NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063980

Metagenome / Metatranscriptome Family F063980

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063980
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 43 residues
Representative Sequence VFAVVLVYVLIMALKLQRLEREVDELAERLPDEDAEEAPRETARVG
Number of Associated Samples 112
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.69 %
% of genes near scaffold ends (potentially truncated) 40.31 %
% of genes from short scaffolds (< 2000 bps) 87.60 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (55.814 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(9.302 % of family members)
Environment Ontology (ENVO) Unclassified
(19.380 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(60.465 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.89%    β-sheet: 0.00%    Coil/Unstructured: 58.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF01578Cytochrom_C_asm 51.94
PF05201GlutR_N 4.65
PF03379CcmB 2.33
PF01379Porphobil_deam 0.78
PF00005ABC_tran 0.78
PF02577BFN_dom 0.78
PF01967MoaC 0.78
PF02602HEM4 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0373Glutamyl-tRNA reductaseCoenzyme transport and metabolism [H] 4.65
COG2386ABC-type transport system involved in cytochrome c biogenesis, permease componentPosttranslational modification, protein turnover, chaperones [O] 2.33
COG0181Porphobilinogen deaminaseCoenzyme transport and metabolism [H] 0.78
COG0315Molybdenum cofactor biosynthesis enzyme MoaCCoenzyme transport and metabolism [H] 0.78
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 0.78
COG1587Uroporphyrinogen-III synthaseCoenzyme transport and metabolism [H] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.81 %
UnclassifiedrootN/A44.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459002|FZY7DQ102JI75HAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
2189573003|GZIR7W402H8J5JNot Available509Open in IMG/M
3300002568|C688J35102_120396530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1038Open in IMG/M
3300002568|C688J35102_120699942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1376Open in IMG/M
3300003152|Ga0052254_1060996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300004153|Ga0063455_101172314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300004156|Ga0062589_102474845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300005167|Ga0066672_10136035All Organisms → cellular organisms → Bacteria1531Open in IMG/M
3300005176|Ga0066679_10640185Not Available693Open in IMG/M
3300005329|Ga0070683_101404890All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300005332|Ga0066388_100712017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1609Open in IMG/M
3300005334|Ga0068869_101513839All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005338|Ga0068868_100809189All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300005524|Ga0070737_10016384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5418Open in IMG/M
3300005526|Ga0073909_10041408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1632Open in IMG/M
3300005529|Ga0070741_10245554All Organisms → cellular organisms → Bacteria1708Open in IMG/M
3300005529|Ga0070741_10655415Not Available931Open in IMG/M
3300005536|Ga0070697_101009124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia740Open in IMG/M
3300005553|Ga0066695_10066583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2170Open in IMG/M
3300005556|Ga0066707_10869738Not Available554Open in IMG/M
