| Basic Information | |
|---|---|
| Family ID | F063783 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTWADFYLICFAVGFLFSLLSFLAGGLRWHLHLPHFS |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.37 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.225 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (7.752 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.256 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.512 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 4.65 |
| PF06739 | SBBP | 4.65 |
| PF00528 | BPD_transp_1 | 2.33 |
| PF12911 | OppC_N | 1.55 |
| PF02746 | MR_MLE_N | 0.78 |
| PF00873 | ACR_tran | 0.78 |
| PF06475 | Glycolipid_bind | 0.78 |
| PF00534 | Glycos_transf_1 | 0.78 |
| PF03781 | FGE-sulfatase | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG3554 | Uncharacterized conserved protein | Function unknown [S] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.22 % |
| Unclassified | root | N/A | 0.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004082|Ga0062384_101270146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 538 | Open in IMG/M |
| 3300004603|Ga0068918_1256261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 624 | Open in IMG/M |
| 3300004635|Ga0062388_100273904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1390 | Open in IMG/M |
| 3300005180|Ga0066685_11009198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 549 | Open in IMG/M |
| 3300005329|Ga0070683_100883633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 857 | Open in IMG/M |
| 3300005330|Ga0070690_100187500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1432 | Open in IMG/M |
| 3300005434|Ga0070709_10417433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1005 | Open in IMG/M |
| 3300005436|Ga0070713_102340884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 517 | Open in IMG/M |
| 3300005437|Ga0070710_10019499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3505 | Open in IMG/M |
| 3300005542|Ga0070732_10666527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 633 | Open in IMG/M |
| 3300005554|Ga0066661_10592135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 659 | Open in IMG/M |
| 3300005598|Ga0066706_10898364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 690 | Open in IMG/M |
| 3300005921|Ga0070766_10464479 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300006031|Ga0066651_10726871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 535 | Open in IMG/M |
| 3300006102|Ga0075015_100024827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 2688 | Open in IMG/M |
| 3300006237|Ga0097621_101410706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300006354|Ga0075021_10031250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 3025 | Open in IMG/M |
| 3300006800|Ga0066660_11229521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 587 | Open in IMG/M |
| 3300009093|Ga0105240_12541581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300009549|Ga0116137_1052994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1310 | Open in IMG/M |
| 3300010043|Ga0126380_10695465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300010046|Ga0126384_11110257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300010048|Ga0126373_10268689 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300010048|Ga0126373_10915206 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300010048|Ga0126373_11116988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300010154|Ga0127503_11320656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300010341|Ga0074045_10512015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 771 | Open in IMG/M |
