Ga0066709_1013673121 | 3300009137 | Grasslands Soil | ISVFDIITYLAECYPKTTMNLPPLHQVMGTVDGG* |
| Ga0075423_103390452 | 3300009162 | Populus Rhizosphere | GDAVRLMNERSFRNIPLEKKGELIGSVSVFDIITYLAECYPKTTMNLPPLPAQVMDTVDGG* |
| Ga0105241_123427162 | 3300009174 | Corn Rhizosphere | LMNDRSFRNIPLVKNGELVGSISVFDIITYLAECYPKATMNLPPVPAQVMDTVDGG* |
| Ga0105242_130225341 | 3300009176 | Miscanthus Rhizosphere | MNERSFRNIPIVDQGLLRGSISVFDIITYLAECYPKTTMNLPPLHQVMGTVDGG* |
| Ga0126380_102237912 | 3300010043 | Tropical Forest Soil | VRLMNERSFRNIPLVKHGDLKGSISVFDIITYLAESYPKTTMNLPPLPAQVMDTVDGG* |
| Ga0126310_118131512 | 3300010044 | Serpentine Soil | GQLIGSISVFDVITYLAESYPKETLNQPPVPAQVMDTPEGG* |
| Ga0126311_104676093 | 3300010045 | Serpentine Soil | YRNIPLVREGQLIGSISVFDVITYLAESYPKETLNQPPVPAQVMDTAEGG* |
| Ga0126382_109447582 | 3300010047 | Tropical Forest Soil | VRLMNERSFRNIPLVKHGDLKGSISVFDIITYLSESYPKTTMNLPPLPEQVMDTVDGG* |
| Ga0134125_105706822 | 3300010371 | Terrestrial Soil | SISVFDIISYLAESYPQTTMNLPPNPDQVMDSTDGG* |
| Ga0134127_121496251 | 3300010399 | Terrestrial Soil | IPIVRKGELVGSISVFDIITYLAECYPKTTMNLPPLPAQVMDTVDGG* |
| Ga0134122_119970311 | 3300010400 | Terrestrial Soil | IPIVKDGELHGSISVFDIITYLAECYPKATMNLPPLPQVMDTTDGG* |
| Ga0134121_113095561 | 3300010401 | Terrestrial Soil | SRNLMVKNGELVGSISVFDIITYLAECYPKTTMNLPPVPAQVMDTVDGG* |
| Ga0134121_114820842 | 3300010401 | Terrestrial Soil | ALFGNIPLVKNGELVGSVSVFDIITYLAECYPKTTMNLPPMPAQIMDTVDGG* |
| Ga0134123_110393353 | 3300010403 | Terrestrial Soil | VKDGKLVGSISVFDVIFYLDESYPKTTMNLPPNPNQIMDSTDGG* |
| Ga0137482_1016861 | 3300011196 | Glacier Forefield Soil | IPLVKKGELVGSISVFDIITYLAECYPKATMNLPPLSAQVMDTVDGG* |
| Ga0137393_115302801 | 3300011271 | Vadose Zone Soil | ELAGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG* |
| Ga0137393_117853621 | 3300011271 | Vadose Zone Soil | SFRNIPLVKEGELAGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG* |
| Ga0137438_10601681 | 3300011431 | Soil | EKSFRNIPLVKDGQLVGSISVFDVIYYLAESYPKETMNLPPIPDQVMTTEDGG* |
| Ga0137389_101182161 | 3300012096 | Vadose Zone Soil | IPLVKKGELAGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG* |
| Ga0137388_104838421 | 3300012189 | Vadose Zone Soil | NIPLVKKGELAGSISVFDIITYLAECYPKATMNLPPLPAQVMDTVDGG* |
| Ga0137388_105296091 | 3300012189 | Vadose Zone Soil | SFRNIPLVKKGELVGSISVFDIITYLAECYPKETMNLPPLPKQVMDTVDGG* |
| Ga0137382_110858821 | 3300012200 | Vadose Zone Soil | GSISVFDIITYLAECYPKTTMNLPPLHQVMGTVDGG* |