3300005614|Ga0068856_100880365Not Available914Open in IMG/M
3300005764|Ga0066903_100042389All Organisms → cellular organisms → Bacteria5394Open in IMG/M
3300005764|Ga0066903_100233039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2811Open in IMG/M
3300005764|Ga0066903_103427897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria855Open in IMG/M
3300005764|Ga0066903_104109689All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300005764|Ga0066903_108712559Not Available516Open in IMG/M
3300005885|Ga0075284_1063998Not Available534Open in IMG/M
3300005893|Ga0075278_1043872All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005900|Ga0075272_1097416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia564Open in IMG/M
3300006034|Ga0066656_11059490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia521Open in IMG/M
3300006173|Ga0070716_101543992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300006173|Ga0070716_101575815Not Available539Open in IMG/M
3300006175|Ga0070712_100235647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1456Open in IMG/M
3300006580|Ga0074049_12436178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300006606|Ga0074062_12134437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia702Open in IMG/M
3300006794|Ga0066658_10113158All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300006794|Ga0066658_10221819All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300006804|Ga0079221_11147700Not Available599Open in IMG/M
3300006806|Ga0079220_11713502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia550Open in IMG/M
3300006893|Ga0073928_10303434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1198Open in IMG/M
3300009012|Ga0066710_100276843All Organisms → cellular organisms → Bacteria2443Open in IMG/M
3300009137|Ga0066709_101499816Not Available973Open in IMG/M
3300009137|Ga0066709_101631352Not Available921Open in IMG/M
3300009792|Ga0126374_11549796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300010048|Ga0126373_10935582Not Available931Open in IMG/M
3300010048|Ga0126373_13304730Not Available502Open in IMG/M
3300010152|Ga0126318_10831330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300010154|Ga0127503_10691039All Organisms → cellular organisms → Bacteria2774Open in IMG/M
3300010154|Ga0127503_11135456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300010335|Ga0134063_10656900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300010358|Ga0126370_10054201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2567Open in IMG/M
3300010360|Ga0126372_12456071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300010362|Ga0126377_10667216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1090Open in IMG/M
3300010366|Ga0126379_12053488Not Available674Open in IMG/M
3300010366|Ga0126379_13761258Not Available508Open in IMG/M
3300010371|Ga0134125_10252262All Organisms → cellular organisms → Bacteria1961Open in IMG/M
3300010373|Ga0134128_12731374Not Available544Open in IMG/M
3300010375|Ga0105239_11917728Not Available687Open in IMG/M
3300010376|Ga0126381_101524276Not Available966Open in IMG/M
3300010376|Ga0126381_103888237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300010396|Ga0134126_11186803Not Available848Open in IMG/M
3300010398|Ga0126383_13378005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300010399|Ga0134127_10556444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1169Open in IMG/M
3300010401|Ga0134121_11772543Not Available643Open in IMG/M
