Basic Information | |
---|---|
Family ID | F063980 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 43 residues |
Representative Sequence | VFAVVLVYVLIMALKLQRLEREVDELAERLPDEDAEEAPRETARVG |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.69 % |
% of genes near scaffold ends (potentially truncated) | 40.31 % |
% of genes from short scaffolds (< 2000 bps) | 87.60 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (55.814 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.302 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.380 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.465 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.89% β-sheet: 0.00% Coil/Unstructured: 58.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF01578 | Cytochrom_C_asm | 51.94 |
PF05201 | GlutR_N | 4.65 |
PF03379 | CcmB | 2.33 |
PF01379 | Porphobil_deam | 0.78 |
PF00005 | ABC_tran | 0.78 |
PF02577 | BFN_dom | 0.78 |
PF01967 | MoaC | 0.78 |
PF02602 | HEM4 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 4.65 |
COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 2.33 |
COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 0.78 |
COG0315 | Molybdenum cofactor biosynthesis enzyme MoaC | Coenzyme transport and metabolism [H] | 0.78 |
COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.78 |
COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.81 % |
Unclassified | root | N/A | 44.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459002|FZY7DQ102JI75H | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
2189573003|GZIR7W402H8J5J | Not Available | 509 | Open in IMG/M |
3300002568|C688J35102_120396530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
3300002568|C688J35102_120699942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1376 | Open in IMG/M |
3300003152|Ga0052254_1060996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
3300004153|Ga0063455_101172314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300004156|Ga0062589_102474845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
3300005167|Ga0066672_10136035 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300005176|Ga0066679_10640185 | Not Available | 693 | Open in IMG/M |
3300005329|Ga0070683_101404890 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300005332|Ga0066388_100712017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1609 | Open in IMG/M |
3300005334|Ga0068869_101513839 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300005338|Ga0068868_100809189 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300005524|Ga0070737_10016384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5418 | Open in IMG/M |
3300005526|Ga0073909_10041408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1632 | Open in IMG/M |
3300005529|Ga0070741_10245554 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
3300005529|Ga0070741_10655415 | Not Available | 931 | Open in IMG/M |
3300005536|Ga0070697_101009124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 740 | Open in IMG/M |
3300005553|Ga0066695_10066583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2170 | Open in IMG/M |
3300005556|Ga0066707_10869738 | Not Available | 554 | Open in IMG/M |