| Ga0137363_112519432 | 3300012202 | Vadose Zone Soil | SISVFDIITYLAESYPKETMNLPPPGQVMDTVDGG* |
| Ga0137374_106644451 | 3300012204 | Vadose Zone Soil | NDKGYRNVPLVKNAKLVGSISVFDVIGYLAESYPKTTMNLPPNPDQVMDSTDGG* |
| Ga0137380_116524492 | 3300012206 | Vadose Zone Soil | EMFVGSISVFDIITYLAECYPKTTMNLPPLPAQVMDTVDGG* |
| Ga0137376_101531392 | 3300012208 | Vadose Zone Soil | SISVFDVIRYLAESYPKTTMNLPPNPNQVMDSTDGG* |
| Ga0137376_115030961 | 3300012208 | Vadose Zone Soil | VRLMNEKSFRNIPLVKQGELVGSISVFDIITYLAECYPKETMNLPPLPKQVMDTVDGG* |
| Ga0137379_109468182 | 3300012209 | Vadose Zone Soil | RNIPLVKDEQLVGSISVFDVILYLAESYPKETMNLPPMTDQIMPTEDGG* |
| Ga0150985_1034614271 | 3300012212 | Avena Fatua Rhizosphere | RGSISVFDIITYLAECYPKTTMNLPPLHQVMGTVDGG* |
| Ga0137370_107221431 | 3300012285 | Vadose Zone Soil | RSFRNIPLVVDGQLRGSISVFDIITYLAECYPKSTMNLPPLRQVMDTVDGG* |
| Ga0137385_103399231 | 3300012359 | Vadose Zone Soil | LVGSISVFDIITYLAEFYPQATMNLLPEPAQVMSTVDGG* |
| Ga0137397_108899141 | 3300012685 | Vadose Zone Soil | NIPLVKNGELIVSISVFDIITYLAECYPKETMNLPPLSAQVMDTVDGG* |
| Ga0137397_111982901 | 3300012685 | Vadose Zone Soil | GSISVFDVILYLAESYPKETMNLPPMTNQIMHTEDGG* |
| Ga0137395_104981541 | 3300012917 | Vadose Zone Soil | KNGELIGSISVFDIITYLAECYPKETMNLPPLSAQVMDTVDGG* |
| Ga0137395_105343092 | 3300012917 | Vadose Zone Soil | NEKGFRNVPLVKQGELVGSISVFDIITYLAECYPKETMNLPPLPAQVMDSVDGG* |
| Ga0137394_100939996 | 3300012922 | Vadose Zone Soil | SVFDIITYLAECYPKETMNLPPLSAQVMDTVDGG* |
| Ga0137394_109636712 | 3300012922 | Vadose Zone Soil | SFRNIPLVKEGELVGSISVFDIITYLAECYPKETMNLPPLPAQVMDTVDGG* |
| Ga0137407_109195732 | 3300012930 | Vadose Zone Soil | FRNIPLVKDGQLVGSISVFDVIYYLAESYPKETMNLPPTDQVMVREEGG* |
| Ga0126369_105566831 | 3300012971 | Tropical Forest Soil | KSFRNIPLIKDGQLVGSISVFDVITYLAESYPKATMNLPPVAGRVMDTTEGG* |
| Ga0126369_122413431 | 3300012971 | Tropical Forest Soil | IPIVEHGQLRGSISVFDIITYLAECYPKTTMNLPPLHQVMGTVDGG* |
| Ga0157375_132378592 | 3300013308 | Miscanthus Rhizosphere | GDAVRLMNERSFRNIPLVKHGDLKGSISVFDIITYLAESYPKTTMNLPPMPAQIMDTVDG |
| Ga0182000_101774152 | 3300014487 | Soil | RNIPLIKDDQLIGSISVFDVITYLAESYPKETMNLPPVPAQVMDTPEGG* |
| Ga0180080_10948531 | 3300014870 | Soil | GELVGSISVFDIITYLAECYPKATMNLPPLSAQVMDTVDGG* |
| Ga0137405_13588006 | 3300015053 | Vadose Zone Soil | MGSISVFDVISYLAESYPKTTMNLPPNPDQVMDSTDGGENISDF* |
| Ga0167633_1017354 | 3300015069 | Glacier Forefield Soil | MNEKGFRNIPLVKNGELVGSISVFDIITYLAECYPKETMNLPPLPKQVMDTVDGG* |