3300012199|Ga0137383_10225517Not Available1374Open in IMG/M
3300012207|Ga0137381_10836225Not Available797Open in IMG/M
3300012210|Ga0137378_10734449All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300012211|Ga0137377_10438637All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300012683|Ga0137398_10401576Not Available933Open in IMG/M
3300012951|Ga0164300_10349383Not Available793Open in IMG/M
3300012955|Ga0164298_10363288Not Available922Open in IMG/M
3300012955|Ga0164298_11516763Not Available524Open in IMG/M
3300012957|Ga0164303_10039086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2019Open in IMG/M
3300012961|Ga0164302_10011799All Organisms → cellular organisms → Bacteria3473Open in IMG/M
3300012977|Ga0134087_10160202Not Available985Open in IMG/M
3300012985|Ga0164308_10304418Not Available1267Open in IMG/M
3300012989|Ga0164305_11258895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300013501|Ga0120154_1146792Not Available532Open in IMG/M
3300015373|Ga0132257_104118489Not Available529Open in IMG/M
3300016319|Ga0182033_11220664Not Available674Open in IMG/M
3300016371|Ga0182034_12025070Not Available509Open in IMG/M
3300017959|Ga0187779_10020578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3760Open in IMG/M
3300017959|Ga0187779_10085214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1886Open in IMG/M
3300017959|Ga0187779_10437654Not Available858Open in IMG/M
3300017974|Ga0187777_10664037Not Available738Open in IMG/M
3300017994|Ga0187822_10048481Not Available1188Open in IMG/M
3300018060|Ga0187765_10283922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium987Open in IMG/M
3300018433|Ga0066667_12094454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300018468|Ga0066662_10589115Not Available1038Open in IMG/M
3300018482|Ga0066669_10947693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300019888|Ga0193751_1003343All Organisms → cellular organisms → Bacteria9452Open in IMG/M
3300020081|Ga0206354_10043385Not Available589Open in IMG/M
3300020082|Ga0206353_10721178Not Available654Open in IMG/M
3300021560|Ga0126371_10836795Not Available1066Open in IMG/M
3300025780|Ga0210100_1013495Not Available986Open in IMG/M
3300025916|Ga0207663_10350695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1117Open in IMG/M
3300025929|Ga0207664_10654740Not Available944Open in IMG/M
3300025939|Ga0207665_11140428Not Available622Open in IMG/M
3300025949|Ga0207667_11207358Not Available736Open in IMG/M
3300025998|Ga0208651_1026540Not Available516Open in IMG/M
3300026023|Ga0207677_11233140Not Available685Open in IMG/M
3300026300|Ga0209027_1043645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1687Open in IMG/M
3300026325|Ga0209152_10124420Not Available981Open in IMG/M
3300027706|Ga0209581_1013654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4774Open in IMG/M
3300027773|Ga0209810_1003594All Organisms → cellular organisms → Bacteria16045Open in IMG/M
3300027821|Ga0209811_10010189All Organisms → cellular organisms → Bacteria3015Open in IMG/M
3300027874|Ga0209465_10527487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300028589|Ga0247818_11227967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300031170|Ga0307498_10419452Not Available530Open in IMG/M
3300031184|Ga0307499_10278340Not Available544Open in IMG/M
3300031251|Ga0265327_10082946All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300031474|Ga0170818_108221777Not Available1055Open in IMG/M
3300031543|Ga0318516_10633025Not Available610Open in IMG/M