3300005614|Ga0068856_100880365 | Not Available | 914 | Open in IMG/M |
3300005764|Ga0066903_100042389 | All Organisms → cellular organisms → Bacteria | 5394 | Open in IMG/M |
3300005764|Ga0066903_100233039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2811 | Open in IMG/M |
3300005764|Ga0066903_103427897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 855 | Open in IMG/M |
3300005764|Ga0066903_104109689 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300005764|Ga0066903_108712559 | Not Available | 516 | Open in IMG/M |
3300005885|Ga0075284_1063998 | Not Available | 534 | Open in IMG/M |
3300005893|Ga0075278_1043872 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300005900|Ga0075272_1097416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 564 | Open in IMG/M |
3300006034|Ga0066656_11059490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 521 | Open in IMG/M |
3300006173|Ga0070716_101543992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300006173|Ga0070716_101575815 | Not Available | 539 | Open in IMG/M |
3300006175|Ga0070712_100235647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1456 | Open in IMG/M |
3300006580|Ga0074049_12436178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300006606|Ga0074062_12134437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 702 | Open in IMG/M |
3300006794|Ga0066658_10113158 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300006794|Ga0066658_10221819 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300006804|Ga0079221_11147700 | Not Available | 599 | Open in IMG/M |
3300006806|Ga0079220_11713502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 550 | Open in IMG/M |
3300006893|Ga0073928_10303434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1198 | Open in IMG/M |
3300009012|Ga0066710_100276843 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
3300009137|Ga0066709_101499816 | Not Available | 973 | Open in IMG/M |
3300009137|Ga0066709_101631352 | Not Available | 921 | Open in IMG/M |
3300009792|Ga0126374_11549796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
3300010048|Ga0126373_10935582 | Not Available | 931 | Open in IMG/M |
3300010048|Ga0126373_13304730 | Not Available | 502 | Open in IMG/M |
3300010152|Ga0126318_10831330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
3300010154|Ga0127503_10691039 | All Organisms → cellular organisms → Bacteria | 2774 | Open in IMG/M |
3300010154|Ga0127503_11135456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
3300010335|Ga0134063_10656900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
3300010358|Ga0126370_10054201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2567 | Open in IMG/M |
3300010360|Ga0126372_12456071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300010362|Ga0126377_10667216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1090 | Open in IMG/M |
3300010366|Ga0126379_12053488 | Not Available | 674 | Open in IMG/M |
3300010366|Ga0126379_13761258 | Not Available | 508 | Open in IMG/M |
3300010371|Ga0134125_10252262 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
3300010373|Ga0134128_12731374 | Not Available | 544 | Open in IMG/M |
3300010375|Ga0105239_11917728 | Not Available | 687 | Open in IMG/M |