| 3300010361|Ga0126378_11219798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300010362|Ga0126377_12608165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300010373|Ga0134128_11760306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300010376|Ga0126381_104575540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300010397|Ga0134124_13168477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300011064|Ga0138525_1056377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300012203|Ga0137399_10099210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2250 | Open in IMG/M |
| 3300012207|Ga0137381_10613925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
| 3300012209|Ga0137379_10667919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300012211|Ga0137377_10674706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300012211|Ga0137377_11438745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300012923|Ga0137359_10044042 | All Organisms → cellular organisms → Bacteria | 3870 | Open in IMG/M |
| 3300012929|Ga0137404_12237992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300012944|Ga0137410_11749322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300012958|Ga0164299_10826151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300012960|Ga0164301_10994722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300012980|Ga0168315_105606 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300012984|Ga0164309_11301298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300012986|Ga0164304_11082692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300014169|Ga0181531_10509508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300014199|Ga0181535_10581281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300014201|Ga0181537_11172409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300014498|Ga0182019_10963777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300014638|Ga0181536_10194044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
| 3300014638|Ga0181536_10324956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300014969|Ga0157376_11585046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300015264|Ga0137403_10381608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 1292 | Open in IMG/M |
| 3300015373|Ga0132257_100031611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5740 | Open in IMG/M |
| 3300015373|Ga0132257_104477885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300016702|Ga0181511_1004195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300016705|Ga0181507_1248837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300018006|Ga0187804_10382684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300018022|Ga0187864_10408346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300018022|Ga0187864_10417399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300018022|Ga0187864_10431250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300018026|Ga0187857_10122639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1250 | Open in IMG/M |
| 3300018030|Ga0187869_10576335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300018037|Ga0187883_10166062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
| 3300018037|Ga0187883_10227067 | Not Available | 956 | Open in IMG/M |
| 3300018040|Ga0187862_10064274 | All Organisms → cellular organisms → Bacteria | 2624 | Open in IMG/M |
| 3300018086|Ga0187769_10943554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300018086|Ga0187769_10990383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 636 | Open in IMG/M |
| 3300018088|Ga0187771_10081328 | All Organisms → cellular organisms → Bacteria | 2580 | Open in IMG/M |