3300031640|Ga0318555_10245835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium966Open in IMG/M
3300031668|Ga0318542_10327536Not Available786Open in IMG/M
3300031713|Ga0318496_10531745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium650Open in IMG/M
3300031781|Ga0318547_10265704All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300031820|Ga0307473_11335401Not Available538Open in IMG/M
3300031938|Ga0308175_102141593Not Available627Open in IMG/M
3300031939|Ga0308174_10156273All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300031996|Ga0308176_10558321Not Available1171Open in IMG/M
3300032261|Ga0306920_102659513Not Available685Open in IMG/M
3300032770|Ga0335085_10751874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1078Open in IMG/M
3300032782|Ga0335082_10035068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5303Open in IMG/M
3300033158|Ga0335077_10300429Not Available1757Open in IMG/M
3300033158|Ga0335077_10522947All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300033550|Ga0247829_11196841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300033759|Ga0314869_014218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.20%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil5.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.43%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.10%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil3.10%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.88%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.55%
SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Sediment0.78%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.78%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.78%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.78%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.78%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2189573003Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003152Freshwater sediment microbial communities from Loktak Lake, IndiaEnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005885Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401EnvironmentalOpen in IMG/M
3300005893Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202EnvironmentalOpen in IMG/M
3300005900Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025780Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025998Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033759Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E1_052181802170459002Grass SoilMALKLQRLEREVDELADRVPNEDAEESPREPARVG
FE2_020671102189573003Grass SoilVVFAVVLAYVLIMALKLQRLEREVDELASRASADEAEEEAPRETASVG
C688J35102_12039653033300002568SoilLVYVLIMALKLQRLEREVDELAGRVSDEDAEEVPQEAARVG*
C688J35102_12069994233300002568SoilVFAVVLAYVLIMALKLQRLERDVDELARSAPEEDAEEAPRETTHVG*
Ga0052254_106099623300003152SedimentVFALILVYVLIMALKLQRLERDVDELAARAPADDVDEEEARRETASVG*
Ga0063455_10117231423300004153SoilVFAVVLAYVLIMALKLQRLERDVDELARRAPEEDAEEAPRETTHVG*
Ga0062589_10247484523300004156SoilVFAVVLVYVLIMALKLQRLEREVDELAERLPDEDAEEAPRETARVG*
Ga0066672_1013603533300005167SoilVFAVVLAYVLIMALKLQRLERDVDELARRAPEENAQEAPRETTHVG*
Ga0066679_1064018513300005176SoilVFAVVLAYVLIMALKLQRLEREVDDLAERVPAEDAGSEEAPRETVRVG*
Ga0070683_10140489023300005329Corn RhizosphereVFAVVLVYVLIMALKVQRLEREVDELAERLPDEDAEEAPRETARVG*
Ga0066388_10071201733300005332Tropical Forest SoilVFAALLVYLVIMALKLQRLEREVDEITGRLPDEDAEEETREPARVG*
Ga0068869_10151383923300005334Miscanthus RhizosphereVFAVVLVYVLIMALKVQRLEREVDELAGRVPDEDAAEAPQEPARVG*