3300010376|Ga0126381_101524276 | Not Available | 966 | Open in IMG/M |
3300010376|Ga0126381_103888237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
3300010396|Ga0134126_11186803 | Not Available | 848 | Open in IMG/M |
3300010398|Ga0126383_13378005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
3300010399|Ga0134127_10556444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1169 | Open in IMG/M |
3300010401|Ga0134121_11772543 | Not Available | 643 | Open in IMG/M |
3300012199|Ga0137383_10225517 | Not Available | 1374 | Open in IMG/M |
3300012207|Ga0137381_10836225 | Not Available | 797 | Open in IMG/M |
3300012210|Ga0137378_10734449 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300012211|Ga0137377_10438637 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300012683|Ga0137398_10401576 | Not Available | 933 | Open in IMG/M |
3300012951|Ga0164300_10349383 | Not Available | 793 | Open in IMG/M |
3300012955|Ga0164298_10363288 | Not Available | 922 | Open in IMG/M |
3300012955|Ga0164298_11516763 | Not Available | 524 | Open in IMG/M |
3300012957|Ga0164303_10039086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2019 | Open in IMG/M |
3300012961|Ga0164302_10011799 | All Organisms → cellular organisms → Bacteria | 3473 | Open in IMG/M |
3300012977|Ga0134087_10160202 | Not Available | 985 | Open in IMG/M |
3300012985|Ga0164308_10304418 | Not Available | 1267 | Open in IMG/M |
3300012989|Ga0164305_11258895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300013501|Ga0120154_1146792 | Not Available | 532 | Open in IMG/M |
3300015373|Ga0132257_104118489 | Not Available | 529 | Open in IMG/M |
3300016319|Ga0182033_11220664 | Not Available | 674 | Open in IMG/M |
3300016371|Ga0182034_12025070 | Not Available | 509 | Open in IMG/M |
3300017959|Ga0187779_10020578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3760 | Open in IMG/M |
3300017959|Ga0187779_10085214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1886 | Open in IMG/M |
3300017959|Ga0187779_10437654 | Not Available | 858 | Open in IMG/M |
3300017974|Ga0187777_10664037 | Not Available | 738 | Open in IMG/M |
3300017994|Ga0187822_10048481 | Not Available | 1188 | Open in IMG/M |
3300018060|Ga0187765_10283922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 987 | Open in IMG/M |
3300018433|Ga0066667_12094454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
3300018468|Ga0066662_10589115 | Not Available | 1038 | Open in IMG/M |
3300018482|Ga0066669_10947693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
3300019888|Ga0193751_1003343 | All Organisms → cellular organisms → Bacteria | 9452 | Open in IMG/M |
3300020081|Ga0206354_10043385 | Not Available | 589 | Open in IMG/M |
3300020082|Ga0206353_10721178 | Not Available | 654 | Open in IMG/M |
3300021560|Ga0126371_10836795 | Not Available | 1066 | Open in IMG/M |
3300025780|Ga0210100_1013495 | Not Available | 986 | Open in IMG/M |
3300025916|Ga0207663_10350695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1117 | Open in IMG/M |
3300025929|Ga0207664_10654740 | Not Available | 944 | Open in IMG/M |
3300025939|Ga0207665_11140428 | Not Available | 622 | Open in IMG/M |
3300025949|Ga0207667_11207358 | Not Available | 736 | Open in IMG/M |