| Ga0167632_10049421 | 3300015085 | Glacier Forefield Soil | ERSLRNIPLVVEGQLRGSISVFDIITYLAECYPKATMNLPPLRQVMDTVDGG* |
| Ga0137409_110448272 | 3300015245 | Vadose Zone Soil | ISVFDVIRYLAESYPKTTMNLPPNHNQVMDSTDGG* |
| Ga0132258_108203461 | 3300015371 | Arabidopsis Rhizosphere | FRNVPLVKNGELVGSISVFDIITYLAECYPKNTMNLPPIPQVMDTVDGG* |
| Ga0132255_1061253231 | 3300015374 | Arabidopsis Rhizosphere | VRLMNERSFRNIPLEMKGELIGSISVFDIITYLAECYPKSTMNLPPLPAQVMDTVDGG* |
| Ga0184620_102721671 | 3300018051 | Groundwater Sediment | DGQPVGSISVFDVIMYLAESYPKETMNLPPVVDQVMDTQEGG |
| Ga0184621_102475151 | 3300018054 | Groundwater Sediment | LMNDKSFRNIPLVDRGELVGSISVFDIITYLAECYPKATMNLPPLSAQVMDTVDGG |
| Ga0184615_106216482 | 3300018059 | Groundwater Sediment | PLVKDGKLVGSISVFDVIGYLAESYPKTTMNLPPNPDQVMASTDGG |
| Ga0190272_117967541 | 3300018429 | Soil | DRGFRNIPLVKDGQLAGSISVFDVISYLAESYPKETMNLPPNTDQVMNSTDGG |
| Ga0066655_104454712 | 3300018431 | Grasslands Soil | ISVFDIITYLAECYPKATMNLPPLPAQVADSVEGG |
| Ga0190269_110441742 | 3300018465 | Soil | KLVGSVSVFDVISYLAESYPKTTMNLPPIPAQVMDTTDGG |
| Ga0190273_123423592 | 3300018920 | Soil | LVGSISVFDVITYLAECYPKETMNLPPVPAQVMDTQEGG |
| Ga0187894_100435921 | 3300019360 | Microbial Mat On Rocks | SISVFDIITYLAECYPKATMNLPPLPEQVMDTVDGG |
| Ga0193724_11178391 | 3300020062 | Soil | VGSISVFDVISYLAESYPKATMNLPPSPNQVMDSTDGG |
| Ga0179594_101830362 | 3300020170 | Vadose Zone Soil | LIGSISVFDIITYLAECYPKETMNLPPLSAQVMDTVDGG |
| Ga0179596_101059862 | 3300021086 | Vadose Zone Soil | RLMNEKSFRNIPLVKNGELIGSISVFDIITYLAECYPKETMNLPPLSAQVMDTVDGG |
| Ga0224452_11956151 | 3300022534 | Groundwater Sediment | LVKDGKLVGSISVFDVIRYLAESYPKTTMNLPPNADQVMDSTDGG |
| Ga0222623_100938242 | 3300022694 | Groundwater Sediment | GSISVFDVIRYLAESYPKTTMNLPPNADQVMDSTDGG |
| Ga0207688_101474791 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | RNIPLVKNGELVGSISVFDIITYLAECYPKATMNLPPVPAQVMDTVDGG |
| Ga0207645_108599391 | 3300025907 | Miscanthus Rhizosphere | LVDDGLLRGSISVFDIITYLAECYPKTTMNLPPLHQVMGSVDGG |
| Ga0207654_111471442 | 3300025911 | Corn Rhizosphere | LMNDRSFRNIPLVKNGELVGSISVFDIITYLAECYPKATMNLPPVPAQVMDTVDGG |
| Ga0207646_107794212 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RLMNERSFRNIPLVKKGELAGSISVFDIITYLAECYPKATMNLPPLSARVMDSVDGG |
| Ga0207650_118708211 | 3300025925 | Switchgrass Rhizosphere | GKLVGSVSVFDVIGYLAESYPQTTMNLPPNPDQVMDSTEGG |