| 3300018431|Ga0066655_10654406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300019890|Ga0193728_1245312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300020070|Ga0206356_11778801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300020580|Ga0210403_11507417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300020581|Ga0210399_10038322 | All Organisms → cellular organisms → Bacteria | 3836 | Open in IMG/M |
| 3300020583|Ga0210401_10482677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
| 3300021168|Ga0210406_10923528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300021406|Ga0210386_10780691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300021475|Ga0210392_10213356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1353 | Open in IMG/M |
| 3300021559|Ga0210409_10745833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300021860|Ga0213851_1235603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300022524|Ga0224534_1067816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300022726|Ga0242654_10306454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300022756|Ga0222622_11415621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300023090|Ga0224558_1247246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 513 | Open in IMG/M |
| 3300025414|Ga0208935_1053630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300025453|Ga0208455_1095631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300025527|Ga0208714_1008220 | All Organisms → cellular organisms → Bacteria | 2763 | Open in IMG/M |
| 3300025898|Ga0207692_10180008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1231 | Open in IMG/M |
| 3300025903|Ga0207680_10016987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3835 | Open in IMG/M |
| 3300025912|Ga0207707_10974320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300025928|Ga0207700_10646856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300025938|Ga0207704_11409062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300026095|Ga0207676_10133091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2117 | Open in IMG/M |
| 3300026291|Ga0209890_10192398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300026322|Ga0209687_1222420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300027521|Ga0209524_1074677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300027548|Ga0209523_1005371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2176 | Open in IMG/M |
| 3300027562|Ga0209735_1104017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300027568|Ga0208042_1190076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300027696|Ga0208696_1010158 | All Organisms → cellular organisms → Bacteria | 3884 | Open in IMG/M |
| 3300027829|Ga0209773_10135844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1022 | Open in IMG/M |
| 3300027842|Ga0209580_10158623 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300027842|Ga0209580_10672016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300027875|Ga0209283_10249118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1178 | Open in IMG/M |
| 3300027889|Ga0209380_10330176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300027894|Ga0209068_10983078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300027905|Ga0209415_10131783 | All Organisms → cellular organisms → Bacteria | 2591 | Open in IMG/M |
| 3300027910|Ga0209583_10088024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1174 | Open in IMG/M |
