NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063596

Metagenome / Metatranscriptome Family F063596

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063596
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 49 residues
Representative Sequence MSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFSGDPVKLTDNGVI
Number of Associated Samples 120
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 97.67 %
% of genes from short scaffolds (< 2000 bps) 90.70 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (90.698 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(19.380 % of family members)
Environment Ontology (ENVO) Unclassified
(37.984 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(46.512 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 18.18%    Coil/Unstructured: 81.82%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF00166Cpn10 8.53
PF07460NUMOD3 0.78
PF00462Glutaredoxin 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 8.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.57 %
UnclassifiedrootN/A5.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10242544All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes572Open in IMG/M
3300001580|Draft_10119526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1337Open in IMG/M
3300002231|KVRMV2_100516082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1762Open in IMG/M
3300002835|B570J40625_101726456All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes509Open in IMG/M
3300004124|Ga0066178_10083338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes853Open in IMG/M
3300004457|Ga0066224_1031800All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes639Open in IMG/M
3300004810|Ga0007757_11465174All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes654Open in IMG/M
3300005517|Ga0070374_10194474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1045Open in IMG/M
3300005527|Ga0068876_10256352All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1002Open in IMG/M
3300005580|Ga0049083_10085159Not Available1101Open in IMG/M
3300005585|Ga0049084_10141418All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes844Open in IMG/M
3300005739|Ga0076948_1127654All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1306Open in IMG/M
3300006737|Ga0098037_1002612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7852Open in IMG/M
3300006805|Ga0075464_10869105All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes562Open in IMG/M
3300006916|Ga0070750_10418574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes557Open in IMG/M
3300006920|Ga0070748_1295192All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes577Open in IMG/M
3300007177|Ga0102978_1013955All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1832Open in IMG/M
3300007177|Ga0102978_1273152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1835Open in IMG/M
3300007538|Ga0099851_1001682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes9341Open in IMG/M
3300007542|Ga0099846_1004914All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes5398Open in IMG/M
3300007542|Ga0099846_1236263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes637Open in IMG/M
3300007708|Ga0102859_1182888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes620Open in IMG/M
3300008221|Ga0114916_1026126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1882Open in IMG/M
3300008448|Ga0114876_1212140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes641Open in IMG/M
3300008470|Ga0115371_10206427Not Available1856Open in IMG/M
3300009165|Ga0105102_10086365All Organisms → Viruses → Predicted Viral1450Open in IMG/M
3300009165|Ga0105102_10797883All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes537Open in IMG/M
3300009172|Ga0114995_10191737Not Available1136Open in IMG/M
3300009180|Ga0114979_10641693All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes604Open in IMG/M
3300009183|Ga0114974_10220831All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1147Open in IMG/M
3300009432|Ga0115005_10404222All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1083Open in IMG/M
3300010158|Ga0114960_10114765All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1483Open in IMG/M
3300010160|Ga0114967_10597948All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes530Open in IMG/M
3300010233|Ga0136235_1052972All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes828Open in IMG/M
3300010368|Ga0129324_10020598All Organisms → Viruses → Predicted Viral3263Open in IMG/M
3300010970|Ga0137575_10000180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes12985Open in IMG/M
3300011011|Ga0139556_1015088Not Available1110Open in IMG/M
3300012524|Ga0129331_1131232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes731Open in IMG/M
3300012953|Ga0163179_10657187All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes885Open in IMG/M
(restricted) 3300013127|Ga0172365_10782000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes538Open in IMG/M
(restricted) 3300013131|Ga0172373_10044367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3949Open in IMG/M
3300014811|Ga0119960_1002739Not Available1091Open in IMG/M
3300014811|Ga0119960_1025645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes810Open in IMG/M
3300015050|Ga0181338_1033688All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes775Open in IMG/M
3300017700|Ga0181339_1019868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes755Open in IMG/M
3300017707|Ga0181363_1005211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2826Open in IMG/M