| Ga0207701_101408921 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RNIPLVKHGDLKGSISVFDIITYLAESYPKTTMNLPPLPAQIMDTVDGG |
| Ga0207644_105026852 | 3300025931 | Switchgrass Rhizosphere | VGSISVFDVISYLAESYPKTTMNLPPNPDQVMDSTDGG |
| Ga0207709_111983681 | 3300025935 | Miscanthus Rhizosphere | QGLLRGSISVFDIITYLAECYPKTTMNLPPLHQVMGTVDGG |
| Ga0207704_114525142 | 3300025938 | Miscanthus Rhizosphere | MNEKSFRNIPLVKKGELIGSISVFDIIGYLAECYPKATMNLPPLPEQVMDTVDGG |
| Ga0207640_105843112 | 3300025981 | Corn Rhizosphere | LVGSISVFDIITYLAESYPQTTMNLPPNPDQVMESTDGG |
| Ga0207677_113917571 | 3300026023 | Miscanthus Rhizosphere | SISVFDVISYLAESYPQTTMNLPPNPDQVMDSTDGG |
| Ga0209804_12471823 | 3300026335 | Soil | MNEKSFRNIPLVRKGELIGSISVFDIITYLAESYPKTTMNLPPLPAQVMGSVDGG |
| Ga0257167_10080891 | 3300026376 | Soil | VRLMNERSFRNIPLVKKGELAGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG |
| Ga0257155_10039733 | 3300026481 | Soil | ELVGSISVFDIITYLAECYPKETMNLPPLPAQVADTVDGG |
| Ga0257165_10872281 | 3300026507 | Soil | IPLVKKGELAGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG |
| Ga0209056_104862762 | 3300026538 | Soil | GSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG |
| Ga0214468_11811271 | 3300027647 | Soil | ENKLVGSVSVFDIISYLAESYPKATMNLPPNPDQVMDSEEGG |
| Ga0209180_102223911 | 3300027846 | Vadose Zone Soil | NIPLVKKGELAGSISVFDIITYLAECYPKATMNLPPLPAQVADTVDGG |
| Ga0209701_100644281 | 3300027862 | Vadose Zone Soil | IPLVKNGELRGSISVFDIITYLAECYPKATMNLPPLPAQVMDTVDGG |
| Ga0209283_106985132 | 3300027875 | Vadose Zone Soil | AVRLMNERSFRNIPLVKKGDLVGSISVFDIITYLAECYPKATMNLPPLPAQVAGTVDGG |
| Ga0209488_100996912 | 3300027903 | Vadose Zone Soil | KSFRNIPLVKNGELLGSISVFDIITYLAECYPKETMNLPPLPAQVMDTLDGG |
| Ga0268264_120141122 | 3300028381 | Switchgrass Rhizosphere | RLMNERSFRNIPIVDQGLLRGSISVFDIITYLAECYPKTTMNLPPLHQVMGTVDGG |
| Ga0307469_118256102 | 3300031720 | Hardwood Forest Soil | KGELVGSISVFDVITYLAECYPKETMNLPPLSAQVMGSVDGG |
| Ga0307469_121787271 | 3300031720 | Hardwood Forest Soil | LLRGSISVFDIITYLAECYPKTTMNLPPLHQVMGTVDGG |
| Ga0307468_1021278112 | 3300031740 | Hardwood Forest Soil | GELVGSISVFDIITYLAECYPKSTMNLPPLSAKVMDTVDGG |
| Ga0315286_107812022 | 3300032342 | Sediment | LVGSISVFDVITYLAECYPKATMNLPPLSAQVMDTVDGG |
| Ga0334918_037834_539_676 | 3300034000 | Hypolithic Biocrust | LVKDGALVGSISVFDVITYLAESYPKETMNLPPVPAQVMDTAEGG |
| Ga0334914_036315_527_634 | 3300034393 | Sub-Biocrust Soil | ISVFDVITYLAESYPKETMNLPPVPAQVMDTPEGG |
| ⦗Top⦘ |