Ga0068868_10080918923300005338Miscanthus RhizosphereVFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEEATRETARVG*
Ga0070737_1001638463300005524Surface SoilVLAYVVIMALKLRRLEREVDELAARSSREADEEAAPQEPAAVG*
Ga0073909_1004140823300005526Surface SoilVFAVVLVYVLIMALKVQRLEREVDELAERVPDGDAEEAPRETARVG*
Ga0070741_1024555433300005529Surface SoilVLIALKLQRLGREVDELAGRAAAGQPSQPEEDGRREPAAVG*
Ga0070741_1065541523300005529Surface SoilALKLQRLEREVDELAGRVPDEDAEEAPREPARVG*
Ga0070697_10100912423300005536Corn, Switchgrass And Miscanthus RhizosphereVFAVVLAYVLIMALKLQRLEREVDDLADRVPAEDAQEEVP
Ga0066695_1006658323300005553SoilVFAVVLVYLLIMALKLQRLEREVDELAARVPDEEAAEALREEARVG*
Ga0066707_1086973813300005556SoilVVLVYLLIMALKLQRLEREVDELAARVPDEEAAEALREEARVG*
Ga0068856_10088036523300005614Corn RhizosphereVLVYVLILSLKLQRLEREVDELAGRVPDEDAAEAPQEPARVG*
Ga0066903_10004238983300005764Tropical Forest SoilYVLIMALKLQRLEREVDQLADRVPQESDEEGAPRETAAVG*
Ga0066903_10023303943300005764Tropical Forest SoilVVFGVILVYVVIMALKLQRLERDVDELARRVPAEDAEDAPRETAAVG*
Ga0066903_10342789723300005764Tropical Forest SoilVFVAVLVYLLIMALKLQRLEREVGELEARVPDEDADEASREPARVG*
Ga0066903_10410968913300005764Tropical Forest SoilVVLVYLLIMALKLQRLEREVDELAGRVPDEDAEEAPREPARVG*
Ga0066903_10871255913300005764Tropical Forest SoilYVLIMALKLQRLEREVDELAGRVPAEDEEEAPREPASVG*
Ga0075284_106399813300005885Rice Paddy SoilYVLIMALKLQRLEREVDELAGRAPTDDVEEAPREPARVG*
Ga0075278_104387213300005893Rice Paddy SoilALVLAYVLIMALKLRRLERDVDELARLVPDEDAEGAPRETAQVG*
Ga0075272_109741613300005900Rice Paddy SoilVFAGVLVYVLIMALKLQRLEREVDELAGRAPTDDVEEAPRE
Ga0066656_1105949023300006034SoilVFAVVLAYVLIMALKLQRLERDVDELARRAPEEDAEEAPRETTRVG*
Ga0070716_10154399223300006173Corn, Switchgrass And Miscanthus RhizosphereVFAVVLAYVLIMALKLQRLEREVDDLADRVPAEDAQEEVPRERASVG*
Ga0070716_10157581523300006173Corn, Switchgrass And Miscanthus RhizosphereLIMALKLQRLEREVDELAGRVPEEDAESEQASREPARVG*
Ga0070712_10023564723300006175Corn, Switchgrass And Miscanthus RhizosphereVFAVVLVYVLIMALKLQRLEREVDELAERVPAEDAEPEEAPREAARVG*
Ga0074049_1243617823300006580SoilVVFAVVLVYVLIMALKLQRLERDVEELAARVPDEDAEETPQEPARVG*
Ga0074062_1213443713300006606SoilVFAIVLVYVLIMALKLQRLEREVDELAERVPAEDAEPEEAPREAARVG*
Ga0066658_1011315813300006794SoilVLVYVLIMALKLQRLEREVDELASRMPAEDPEEAPREPARVG*
Ga0066658_1022181923300006794SoilVFAVVLAYVLIMALKVQRLEREVDEIAARVAEDDAEEAPRETAHVG*
Ga0079221_1114770023300006804Agricultural SoilYVLIMALKLQRLEREVDELAERVPAEDDAEETQREPARVG*
Ga0079220_1171350213300006806Agricultural SoilVFAVVLAYVLIMALKLQRLERDVDELARRAPEEDAEEAPRETARVG*
Ga0073928_1030343413300006893Iron-Sulfur Acid SpringVFAVVLAYVLIMGLKLQRLERDVDDLVGRVPDEDAEEA
Ga0066710_10027684313300009012Grasslands SoilLIMALKLQRLEREVDELAARVPDEEAAEALREEARVG
Ga0066709_10149981623300009137Grasslands SoilVFAVVLAYVLIMALKLQRLEREVDELAARVPDEEAAEALREEARVG*
Ga0066709_10163135213300009137Grasslands SoilMALKLQRLEREVDELAARVPDEEAAEALREEARVG*
Ga0126374_1154979623300009792Tropical Forest SoilVFAGVLVYLLIMALKLQRLEREVDELEARVPDEDADEASREPARVG*
Ga0126373_1093558223300010048Tropical Forest SoilMALKLQRLEREVDDLAARAPETDAEETPREPAPVG*
Ga0126373_1330473013300010048Tropical Forest SoilLKVQRLEREVDDLAERLPDEDAEEEAPRETARVG*
Ga0126318_1083133023300010152SoilVFAVVLAYVLIMALKLQRLERDVEELARRVPEEDAEEAPRETAHVG*
Ga0127503_1069103923300010154SoilMALKLQRLEREVDELAERVPADDAEEEETSREPARVG*
Ga0127503_1113545623300010154SoilVFAVVLVYVLIMALKLQRLEREVDELAERLPVEDAESEEAPREAARVG*
Ga0134063_1065690023300010335Grasslands SoilVFAVVLVYLLIMALKLQRLEREVDELAARVPDEHAAEALREEARVG*