3300017716|Ga0181350_1097217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes729Open in IMG/M
3300017723|Ga0181362_1056931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes807Open in IMG/M
3300017725|Ga0181398_1071535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes832Open in IMG/M
3300017736|Ga0181365_1106076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes678Open in IMG/M
3300017754|Ga0181344_1051490All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1228Open in IMG/M
3300017754|Ga0181344_1135192All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes706Open in IMG/M
3300017761|Ga0181356_1230340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes535Open in IMG/M
3300017766|Ga0181343_1068557All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1026Open in IMG/M
3300017774|Ga0181358_1197971All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes659Open in IMG/M
3300017785|Ga0181355_1054885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1688Open in IMG/M
3300018420|Ga0181563_10071587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2351Open in IMG/M
3300019784|Ga0181359_1043082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1748Open in IMG/M
3300020109|Ga0194112_10590185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes760Open in IMG/M
3300020387|Ga0211590_10035744All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1463Open in IMG/M
3300021519|Ga0194048_10060041All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1514Open in IMG/M
3300021962|Ga0222713_10400178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes845Open in IMG/M
3300021963|Ga0222712_10580987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes650Open in IMG/M
3300022063|Ga0212029_1000795All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2404Open in IMG/M
3300022063|Ga0212029_1070800All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes513Open in IMG/M
3300022176|Ga0212031_1010101All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1322Open in IMG/M
3300022179|Ga0181353_1002080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4274Open in IMG/M
3300022179|Ga0181353_1028587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1477Open in IMG/M
3300022190|Ga0181354_1062830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1234Open in IMG/M
3300022745|Ga0228698_1044455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1056Open in IMG/M
3300022747|Ga0228703_1076301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes829Open in IMG/M
3300022748|Ga0228702_1070187All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes885Open in IMG/M
3300023179|Ga0214923_10254669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes987Open in IMG/M
3300024262|Ga0210003_1245948All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes709Open in IMG/M
3300024545|Ga0256347_1060154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes846Open in IMG/M
3300024549|Ga0256308_1007393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2349Open in IMG/M
3300024552|Ga0256345_1058280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes750Open in IMG/M
3300024567|Ga0256307_1100579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes672Open in IMG/M
3300024850|Ga0255282_1040414All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes832Open in IMG/M
3300025110|Ga0208158_1034106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1292Open in IMG/M
3300025137|Ga0209336_10127765All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes691Open in IMG/M
3300025266|Ga0208032_1093278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes590Open in IMG/M
3300025674|Ga0208162_1200508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes507Open in IMG/M
3300026405|Ga0256296_1025052All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes716Open in IMG/M
3300027139|Ga0255082_1029315All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes895Open in IMG/M
3300027153|Ga0255083_1087055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes584Open in IMG/M
3300027212|Ga0208554_1028881All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes895Open in IMG/M
3300027494|Ga0255094_1040507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes886Open in IMG/M
3300027668|Ga0209482_1176862All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes608Open in IMG/M
3300027693|Ga0209704_1042666All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1227Open in IMG/M
3300027732|Ga0209442_1252754All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes629Open in IMG/M
3300027733|Ga0209297_1244849All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes690Open in IMG/M
3300027743|Ga0209593_10048849All Organisms → Viruses → Predicted Viral1632Open in IMG/M
3300027744|Ga0209355_1080774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1506Open in IMG/M
3300027752|Ga0209192_10213003All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes730Open in IMG/M
3300027763|Ga0209088_10187583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes892Open in IMG/M
3300027785|Ga0209246_10305709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes610Open in IMG/M
3300027793|Ga0209972_10322391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes675Open in IMG/M
3300027813|Ga0209090_10487110All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes577Open in IMG/M
3300027816|Ga0209990_10178449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes994Open in IMG/M