| 3300027911|Ga0209698_10258691 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300027911|Ga0209698_11298657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300028380|Ga0268265_11916950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300028765|Ga0302198_10308269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300029907|Ga0311329_10872953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300030503|Ga0311370_11080675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300031231|Ga0170824_108378786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300031708|Ga0310686_114975904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300031720|Ga0307469_11791791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300031740|Ga0307468_100932493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300031795|Ga0318557_10332920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300031823|Ga0307478_10478961 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300032001|Ga0306922_12192378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300032180|Ga0307471_102106725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300032180|Ga0307471_102600767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300032180|Ga0307471_104018152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300032205|Ga0307472_100148369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1708 | Open in IMG/M |
| 3300032205|Ga0307472_102329375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300033475|Ga0310811_10523971 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300034124|Ga0370483_0137530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.20% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.43% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.65% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.55% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.55% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.78% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.78% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.78% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004603 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012980 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCW15 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062384_1012701461 | 3300004082 | Bog Forest Soil | MTWSDFYLTCFAVGFLLSAISFLVGGLHGHFHLPHFPDFGGHVDA |
| Ga0068918_12562612 | 3300004603 | Peatlands Soil | MTWADFYLTCFAVGFLLSAISFIAGGLRWHLHLPHFPGGG |
| Ga0062388_1002739041 | 3300004635 | Bog Forest Soil | MTVNMATMTTANMTWADFYLICFAVGFLLSAISFIAGGLRWHLHL |
| Ga0066685_110091982 | 3300005180 | Soil | MTWADFYLVCFVLGFVFSLLSFVLGGLHWHLPFHAHLPHVGGGSVHV |
| Ga0070683_1008836333 | 3300005329 | Corn Rhizosphere | MTWAHFYLVCFAVGFFLSVLMFLAGGLNLHLPHIHIHFPGAHGH |
| Ga0070690_1001875001 | 3300005330 | Switchgrass Rhizosphere | MTWAHFYLVCFAVGFFLSVLMFLAGGLNLHLPHIHIHFPGAHG |
| Ga0070709_104174332 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTWADFYLVCFVVGLFLSVVMFLAGGLHLPHFHIQLPGLNG |
| Ga0070713_1023408841 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNWADFYLICFAVGFSFSLLSFLAGGLRWHPHLPHFSHPHVH |
| Ga0070710_100194995 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNWADFYLICFAIGFSFSLVSFLAGGLRWHLHMPHFPHAPAVHHASAPSN |
| Ga0070732_106665272 | 3300005542 | Surface Soil | MTWANFYLICFAVGLAFSLLSFFAGGARWHLHLPHLPHAVHGP |
| Ga0066661_105921352 | 3300005554 | Soil | MTLADFYLVCFVVGFFLSLLMFLAGGLHLHIPHFHGHALPVHIHA |
| Ga0066706_108983642 | 3300005598 | Soil | MTLADFYLVCFVVGFFLSLLMFLAGGMHLHIPHFHGHA |
| Ga0070766_104644793 | 3300005921 | Soil | MTWADFYLVCFAVGFFFSLLSFLAGGLRWHLHLPHFSHVHTAPPHAS |
| Ga0066651_107268711 | 3300006031 | Soil | MTWADFYLVCFVVGFFLSLLMFLAGGMHLQIPHFHGHALPVH |
| Ga0075015_1000248275 | 3300006102 | Watersheds | MTWADFYLVCFVIGFCFSLLSFLTGGLRWHLHMPHLPHGAAGGHI |