3300025998|Ga0208651_1026540 | Not Available | 516 | Open in IMG/M |
3300026023|Ga0207677_11233140 | Not Available | 685 | Open in IMG/M |
3300026300|Ga0209027_1043645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1687 | Open in IMG/M |
3300026325|Ga0209152_10124420 | Not Available | 981 | Open in IMG/M |
3300027706|Ga0209581_1013654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4774 | Open in IMG/M |
3300027773|Ga0209810_1003594 | All Organisms → cellular organisms → Bacteria | 16045 | Open in IMG/M |
3300027821|Ga0209811_10010189 | All Organisms → cellular organisms → Bacteria | 3015 | Open in IMG/M |
3300027874|Ga0209465_10527487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
3300028589|Ga0247818_11227967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
3300031170|Ga0307498_10419452 | Not Available | 530 | Open in IMG/M |
3300031184|Ga0307499_10278340 | Not Available | 544 | Open in IMG/M |
3300031251|Ga0265327_10082946 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
3300031474|Ga0170818_108221777 | Not Available | 1055 | Open in IMG/M |
3300031543|Ga0318516_10633025 | Not Available | 610 | Open in IMG/M |
3300031640|Ga0318555_10245835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 966 | Open in IMG/M |
3300031668|Ga0318542_10327536 | Not Available | 786 | Open in IMG/M |
3300031713|Ga0318496_10531745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
3300031781|Ga0318547_10265704 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300031820|Ga0307473_11335401 | Not Available | 538 | Open in IMG/M |
3300031938|Ga0308175_102141593 | Not Available | 627 | Open in IMG/M |
3300031939|Ga0308174_10156273 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
3300031996|Ga0308176_10558321 | Not Available | 1171 | Open in IMG/M |
3300032261|Ga0306920_102659513 | Not Available | 685 | Open in IMG/M |
3300032770|Ga0335085_10751874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1078 | Open in IMG/M |
3300032782|Ga0335082_10035068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5303 | Open in IMG/M |
3300033158|Ga0335077_10300429 | Not Available | 1757 | Open in IMG/M |
3300033158|Ga0335077_10522947 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300033550|Ga0247829_11196841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
3300033759|Ga0314869_014218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.20% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.43% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.43% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.65% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.10% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.10% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.88% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.33% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.55% |
Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.78% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.78% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.78% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.78% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025780 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025998 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033759 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_B | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E1_05218180 | 2170459002 | Grass Soil | MALKLQRLEREVDELADRVPNEDAEESPREPARVG |