3300027956|Ga0209820_1081100All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes873Open in IMG/M
3300028178|Ga0265593_1074447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes934Open in IMG/M
3300028298|Ga0268280_1101758All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes778Open in IMG/M
3300028393|Ga0304728_1268476All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes564Open in IMG/M
3300031378|Ga0308145_1042979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes694Open in IMG/M
3300031510|Ga0308010_1182259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes768Open in IMG/M
3300031578|Ga0307376_10091299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2152Open in IMG/M
3300031602|Ga0307993_1058081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes973Open in IMG/M
3300031637|Ga0302138_10180966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes711Open in IMG/M
3300031857|Ga0315909_10957073All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes522Open in IMG/M
3300031951|Ga0315904_10896080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes717Open in IMG/M
3300031999|Ga0315274_10687543Not Available1109Open in IMG/M
3300032046|Ga0315289_11286257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes580Open in IMG/M
3300032050|Ga0315906_10597814All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes909Open in IMG/M
3300032053|Ga0315284_10638708All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1263Open in IMG/M
3300032093|Ga0315902_10955010All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes651Open in IMG/M
3300032116|Ga0315903_10442311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1045Open in IMG/M
3300032116|Ga0315903_10593566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes852Open in IMG/M
3300032116|Ga0315903_11171446All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes521Open in IMG/M
3300033233|Ga0334722_11089034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes561Open in IMG/M
3300034021|Ga0335004_0198968All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1251Open in IMG/M
3300034063|Ga0335000_0251596Not Available1110Open in IMG/M
3300034093|Ga0335012_0149475All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1272Open in IMG/M
3300034095|Ga0335022_0406186All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes735Open in IMG/M
3300034101|Ga0335027_0400958All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes890Open in IMG/M
3300034103|Ga0335030_0530126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes737Open in IMG/M
3300034106|Ga0335036_0553727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes707Open in IMG/M
3300034120|Ga0335056_0265301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes964Open in IMG/M
3300034122|Ga0335060_0235908All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1025Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake19.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater8.53%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.53%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater6.98%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.98%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.43%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.43%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.10%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.88%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater2.33%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.55%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic1.55%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.55%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.55%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.55%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.55%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.55%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.78%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.78%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.78%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.78%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.78%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.78%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.78%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.78%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.78%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.78%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.78%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.78%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.78%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.78%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300001580Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6EngineeredOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004124Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004810Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300005739Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300008221Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66EnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300010158Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010233Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA.EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010970Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016EnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017700Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.DEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020387Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX556119-ERR599023)EnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022745Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MGEnvironmentalOpen in IMG/M