| Ga0097621_1014107061 | 3300006237 | Miscanthus Rhizosphere | MTWADFYLVCFAAGFLFSVLSFVLGAHWHLPFHLHF |
| Ga0075021_100312501 | 3300006354 | Watersheds | MTWADFYLICFAVGFSFSLLSFLAGGLRWHLHVPRFSHVHVPP |
| Ga0066660_112295212 | 3300006800 | Soil | MTWADFYLVCFVVGFFLSVLMFLAGGVHLHIPHFHG |
| Ga0105240_125415812 | 3300009093 | Corn Rhizosphere | MMTWANFYLLCFALGFAFSLISFIGGGMRWHLHLPHL |
| Ga0116137_10529941 | 3300009549 | Peatland | MTSNVTWSDFYLACFAVGFLLSAVSFIAGGLRWHAHLPHLPHGGG |
| Ga0126380_106954652 | 3300010043 | Tropical Forest Soil | MTWADFYLVCFVVGFFLSVLLFLAGGVHFHIPHFHIHVHG |
| Ga0126384_111102571 | 3300010046 | Tropical Forest Soil | MTWADFYLICFAVGFLFSFLSFFLGGIHWHLPFDV |
| Ga0126373_102686893 | 3300010048 | Tropical Forest Soil | MTWADFYLVCFVVGFFLSVLMFLSGGLRLHVPHVHVHLPGFH |
| Ga0126373_109152063 | 3300010048 | Tropical Forest Soil | MTWADFYLVCFVVGFFLSVIIFVTGGLRLHFPHLPHFH |
| Ga0126373_111169882 | 3300010048 | Tropical Forest Soil | MTWADFYLICFAVGFAFSLMSFLGGGTRWRLHLPHS |
| Ga0127503_113206561 | 3300010154 | Soil | MTWADFYLICFAVGFLFSLLSFLAGGLRWHLHLPHFS |
| Ga0074045_105120152 | 3300010341 | Bog Forest Soil | MTSWADFYLACFAIGFLLSAVSFIAGGMHWHLPHFPDGGHFG |
| Ga0126378_112197982 | 3300010361 | Tropical Forest Soil | MTWADFYLVCFVVGFFLSLLMFLGGGARLHLPHFHLHLPGLSGHGTAPHAV |
| Ga0126377_126081651 | 3300010362 | Tropical Forest Soil | MTWADFYLICFAVGFTFSVLSFFFGGHRWHLPFHFH |
| Ga0134128_117603062 | 3300010373 | Terrestrial Soil | MTWADFYLICFVVGFFLSLVMFLAGGAQLPHVHIHLPGMHG |
| Ga0126381_1045755401 | 3300010376 | Tropical Forest Soil | MTWSDFYLICFAAGFLFSLLSFIFGGLHFHGHSLHVHDLHF |
| Ga0134124_131684771 | 3300010397 | Terrestrial Soil | MTWADFYLVCFVVGLFLSVLMFLAGGTHLHIPHFHGHALPAHIHG |
| Ga0138525_10563771 | 3300011064 | Peatlands Soil | MTWADFYLTCFAVGFLLSAISFIAGGLRWHLHLPHFPGGGGHVGA |
| Ga0137399_100992105 | 3300012203 | Vadose Zone Soil | MNWADFYLICFAVGFSFSLLSFLAGGLRWQLHLPHFSHVHV |
| Ga0137381_106139253 | 3300012207 | Vadose Zone Soil | MTLADFYLVCFVVGFFLSLLMFLAGGMHLHIPHFHGHALPVHIHA |
| Ga0137379_106679192 | 3300012209 | Vadose Zone Soil | MTLADFYLVCFVVGFFLSLLMFLAGGMHLHIPHFHGHALPV |
| Ga0137377_106747062 | 3300012211 | Vadose Zone Soil | MTWADFYLVCFVVGFFLSVLMFLAGGTHLHIPHFHGHALPVHIHGA |
| Ga0137377_114387451 | 3300012211 | Vadose Zone Soil | MTLADFYLVCFVVGFFLSLLMFLAGGMHLHIPHFHG |
| Ga0137359_100440421 | 3300012923 | Vadose Zone Soil | MTVNMTWSDFYLTCFAIGFLLSAISFMAGGMRWQLHLPHFPHAA |
| Ga0137404_122379922 | 3300012929 | Vadose Zone Soil | MTWADFYLVCFALGFAFSLLSFLLGGLRWHLPLHTHLHP |
| Ga0137410_117493221 | 3300012944 | Vadose Zone Soil | MTWADFYLVCFALGFAFSLLSFLLGGLRWHLPLHTHLHPG |
| Ga0164299_108261512 | 3300012958 | Soil | MTWADFYLVCFVVGFFLSVVIFVTGGLRLHFPHAHFHWPG |
| Ga0164301_109947221 | 3300012960 | Soil | VTWADFYLVCFIAGFFLSVLMFLAGGVHFHLPHFHINLPGLHGQ |
| Ga0168315_1056063 | 3300012980 | Weathered Mine Tailings | MTWADFYLVCFVIGFCFSLLSFLTGGLRWHLHMPHLPHGTA |
| Ga0164309_113012981 | 3300012984 | Soil | MTWADFYLVCFAVGFLLSLLSFLAGGLHWHPHVPHFSHGHLAMPHP |
| Ga0164304_110826922 | 3300012986 | Soil | MTWADFYLVCFVVGLFLSVLMFLAGGTHLHIPHFHGHALPAHIH |
| Ga0181531_105095082 | 3300014169 | Bog | MTWADFYLTCFAVGFLLSAVSFIAGGMRWHLHLPHF |
| Ga0181535_105812812 | 3300014199 | Bog | MTWADFYLTCFAVGFLLSAVSFIAGGMRWHVHLPHVPHGGGHIGGG |
| Ga0181537_111724091 | 3300014201 | Bog | MTWADFYLICFVVGFLLSAVSFLLGGLHGHLHLPHSLNAGGHAPL |
| Ga0182019_109637772 | 3300014498 | Fen | MTWENFYLLCFSVGFFLSLISFLAGGLHAVHLPHFPHVHI |
| Ga0181536_101940443 | 3300014638 | Bog | MTGNMTWNMTWADFYLICFAVGFLLSAISFIAGGLRWHLHLPHFPHSGA |
| Ga0181536_103249562 | 3300014638 | Bog | MTWNMTWADFYLICFAVGFLLSAISFIAGGLRWHLHLPHF |
| Ga0157376_115850462 | 3300014969 | Miscanthus Rhizosphere | MTWADFYLVCFVVGFFLSVVIFVTGGLRLHFPHAHFHW |