FE2_02067110 | 2189573003 | Grass Soil | VVFAVVLAYVLIMALKLQRLEREVDELASRASADEAEEEAPRETASVG |
C688J35102_1203965303 | 3300002568 | Soil | LVYVLIMALKLQRLEREVDELAGRVSDEDAEEVPQEAARVG* |
C688J35102_1206999423 | 3300002568 | Soil | VFAVVLAYVLIMALKLQRLERDVDELARSAPEEDAEEAPRETTHVG* |
Ga0052254_10609962 | 3300003152 | Sediment | VFALILVYVLIMALKLQRLERDVDELAARAPADDVDEEEARRETASVG* |
Ga0063455_1011723142 | 3300004153 | Soil | VFAVVLAYVLIMALKLQRLERDVDELARRAPEEDAEEAPRETTHVG* |
Ga0062589_1024748452 | 3300004156 | Soil | VFAVVLVYVLIMALKLQRLEREVDELAERLPDEDAEEAPRETARVG* |
Ga0066672_101360353 | 3300005167 | Soil | VFAVVLAYVLIMALKLQRLERDVDELARRAPEENAQEAPRETTHVG* |
Ga0066679_106401851 | 3300005176 | Soil | VFAVVLAYVLIMALKLQRLEREVDDLAERVPAEDAGSEEAPRETVRVG* |
Ga0070683_1014048902 | 3300005329 | Corn Rhizosphere | VFAVVLVYVLIMALKVQRLEREVDELAERLPDEDAEEAPRETARVG* |
Ga0066388_1007120173 | 3300005332 | Tropical Forest Soil | VFAALLVYLVIMALKLQRLEREVDEITGRLPDEDAEEETREPARVG* |
Ga0068869_1015138392 | 3300005334 | Miscanthus Rhizosphere | VFAVVLVYVLIMALKVQRLEREVDELAGRVPDEDAAEAPQEPARVG* |
Ga0068868_1008091892 | 3300005338 | Miscanthus Rhizosphere | VFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEEATRETARVG* |
Ga0070737_100163846 | 3300005524 | Surface Soil | VLAYVVIMALKLRRLEREVDELAARSSREADEEAAPQEPAAVG* |
Ga0073909_100414082 | 3300005526 | Surface Soil | VFAVVLVYVLIMALKVQRLEREVDELAERVPDGDAEEAPRETARVG* |
Ga0070741_102455543 | 3300005529 | Surface Soil | VLIALKLQRLGREVDELAGRAAAGQPSQPEEDGRREPAAVG* |
Ga0070741_106554152 | 3300005529 | Surface Soil | ALKLQRLEREVDELAGRVPDEDAEEAPREPARVG* |
Ga0070697_1010091242 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAVVLAYVLIMALKLQRLEREVDDLADRVPAEDAQEEVP |
Ga0066695_100665832 | 3300005553 | Soil | VFAVVLVYLLIMALKLQRLEREVDELAARVPDEEAAEALREEARVG* |
Ga0066707_108697381 | 3300005556 | Soil | VVLVYLLIMALKLQRLEREVDELAARVPDEEAAEALREEARVG* |
Ga0068856_1008803652 | 3300005614 | Corn Rhizosphere | VLVYVLILSLKLQRLEREVDELAGRVPDEDAAEAPQEPARVG* |
Ga0066903_1000423898 | 3300005764 | Tropical Forest Soil | YVLIMALKLQRLEREVDQLADRVPQESDEEGAPRETAAVG* |
Ga0066903_1002330394 | 3300005764 | Tropical Forest Soil | VVFGVILVYVVIMALKLQRLERDVDELARRVPAEDAEDAPRETAAVG* |
Ga0066903_1034278972 | 3300005764 | Tropical Forest Soil | VFVAVLVYLLIMALKLQRLEREVGELEARVPDEDADEASREPARVG* |
Ga0066903_1041096891 | 3300005764 | Tropical Forest Soil | VVLVYLLIMALKLQRLEREVDELAGRVPDEDAEEAPREPARVG* |
Ga0066903_1087125591 | 3300005764 | Tropical Forest Soil | YVLIMALKLQRLEREVDELAGRVPAEDEEEAPREPASVG* |
Ga0075284_10639981 | 3300005885 | Rice Paddy Soil | YVLIMALKLQRLEREVDELAGRAPTDDVEEAPREPARVG* |
Ga0075278_10438721 | 3300005893 | Rice Paddy Soil | ALVLAYVLIMALKLRRLERDVDELARLVPDEDAEGAPRETAQVG* |
Ga0075272_10974161 | 3300005900 | Rice Paddy Soil | VFAGVLVYVLIMALKLQRLEREVDELAGRAPTDDVEEAPRE |
Ga0066656_110594902 | 3300006034 | Soil | VFAVVLAYVLIMALKLQRLERDVDELARRAPEEDAEEAPRETTRVG* |
Ga0070716_1015439922 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAVVLAYVLIMALKLQRLEREVDDLADRVPAEDAQEEVPRERASVG* |