Ga0126370_1005420123300010358Tropical Forest SoilVFAALLVYLVIMALKLQRLEREVNELAGRVPDEQAEEAPREPARVG*
Ga0126372_1245607123300010360Tropical Forest SoilVFAALLVYLLIMALKLQRLEREVDDLAGRVPDEDAEETPREPARVG*
Ga0126377_1066721623300010362Tropical Forest SoilVLVYLLIMALKLQRLEREVDELEARVPEDADEAPREPARVG*
Ga0126379_1205348823300010366Tropical Forest SoilVFAVVLVYVLIMALKLQRLEREVDQLADRVPHEVDEEDAPRETAAVG*
Ga0126379_1376125823300010366Tropical Forest SoilMALKLQRLEREVDEIAGRVPAEDAEEAPREPARVG*
Ga0134125_1025226243300010371Terrestrial SoilVFAVVLVYVLIMALKVQRLQREVDELAERVPDEDAEEATRETARVG*
Ga0134128_1273137413300010373Terrestrial SoilYLLIMALKLQRLEHEVDALAGRMPADDAGEEEAPREPARVG*
Ga0105239_1191772823300010375Corn RhizosphereVFAVVLAYVLIMALKLQRLERDVDELARRAPEEDAEEAPRE
Ga0126381_10152427623300010376Tropical Forest SoilMALKLQRLEREVDELAGRAPAEDEEEAPREPASVG*
Ga0126381_10388823723300010376Tropical Forest SoilVFAVVLAYVLIMALKLQRLERDVDELAGRVPDEDAEE
Ga0134126_1118680323300010396Terrestrial SoilVFAVVLVYLLIMALKLQRLEHEVDALAGRMPADDAGEEEAPREPARVG*
Ga0126383_1337800523300010398Tropical Forest SoilVFAVVLVYVLIMALKLQRLEREVDQLADRVPQESDEEGAPRETAAVG*
Ga0134127_1055644423300010399Terrestrial SoilVFAVVLVYVLIMALKVQRLEREVDELAERLPDDDAEEAPRETARVG*
Ga0134121_1177254323300010401Terrestrial SoilLKLHRLEREVDELADRVPAEDDAEETPRETARVG*
Ga0137383_1022551723300012199Vadose Zone SoilVFAVVLVYVLIMALKLQRLEREVDELAERVPAEDADSEEAPRERASVG*
Ga0137381_1083622523300012207Vadose Zone SoilVFAAVLVYVLIMALKLQRLEREVDELAERVPAEDADSEEAPLETARVG*
Ga0137378_1073444933300012210Vadose Zone SoilVFAVVLAYVLIMALKLQRLERDVDALARRAPEEDAEEAPRET
Ga0137377_1043863723300012211Vadose Zone SoilVVFAVVLAYVLIMALKLQRLEREVDEIARRGNEEDAREEAPRERAGVG*
Ga0137398_1040157623300012683Vadose Zone SoilVVFAVVLVYLLIMALKLQRLEREVDQLVARVPDEDAEEALREEAHVG*
Ga0164300_1034938323300012951SoilVFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEEAARETARVG*
Ga0164298_1036328823300012955SoilVFAVVLVYVLIMALQVQRLEREVDELAERLPDEDAEEALRETARVG*
Ga0164298_1151676313300012955SoilVFAVVLVYVLIMALKVQRLEREVDELAERLPSEDAESEEAPREAARVG
Ga0164303_1003908633300012957SoilVFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEEAPRETARVG*
Ga0164302_1001179923300012961SoilVFAVVLVYVLIMALKLQRLEREVDELAERVPDVDAEEVPREPARVG*
Ga0134087_1016020223300012977Grasslands SoilVFAVLLLYVLIMALKLQRLEREVDELAGGAAEAGAAEESREPARVG*
Ga0164308_1030441823300012985SoilVFAVVLVYVLIMALKVQRLEREVDELAERLPDEDAEEALRETARVG*
Ga0164305_1125889523300012989SoilVFAGVLVYVLIMALKLQRLEREVDELAERLPSEDAESEEAPREAARVG*
Ga0120154_114679213300013501PermafrostVFAVVLAYVLIMALKLQRLEREVDDLAGRVPAEGAEEAP
Ga0132257_10411848913300015373Arabidopsis RhizosphereYCVVFAVVLVYVLIMALKLHRLEREVDELADRVPAEDDAEETPRETARVG*
Ga0182033_1122066423300016319SoilMALKLQRLEREVDELAARVPEEDAEEETREPARVG
Ga0182034_1202507023300016371SoilVFAALLVYVLIMALKLQRLEREVDEIASRLPDEEAEEVPREPARVG
Ga0187779_1002057823300017959Tropical PeatlandVFALVLVYVLIMALKLQRLERDVDALAARAPADDVDHEEAARREPARVG
Ga0187779_1008521413300017959Tropical PeatlandMALKLQRLEREVDELAGRMPPEDAEEEEAPREPARVG
Ga0187779_1043765423300017959Tropical PeatlandAVVLAYVLIMALKLQRLEREVDELAERVPDEDTEEAPREAARVG
Ga0187777_1066403713300017974Tropical PeatlandMALKLQRLEREVDELAERAAEVPEEEGRREPAAVG
Ga0187822_1004848123300017994Freshwater SedimentVFAVVLAYVLIMALKLQRLERDVDELAARVPGTDEEEAPREPAAVG
Ga0187765_1028392223300018060Tropical PeatlandALVLVYVLIMALKLQRLERDVDALAARAPADDVDHEEAARREPARVG
Ga0066667_1209445423300018433Grasslands SoilVFAVVLAYVLIMALKLQRLERDVDELARRAPEEDAEEAPRETTHVG
Ga0066662_1058911523300018468Grasslands SoilMLRLVLVYVLIMALKLQRLERDVDELAARAPEDDTEETPREPVRVG