| Ga0137403_103816083 | 3300015264 | Vadose Zone Soil | MTGADFYLICFAVGFSFSLLSFLAGGLRWHLHLPHFSHGHVIPHPP |
| Ga0132257_1000316111 | 3300015373 | Arabidopsis Rhizosphere | MTWADFYLVCFAAGFLFSVLSFVLGAHWHLPFHLHFP |
| Ga0132257_1044778852 | 3300015373 | Arabidopsis Rhizosphere | MTWADFYLVCFAAGFLFSVLSFVLGGFHWHLPFHIHL |
| Ga0181511_10041951 | 3300016702 | Peatland | MTWADFYLTCFAVGFLLSAISFVVGGLHGHLHLPHFP |
| Ga0181507_12488371 | 3300016705 | Peatland | MTWADFYLTCFAVGFLLSAVSFIAGGMRWHVHLPHVPHGGGH |
| Ga0187804_103826842 | 3300018006 | Freshwater Sediment | MTWADFYLACFAIGFLLSAVSFIAGGMHWHLPHFPDG |
| Ga0187864_104083461 | 3300018022 | Peatland | MTGNMTWNMTWADFYLICFAVGFLLSAISFIAGGLRWHLHLPHFPHS |
| Ga0187864_104173992 | 3300018022 | Peatland | MTGSMTWNMTWADFYLICFAVGFLLSAISFIAGGLRWHLH |
| Ga0187864_104312502 | 3300018022 | Peatland | MIATTTWNMTWADFYLACFAVGFLLSAISFIAGGLRWHLHLPHF |
| Ga0187857_101226391 | 3300018026 | Peatland | MTWNMTWADFYLTCFAVGFLLSAISFIAGGLRWHLHLPHLPHAG |
| Ga0187869_105763351 | 3300018030 | Peatland | MTWADFYLICFAIGFLLSAISFIAGGLHWHVHLPHFP |
| Ga0187883_101660623 | 3300018037 | Peatland | MTWNMTWADFYLTCFAVGFLLSAISFIAGGLRWHLHLPHL |
| Ga0187883_102270672 | 3300018037 | Peatland | MTWADFYLICFAIGFLLSAISFIAGGLHWHVHLPHFPGVH |
| Ga0187862_100642743 | 3300018040 | Peatland | MTVNMTWADFYLICFAVGFLLSAISFIGGGLRWHLHLPHFPHSG |
| Ga0187769_109435542 | 3300018086 | Tropical Peatland | MTWSDFYLTCFAVGFLLSAISFIAGGLRWHLHLPH |
| Ga0187769_109903831 | 3300018086 | Tropical Peatland | MTWADFYLTCFAVGFLLSAVSFIAGGLHWHLHLPHFPHGGGQVTAGHV |
| Ga0187771_100813281 | 3300018088 | Tropical Peatland | MTWATFYLTCFALGFLFSLVSFLLGGLRLHLPHLG |
| Ga0066655_106544061 | 3300018431 | Grasslands Soil | MTLADFYLVCFVVGFLSLLMFLAGGMHLHIPHFHG |
| Ga0193728_12453121 | 3300019890 | Soil | MNWADFYLICFAVGFSFSLLSFLAGGLRWHPHLPHFSHVHVA |
| Ga0206356_117788012 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MTWAHFYLVCFAVGFFLSVLMFLAGGLNLHLPHIHIHF |
| Ga0210403_115074171 | 3300020580 | Soil | VTWADFYLVCFVVGFAFSVLAVFSGGMRWHIPHLPHGHGP |
| Ga0210399_100383223 | 3300020581 | Soil | MTWSDFYLICFAVGFLLSAVSFVVGGLHGHLHLPHFPDAGGHVD |
| Ga0210401_104826771 | 3300020583 | Soil | MTWADFYLVCFAVGFFFSLLSFLAGGLRWHLHLPHFS |
| Ga0210406_109235281 | 3300021168 | Soil | MTWADFYLTCFAVGFLLSAISFIAGGMRWQLHLPHF |
| Ga0210386_107806912 | 3300021406 | Soil | MTWADFYLICFAVGFAFSLISFVSGGTRWRLHLPHL |
| Ga0210392_102133561 | 3300021475 | Soil | MTWATFYLVCFAVGLAFSLLSFFTAGVRWHLHLPHLP |
| Ga0210409_107458332 | 3300021559 | Soil | MTWADFYLTCFAVGFAFSLISFVGGGSRWHFHLHLPHGAG |
| Ga0213851_12356031 | 3300021860 | Watersheds | MTWADFYLICFVVGFLLSAVSFLLGGLHGHLHLPHFP |
| Ga0224534_10678162 | 3300022524 | Soil | MTGTMTGNMTGNIAWADFYLTCFAVGFLLSAISFLAGGLRWHLH |
| Ga0242654_103064541 | 3300022726 | Soil | VTWANFYLVCFAVGFAFSVISFLGGGTRWRFHLPHLPHGA |
| Ga0222622_114156211 | 3300022756 | Groundwater Sediment | MTWADFYLVCFALGFVFSLLSFLLGGMEWHLPFHAHLPHFG |
| Ga0224558_12472462 | 3300023090 | Soil | VTWSDFYLTCFAVGFLLSAVLFIAGGMHWHLHLHLPDLPHLGGDVGGHVLTGDA |
| Ga0208935_10536302 | 3300025414 | Peatland | MTWSDFYLACFAIGFLLSAVSFIAGGMHWHLPHFPDG |
| Ga0208455_10956312 | 3300025453 | Peatland | MTWNMTWADFYLTCFAVGFLLSAISFIAGGLRWHLHLPHLPHAGGH |
| Ga0208714_10082201 | 3300025527 | Arctic Peat Soil | MTWNMTWSDFYLTCFAVGFLLSAISFIAGGMRWQLHLPH |
| Ga0207692_101800083 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MNWADFYLICFAIGFSFSLVSFLAGGLRWHLHMPHFPHAPAVHHASAPSNV |
| Ga0207680_100169876 | 3300025903 | Switchgrass Rhizosphere | MTWADFYLICFAGGFFFSLLSFLAGGMRWHLHLPHFSH |
| Ga0207707_109743202 | 3300025912 | Corn Rhizosphere | MTWAHFYLVCFAVGFFLSVLMFLAGGLNLHLPHIHIHFPGSHGH |