Ga0070716_1015758152 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LIMALKLQRLEREVDELAGRVPEEDAESEQASREPARVG* |
Ga0070712_1002356472 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAVVLVYVLIMALKLQRLEREVDELAERVPAEDAEPEEAPREAARVG* |
Ga0074049_124361782 | 3300006580 | Soil | VVFAVVLVYVLIMALKLQRLERDVEELAARVPDEDAEETPQEPARVG* |
Ga0074062_121344371 | 3300006606 | Soil | VFAIVLVYVLIMALKLQRLEREVDELAERVPAEDAEPEEAPREAARVG* |
Ga0066658_101131581 | 3300006794 | Soil | VLVYVLIMALKLQRLEREVDELASRMPAEDPEEAPREPARVG* |
Ga0066658_102218192 | 3300006794 | Soil | VFAVVLAYVLIMALKVQRLEREVDEIAARVAEDDAEEAPRETAHVG* |
Ga0079221_111477002 | 3300006804 | Agricultural Soil | YVLIMALKLQRLEREVDELAERVPAEDDAEETQREPARVG* |
Ga0079220_117135021 | 3300006806 | Agricultural Soil | VFAVVLAYVLIMALKLQRLERDVDELARRAPEEDAEEAPRETARVG* |
Ga0073928_103034341 | 3300006893 | Iron-Sulfur Acid Spring | VFAVVLAYVLIMGLKLQRLERDVDDLVGRVPDEDAEEA |
Ga0066710_1002768431 | 3300009012 | Grasslands Soil | LIMALKLQRLEREVDELAARVPDEEAAEALREEARVG |
Ga0066709_1014998162 | 3300009137 | Grasslands Soil | VFAVVLAYVLIMALKLQRLEREVDELAARVPDEEAAEALREEARVG* |
Ga0066709_1016313521 | 3300009137 | Grasslands Soil | MALKLQRLEREVDELAARVPDEEAAEALREEARVG* |
Ga0126374_115497962 | 3300009792 | Tropical Forest Soil | VFAGVLVYLLIMALKLQRLEREVDELEARVPDEDADEASREPARVG* |
Ga0126373_109355822 | 3300010048 | Tropical Forest Soil | MALKLQRLEREVDDLAARAPETDAEETPREPAPVG* |
Ga0126373_133047301 | 3300010048 | Tropical Forest Soil | LKVQRLEREVDDLAERLPDEDAEEEAPRETARVG* |
Ga0126318_108313302 | 3300010152 | Soil | VFAVVLAYVLIMALKLQRLERDVEELARRVPEEDAEEAPRETAHVG* |
Ga0127503_106910392 | 3300010154 | Soil | MALKLQRLEREVDELAERVPADDAEEEETSREPARVG* |
Ga0127503_111354562 | 3300010154 | Soil | VFAVVLVYVLIMALKLQRLEREVDELAERLPVEDAESEEAPREAARVG* |
Ga0134063_106569002 | 3300010335 | Grasslands Soil | VFAVVLVYLLIMALKLQRLEREVDELAARVPDEHAAEALREEARVG* |
Ga0126370_100542012 | 3300010358 | Tropical Forest Soil | VFAALLVYLVIMALKLQRLEREVNELAGRVPDEQAEEAPREPARVG* |
Ga0126372_124560712 | 3300010360 | Tropical Forest Soil | VFAALLVYLLIMALKLQRLEREVDDLAGRVPDEDAEETPREPARVG* |
Ga0126377_106672162 | 3300010362 | Tropical Forest Soil | VLVYLLIMALKLQRLEREVDELEARVPEDADEAPREPARVG* |
Ga0126379_120534882 | 3300010366 | Tropical Forest Soil | VFAVVLVYVLIMALKLQRLEREVDQLADRVPHEVDEEDAPRETAAVG* |
Ga0126379_137612582 | 3300010366 | Tropical Forest Soil | MALKLQRLEREVDEIAGRVPAEDAEEAPREPARVG* |
Ga0134125_102522624 | 3300010371 | Terrestrial Soil | VFAVVLVYVLIMALKVQRLQREVDELAERVPDEDAEEATRETARVG* |
Ga0134128_127313741 | 3300010373 | Terrestrial Soil | YLLIMALKLQRLEHEVDALAGRMPADDAGEEEAPREPARVG* |
Ga0105239_119177282 | 3300010375 | Corn Rhizosphere | VFAVVLAYVLIMALKLQRLERDVDELARRAPEEDAEEAPRE |
Ga0126381_1015242762 | 3300010376 | Tropical Forest Soil | MALKLQRLEREVDELAGRAPAEDEEEAPREPASVG* |
Ga0126381_1038882372 | 3300010376 | Tropical Forest Soil | VFAVVLAYVLIMALKLQRLERDVDELAGRVPDEDAEE |
Ga0134126_111868032 | 3300010396 | Terrestrial Soil | VFAVVLVYLLIMALKLQRLEHEVDALAGRMPADDAGEEEAPREPARVG* |
Ga0126383_133780052 | 3300010398 | Tropical Forest Soil | VFAVVLVYVLIMALKLQRLEREVDQLADRVPQESDEEGAPRETAAVG* |
Ga0134127_105564442 | 3300010399 | Terrestrial Soil | VFAVVLVYVLIMALKVQRLEREVDELAERLPDDDAEEAPRETARVG* |