Ga0066669_1094769313300018482Grasslands SoilVFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEVAPRET
Ga0193751_100334353300019888SoilVFAVVLAYVLIMALKLQRLEREVDELAARAPAEDEEEAPREPARVG
Ga0206354_1004338513300020081Corn, Switchgrass And Miscanthus RhizosphereAYVLIMALKLQRLERDVDELARRAPEEDAEEAPRETTHVG
Ga0206353_1072117823300020082Corn, Switchgrass And Miscanthus RhizosphereVFAVVLVYVLIMALKVQRLEREVDELAERLPDEDAEEAPRETARVG
Ga0126371_1083679523300021560Tropical Forest SoilMALKLQRLEREVDELSGRAPAKDEEEAPREPASVG
Ga0210100_101349513300025780Natural And Restored WetlandsMALKLQRLEREVDELAGRAPADDAEDTPREPARVG
Ga0207663_1035069533300025916Corn, Switchgrass And Miscanthus RhizosphereYVVIIALKLQRLEREVDELAVRRDADEATDREPAQVG
Ga0207664_1065474013300025929Agricultural SoilLLIMGLKLQRLEREVDELAGRVPEEDAESEQASREPARVG
Ga0207665_1114042823300025939Corn, Switchgrass And Miscanthus RhizosphereVFAVVLAYVLIMALKLQRLEREVDDLADRVPAEDAQEEVPRERASVG
Ga0207667_1120735813300025949Corn RhizosphereVLIMALKVQRLEREVDELAERLPDEDAEEAPRETARVG
Ga0207640_1082900413300025981Corn RhizosphereIIALKLQRLEREVAELADRSEQDATEPGREPAQVG
Ga0208651_102654013300025998Rice Paddy SoilAYVLILALKLQRLERDVDELVGRVPDEDAEEAPQEPARVG
Ga0207677_1123314023300026023Miscanthus RhizosphereVFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEEATRETARVG
Ga0209027_104364523300026300Grasslands SoilVFAVVLVYLLIMALKLQRLEREVDELAARVPDEEAAEALREEARVG
Ga0209152_1012442023300026325SoilVFAVVLAYVLIMALKVQRLEREVDEIAARVAEDDAEEAPRETAHVG
Ga0209581_101365433300027706Surface SoilVLAYVVIMALKLRRLEREVDELAARSSREADEEAAPQEPAAVG
Ga0209810_1003594213300027773Surface SoilVIIALKLQRLEREVDELAGRAPAAEEEAPREPAAVG
Ga0209811_1001018923300027821Surface SoilVFAVVLVYVLIMALKVQRLEREVDELAERVPDEDAEEAPRETARVG
Ga0209465_1052748723300027874Tropical Forest SoilVTAAYCVVFAGVLVYLLIMALKLQRLEREVDELEARVPDEDADEAS
Ga0247818_1122796713300028589SoilVFAVVLVYVVIMALKLQRLEREVDELAERVPDEDAEEVPRE
Ga0307498_1041945223300031170SoilVVFAVLLVYLLIMALKLQRLEREVDELADRVPDEDAEESPREAARVG
Ga0307499_1027834023300031184SoilMALKVQRLEREVDELAERVPDEDAEEAPRETARVG
Ga0265327_1008294613300031251RhizosphereIIALKLQRLEREVDELAGRAATREEEPEESREAAVVG
Ga0170818_10822177723300031474Forest SoilVLAYVLIMALKLQRLEREVDELASRASADEAEEEAPRETASVG
Ga0318516_1063302513300031543SoilLIMALKLQRLEREVDEIAGRVPDEDAQEAPREPARVG
Ga0318555_1024583513300031640SoilVFAVVLAYVLIMALKLQRLERDVDELAGRVPDEDAEEA
Ga0318542_1032753623300031668SoilVFAALLVYVLIMALKLQRLEREVDEIAGRVPDEDAQEAPREPARVG
Ga0318496_1053174523300031713SoilVFAALLVYVLIMALKLQRLEREVDEIAGRLPDEDAEEAPREPARVG
Ga0318547_1026570423300031781SoilVFAVVLAYVLIMALKLQRLERDEDAEEAPREPARVG
Ga0307473_1133540113300031820Hardwood Forest SoilMALKLQRLEREVDELAERLPSDDAEPEEAPREAARVG
Ga0308175_10214159313300031938SoilVFAVVLVYVLIMALKVQRLARGGDELAGRVAEETEE
Ga0308174_1015627343300031939SoilLIMALKLQRLERDVDDLAARVPDEDADEETREPARIG
Ga0308176_1055832123300031996SoilVFAVVLVYVLIMALKMQRLEREVDELAERVPDEDAEETPRETTRVG
Ga0306920_10265951313300032261SoilAVVLVYVLIMALKLQRLEREVDELAERAAEAPEEEGRREPAAVG
Ga0335085_1075187433300032770SoilVFALVLAYVLIMALKLQRLERDVDELAARAPADGVDEEEARRETA
Ga0335082_1003506823300032782SoilVFALVLAYVLIMALKLQRLERDVDELAARAPADGVDEEDARRETASVG
Ga0335077_1030042943300033158SoilVFALVLAYVLIMALKLQRLERDVDELAARAPADGVDEEDARRE
Ga0335077_1052294723300033158SoilMALKLQRLERDVDELAARAPTDEAEEEEAPREAARVG
Ga0247829_1119684113300033550SoilVFAVVLVYVLIMALKVQRLEREVDELAERLPDEDAEEA
Ga0314869_014218_197_3433300033759PeatlandVFALVLAYVLIMALKLQRLERDVDELAARAPADDVDEEEARRETASVG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.