| Ga0207700_106468563 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTWANFYLVCFAVGFAFSVLAFLGGGTRWHLHVPHFHG |
| Ga0207704_114090622 | 3300025938 | Miscanthus Rhizosphere | MTWADFYLICFAGGFFFSLLSFLAGGMRWHLHLPHFS |
| Ga0207676_101330913 | 3300026095 | Switchgrass Rhizosphere | MTWAHFYLVCFAVGFFLSVLMFLAGGLNLHLRHIHIHFPGAQGHVS |
| Ga0209890_101923981 | 3300026291 | Soil | MTWADFYLICFVLGIAFSLVSLLGGGSRWHLHLPHFAHAH |
| Ga0209687_12224202 | 3300026322 | Soil | MTWADFYLVCFVVGFAFSLLSFLSGGLRWHLHIPRIFHGGH |
| Ga0209524_10746772 | 3300027521 | Forest Soil | MTWADFYLVCFAVGFFFSLLSFLAGGLRWHLHLPHFSHVHT |
| Ga0209523_10053714 | 3300027548 | Forest Soil | VTWANFYLVCFAVGFAFSAISFLGGGSRWRFHLPHL |
| Ga0209735_11040171 | 3300027562 | Forest Soil | MTWSDFYLTCFAVGFLLSAISFIAGGMRWQLHLPHFPH |
| Ga0208042_11900761 | 3300027568 | Peatlands Soil | VTWSDFYLTCFAVGFLLSAVLFIAGGLHWHLHLPDLPHLGGDVG |
| Ga0208696_10101581 | 3300027696 | Peatlands Soil | VTWSDFYLTCFAVGFLLSAVLFIAGGLHWHLHLPDLPHLGGD |
| Ga0209773_101358443 | 3300027829 | Bog Forest Soil | MTWHMTWADFYLTCFAVGFLLSAISFIAGGLRWHLH |
| Ga0209580_101586233 | 3300027842 | Surface Soil | MTWADFYLICFAVGFAFSLISFLGGGTRWRLHLPH |
| Ga0209580_106720161 | 3300027842 | Surface Soil | VTWANFYLVCFAVGFAFSVISFLGGGTRWRFHLPHLP |
| Ga0209283_102491183 | 3300027875 | Vadose Zone Soil | MNWADFYLICFAVGFSFSLLSFLAGGLRWQLHLPH |
| Ga0209380_103301762 | 3300027889 | Soil | MTATMTANMTVMTNANMSWSDFYLICFAVGFLLSAISFIAGGLRWHLHLPH |
| Ga0209068_109830782 | 3300027894 | Watersheds | MTWADFYLVCFAVGFLFSLLAFLAGGLRWHAHLPHFSHVH |
| Ga0209415_101317831 | 3300027905 | Peatlands Soil | MIGNMIATTTWNMTWADFYLTCFAVGFLLSAISFIAGGLRWHVHLPHFP |
| Ga0209583_100880242 | 3300027910 | Watersheds | MTWADFYLICFAVGFSFSLLSFLAGGLRWHLHVPRFSHVHVP |
| Ga0209698_102586911 | 3300027911 | Watersheds | MTWSDFYLICFAVGFLLSAISFIAGGLRWHVHLPHF |
| Ga0209698_112986572 | 3300027911 | Watersheds | MTWADFYLTCFAVGFLLSAVSFLVGGLHWHLHMHLPDLPHFGGDV |
| Ga0268265_119169501 | 3300028380 | Switchgrass Rhizosphere | MTWADFYLVCFAAGFLFSVLSFVLGGFHWHLPFHIHLPASADPH |
| Ga0302198_103082692 | 3300028765 | Bog | MTWADFYLTCFAVGFLLSAVSFIAGGMRWHIHLPHFPHAG |
| Ga0311329_108729532 | 3300029907 | Bog | MTWADFYLTCFAVGFLLSAVSFIAGGMRWHLHLPHLPHAGGHGFGSHT |
| Ga0311370_110806752 | 3300030503 | Palsa | MTWADFYLICFAVGFLLSAISAILGGLHWHVHLPHLP |
| Ga0170824_1083787861 | 3300031231 | Forest Soil | MTWADFYLICFGVGFLLSAVSFIAGGFRWHLHLPH |
| Ga0310686_1149759041 | 3300031708 | Soil | MTWNMTWADFYLTCFAVGFLLSAISFIVGGIHGRLHLPHFPDFGGHDFG |
| Ga0307469_117917911 | 3300031720 | Hardwood Forest Soil | MTWADFYLVCFVVGFFLSALMFLGGGLHLHIPHFHLHAPTHVHFAGHTP |
| Ga0307468_1009324931 | 3300031740 | Hardwood Forest Soil | MTWADFYLICFAVGFLFSLLSFLAGGLRWHVHLPH |
| Ga0318557_103329201 | 3300031795 | Soil | VTWADFYLVCFVVGFAFSVLAVFSGGMRWHIPHLPHGHGPVG |
| Ga0307478_104789611 | 3300031823 | Hardwood Forest Soil | MTWADFYLVCFVVGFFLSVLMFLGGGLHLHIPHFHF |
| Ga0306922_121923782 | 3300032001 | Soil | MSWSDFYLICFAIGFLLSLLSFIMGGLHLPGHWQH |
| Ga0307471_1021067252 | 3300032180 | Hardwood Forest Soil | MTWANFYLICFAVGLAFSLISFFAGGVRWHPHLPHLPHAMHGP |
| Ga0307471_1026007672 | 3300032180 | Hardwood Forest Soil | MTWANFYLICFALGLAFSLLSFFAGGVRWHLHLPHLPHAMH |
| Ga0307471_1040181522 | 3300032180 | Hardwood Forest Soil | MTWADFYLICFGVGFLLSAVSFIAGGFRWHLHLPHFPH |
| Ga0307472_1001483691 | 3300032205 | Hardwood Forest Soil | MTWTDFYLVCFALGFAFSLLSFLLGGLHWHMPFHAHLPHVGGPSLH |
| Ga0307472_1023293751 | 3300032205 | Hardwood Forest Soil | MTWADFYLVCFAAGFLFSVLSFVLGAHWHLPFHLHFPGAHG |
| Ga0310811_105239711 | 3300033475 | Soil | MTWADFYLVCFAAGFLFSVLSFVLGAHWHLPFHLHFPG |
| Ga0370483_0137530_2_121 | 3300034124 | Untreated Peat Soil | MTWSDFYLICFAVGFLLSAISFVTGGLRWHLHLPHFPHGG |
| ⦗Top⦘ |