Ga0134121_117725432 | 3300010401 | Terrestrial Soil | LKLHRLEREVDELADRVPAEDDAEETPRETARVG* |
Ga0137383_102255172 | 3300012199 | Vadose Zone Soil | VFAVVLVYVLIMALKLQRLEREVDELAERVPAEDADSEEAPRERASVG* |
Ga0137381_108362252 | 3300012207 | Vadose Zone Soil | VFAAVLVYVLIMALKLQRLEREVDELAERVPAEDADSEEAPLETARVG* |
Ga0137378_107344493 | 3300012210 | Vadose Zone Soil | VFAVVLAYVLIMALKLQRLERDVDALARRAPEEDAEEAPRET |
Ga0137377_104386372 | 3300012211 | Vadose Zone Soil | VVFAVVLAYVLIMALKLQRLEREVDEIARRGNEEDAREEAPRERAGVG* |
Ga0137398_104015762 | 3300012683 | Vadose Zone Soil | VVFAVVLVYLLIMALKLQRLEREVDQLVARVPDEDAEEALREEAHVG* |
Ga0164300_103493832 | 3300012951 | Soil | VFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEEAARETARVG* |
Ga0164298_103632882 | 3300012955 | Soil | VFAVVLVYVLIMALQVQRLEREVDELAERLPDEDAEEALRETARVG* |
Ga0164298_115167631 | 3300012955 | Soil | VFAVVLVYVLIMALKVQRLEREVDELAERLPSEDAESEEAPREAARVG |
Ga0164303_100390863 | 3300012957 | Soil | VFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEEAPRETARVG* |
Ga0164302_100117992 | 3300012961 | Soil | VFAVVLVYVLIMALKLQRLEREVDELAERVPDVDAEEVPREPARVG* |
Ga0134087_101602022 | 3300012977 | Grasslands Soil | VFAVLLLYVLIMALKLQRLEREVDELAGGAAEAGAAEESREPARVG* |
Ga0164308_103044182 | 3300012985 | Soil | VFAVVLVYVLIMALKVQRLEREVDELAERLPDEDAEEALRETARVG* |
Ga0164305_112588952 | 3300012989 | Soil | VFAGVLVYVLIMALKLQRLEREVDELAERLPSEDAESEEAPREAARVG* |
Ga0120154_11467921 | 3300013501 | Permafrost | VFAVVLAYVLIMALKLQRLEREVDDLAGRVPAEGAEEAP |
Ga0132257_1041184891 | 3300015373 | Arabidopsis Rhizosphere | YCVVFAVVLVYVLIMALKLHRLEREVDELADRVPAEDDAEETPRETARVG* |
Ga0182033_112206642 | 3300016319 | Soil | MALKLQRLEREVDELAARVPEEDAEEETREPARVG |
Ga0182034_120250702 | 3300016371 | Soil | VFAALLVYVLIMALKLQRLEREVDEIASRLPDEEAEEVPREPARVG |
Ga0187779_100205782 | 3300017959 | Tropical Peatland | VFALVLVYVLIMALKLQRLERDVDALAARAPADDVDHEEAARREPARVG |
Ga0187779_100852141 | 3300017959 | Tropical Peatland | MALKLQRLEREVDELAGRMPPEDAEEEEAPREPARVG |
Ga0187779_104376542 | 3300017959 | Tropical Peatland | AVVLAYVLIMALKLQRLEREVDELAERVPDEDTEEAPREAARVG |
Ga0187777_106640371 | 3300017974 | Tropical Peatland | MALKLQRLEREVDELAERAAEVPEEEGRREPAAVG |
Ga0187822_100484812 | 3300017994 | Freshwater Sediment | VFAVVLAYVLIMALKLQRLERDVDELAARVPGTDEEEAPREPAAVG |
Ga0187765_102839222 | 3300018060 | Tropical Peatland | ALVLVYVLIMALKLQRLERDVDALAARAPADDVDHEEAARREPARVG |
Ga0066667_120944542 | 3300018433 | Grasslands Soil | VFAVVLAYVLIMALKLQRLERDVDELARRAPEEDAEEAPRETTHVG |
Ga0066662_105891152 | 3300018468 | Grasslands Soil | MLRLVLVYVLIMALKLQRLERDVDELAARAPEDDTEETPREPVRVG |
Ga0066669_109476931 | 3300018482 | Grasslands Soil | VFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEVAPRET |
Ga0193751_10033435 | 3300019888 | Soil | VFAVVLAYVLIMALKLQRLEREVDELAARAPAEDEEEAPREPARVG |
Ga0206354_100433851 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | AYVLIMALKLQRLERDVDELARRAPEEDAEEAPRETTHVG |
Ga0206353_107211782 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAVVLVYVLIMALKVQRLEREVDELAERLPDEDAEEAPRETARVG |
Ga0126371_108367952 | 3300021560 | Tropical Forest Soil | MALKLQRLEREVDELSGRAPAKDEEEAPREPASVG |
Ga0210100_10134951 | 3300025780 | Natural And Restored Wetlands | MALKLQRLEREVDELAGRAPADDAEDTPREPARVG |
Ga0207663_103506953 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | YVVIIALKLQRLEREVDELAVRRDADEATDREPAQVG |
Ga0207664_106547401 | 3300025929 | Agricultural Soil | LLIMGLKLQRLEREVDELAGRVPEEDAESEQASREPARVG |
Ga0207665_111404282 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAVVLAYVLIMALKLQRLEREVDDLADRVPAEDAQEEVPRERASVG |
Ga0207667_112073581 | 3300025949 | Corn Rhizosphere | VLIMALKVQRLEREVDELAERLPDEDAEEAPRETARVG |
Ga0207640_108290041 | 3300025981 | Corn Rhizosphere | IIALKLQRLEREVAELADRSEQDATEPGREPAQVG |
Ga0208651_10265401 | 3300025998 | Rice Paddy Soil | AYVLILALKLQRLERDVDELVGRVPDEDAEEAPQEPARVG |
Ga0207677_112331402 | 3300026023 | Miscanthus Rhizosphere | VFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEEATRETARVG |
Ga0209027_10436452 | 3300026300 | Grasslands Soil | VFAVVLVYLLIMALKLQRLEREVDELAARVPDEEAAEALREEARVG |
Ga0209152_101244202 | 3300026325 | Soil | VFAVVLAYVLIMALKVQRLEREVDEIAARVAEDDAEEAPRETAHVG |
Ga0209581_10136543 | 3300027706 | Surface Soil | VLAYVVIMALKLRRLEREVDELAARSSREADEEAAPQEPAAVG |
Ga0209810_100359421 | 3300027773 | Surface Soil | VIIALKLQRLEREVDELAGRAPAAEEEAPREPAAVG |
Ga0209811_100101892 | 3300027821 | Surface Soil | VFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEEAPRETARVG |
Ga0209465_105274872 | 3300027874 | Tropical Forest Soil | VTAAYCVVFAGVLVYLLIMALKLQRLEREVDELEARVPDEDADEAS |
Ga0247818_112279671 | 3300028589 | Soil | VFAVVLVYVVIMALKLQRLEREVDELAERVPDEDAEEVPRE |
Ga0307498_104194522 | 3300031170 | Soil | VVFAVLLVYLLIMALKLQRLEREVDELADRVPDEDAEESPREAARVG |
Ga0307499_102783402 | 3300031184 | Soil | MALKVQRLEREVDELAERVPDEDAEEAPRETARVG |
Ga0265327_100829461 | 3300031251 | Rhizosphere | IIALKLQRLEREVDELAGRAATREEEPEESREAAVVG |
Ga0170818_1082217772 | 3300031474 | Forest Soil | VLAYVLIMALKLQRLEREVDELASRASADEAEEEAPRETASVG |
Ga0318516_106330251 | 3300031543 | Soil | LIMALKLQRLEREVDEIAGRVPDEDAQEAPREPARVG |
Ga0318555_102458351 | 3300031640 | Soil | VFAVVLAYVLIMALKLQRLERDVDELAGRVPDEDAEEA |
Ga0318542_103275362 | 3300031668 | Soil | VFAALLVYVLIMALKLQRLEREVDEIAGRVPDEDAQEAPREPARVG |
Ga0318496_105317452 | 3300031713 | Soil | VFAALLVYVLIMALKLQRLEREVDEIAGRLPDEDAEEAPREPARVG |
Ga0318547_102657042 | 3300031781 | Soil | VFAVVLAYVLIMALKLQRLERDEDAEEAPREPARVG |
Ga0307473_113354011 | 3300031820 | Hardwood Forest Soil | MALKLQRLEREVDELAERLPSDDAEPEEAPREAARVG |
Ga0308175_1021415931 | 3300031938 | Soil | VFAVVLVYVLIMALKVQRLARGGDELAGRVAEETEE |
Ga0308174_101562734 | 3300031939 | Soil | LIMALKLQRLERDVDDLAARVPDEDADEETREPARIG |
Ga0308176_105583212 | 3300031996 | Soil | VFAVVLVYVLIMALKMQRLEREVDELAERVPDEDAEETPRETTRVG |
Ga0306920_1026595131 | 3300032261 | Soil | AVVLVYVLIMALKLQRLEREVDELAERAAEAPEEEGRREPAAVG |
Ga0335085_107518743 | 3300032770 | Soil | VFALVLAYVLIMALKLQRLERDVDELAARAPADGVDEEEARRETA |
Ga0335082_100350682 | 3300032782 | Soil | VFALVLAYVLIMALKLQRLERDVDELAARAPADGVDEEDARRETASVG |
Ga0335077_103004294 | 3300033158 | Soil | VFALVLAYVLIMALKLQRLERDVDELAARAPADGVDEEDARRE |
Ga0335077_105229472 | 3300033158 | Soil | MALKLQRLERDVDELAARAPTDEAEEEEAPREAARVG |
Ga0247829_111968411 | 3300033550 | Soil | VFAVVLVYVLIMALKVQRLEREVDELAERLPDEDAEEA |
Ga0314869_014218_197_343 | 3300033759 | Peatland | VFALVLAYVLIMALKLQRLERDVDELAARAPADDVDEEEARRETASVG |
⦗Top⦘ |