3300022747Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MGEnvironmentalOpen in IMG/M
3300022748Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MGEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024545Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024549Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024552Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024567Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024850Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025266Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300026405Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027139Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8hEnvironmentalOpen in IMG/M
3300027153Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8hEnvironmentalOpen in IMG/M
3300027212Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027494Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8dEnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027744Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028178Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36mEnvironmentalOpen in IMG/M
3300028298Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40mEnvironmentalOpen in IMG/M
3300028393Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031378Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_319_33.10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031637Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1024254413300000101MarineMSATSAPFGFRASYHNSGQIIAKAYTLASGYAQNVFQ
Draft_1011952613300001580Hydrocarbon Resource EnvironmentsMSSTSAPFGFRPSFHNSGQMRPKAYTIASTYAANIFAGDPVKLTDNGVIQLGTSDGTRSGTTD
KVRMV2_10051608233300002231Marine SedimentMSSATKAAGFRPIYHPSGQIRPKKYTIASGSAVSIFNGDPVKLVDAG
B570J40625_10172645623300002835FreshwaterMSSTSAPFGFRPSFHNSGQMRPKAYVIASTYAANIFSGDPVKLTDNGVIQLGTSDGTRSGTTDG
Ga0066178_1008333823300004124Freshwater LakeMSSTSAPFGFRPSFHNSGQMRPKAYTIASTYAANIFQGDPV
Ga0066224_103180023300004457MarineMSTTTEAFGFRASYHNSGRITAKAYTIASGYAQNVFSGDPVKLVDAGTIQLATSDG
Ga0007757_1146517423300004810Freshwater LakeMSSTSAPFGFRASFHNSGQIRPKAYTIASAYAANIFSGDP
Ga0070374_1019447413300005517Freshwater LakeMSSTSAPFGFRPSFHNSGQMRPKAYTIASTYAANIFQGDPVKLTDAGVIQLGSSDGTRAGTTD
Ga0068876_1025635213300005527Freshwater LakeMSSTSAPFGFRPSFHNSGQMRPKAYTITSTYAANIFSGDPVKLTDNGVVELGTSDGTRSG
Ga0049083_1008515933300005580Freshwater LenticMSSTSAPFGFRASFHNSGQIRPKAYVIASAYAASIYSGDPVKL
Ga0049084_1014141813300005585Freshwater LenticMSSTSAPFGFRASFHNSGQIRPKAYVIASAYAASIFAGDPVKLVDAGTIQLGTSDGTRTG
Ga0076948_112765413300005739Lake WaterMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFSGDPVK
Ga0098037_100261213300006737MarineMSSTSAPFGFRPSYHNSGRITAKAYVIATGYAQNVFQ
Ga0075464_1086910523300006805AqueousMSSTSAPFGFRASFHNSGQIRPKAYVIASGYAANIFQGDPV
Ga0070750_1041857413300006916AqueousMSSTSAPFGFRPSYHNSGQMRPKAYTIASGYAVGIFSGDPVKLTDAGV
Ga0070748_129519213300006920AqueousMSSTSAPFGFRASFHNSGQMRPKAYTVASAYAANIF
Ga0102978_101395513300007177Freshwater LakeMSSTSAPFGFRASYHNSGQMRPKAYTIASTYAANIFSGDPVKLTD
Ga0102978_127315213300007177Freshwater LakeMSSTSAPFGFRPSFHNSGQMRPKAYTIASTYAANIFSGDPVKLTDNGVIQLGT
Ga0099851_1001682103300007538AqueousMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFSGDPVKLTDNGVI
Ga0099846_100491413300007542AqueousMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFSGDPVKLTDNGVIELGTSD
Ga0099846_123626313300007542AqueousMSSTSAPFGFRPSFHNSGQIRSKAYAITSAYAANIFSGDPVKLAA
Ga0102859_118288813300007708EstuarineMSSTSAPFGFRASFHNSGQIRPKAYVIASGYAANIF
Ga0114916_102612643300008221Deep OceanMSSTTEAFGFRASYHNSGRITAKAYTIASGYAQNVFSGDPVKLVDTGVIQLA
Ga0114876_121214023300008448Freshwater LakeMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAVNIFSGDP
Ga0115371_1020642733300008470SedimentMSATTEAFGFRASYHNSGRITAKAYTIASGYAQNIFSGDPVKLVDTGVIASHI*
Ga0105102_1008636533300009165Freshwater SedimentMSSTSAPFGFRPSFHNSGQMRPKAYTIASTYAANVFQGDPVKLTDNGV
Ga0105102_1079788313300009165Freshwater SedimentMSSTSAPFGFRPSFHNSGQMRPKAYTIASTYAANIFQGDPVKLTDAGVIQLGSSDGTRDGTTDGISLL
Ga0114995_1019173713300009172MarineMSTTTEAFGFRASYHNSGRITAKAYTIASGYAQNVFSGDPVKLVDAGT
Ga0114979_1064169313300009180Freshwater LakeMSSISAPFGFRASYHNSGQMRPKAYVIASTYAANIFSGDPVKLTDAGVIQLGTSDGTRSGTTDG
Ga0114974_1022083113300009183Freshwater LakeMSAISAPFGFRPSYHNSGQMRPKAYTIASTYAANIFSGDPVKLTDNG
Ga0115005_1040422213300009432MarineMSATTEAFGFRASYHNSGRITAKAYTIASGYAQNV
Ga0114960_1011476513300010158Freshwater LakeMSTTSAPYGFRPSFHNSGQMRPKAYTIASAYAASI
Ga0114967_1059794813300010160Freshwater LakeMSSTSAPFGFRPSYHNSGQMRPKAYVITSGYAQNVFSGDPVKL
Ga0136235_105297233300010233FreshwaterMASVSAPFGFRPSFHNSGQIRAKAYVIASGYPTSVFSGDPVKLTVNGVVQLRTS
Ga0129324_1002059873300010368Freshwater To Marine Saline GradientMSSTSAPFGFRASFHNSGNMRPKAYTVASTYAANIFSGDPVKMTDNGVIQLGTSDGT
Ga0137575_1000018013300010970Pond Fresh WaterMSSTSAPFGFRASYHNSGQMRPKAYVIASTYAANIFSGDPVKLTDNGV
Ga0139556_101508813300011011FreshwaterMSSISAPFGFRASYHNSGQMRPKAYVIASAYAANIFSGDPVKLTDN
Ga0129331_113123213300012524AqueousMSATSAPFGFRPSYHNSGRITAKAYVIASGYAQNIFQGDPVKLTDAGTIQLATSD
Ga0163179_1065718713300012953SeawaterMSATSAPFGFRPSYHNSGRITAKAYVIASGYAQNVFQGDPVK
(restricted) Ga0172365_1078200013300013127SedimentMSSSSTPFGFRASYHNSGQIRPKAYAIASGYAINLFAGDPVKLINTGTIELGTN
(restricted) Ga0172373_1004436713300013131FreshwaterMSATSAAFGFRPSFHNSGQMRPKAYVIASGYAVNIFSGDPVKLVDA
Ga0119960_100273933300014811AquaticMTATSAPFGFRASFHNSGQMRPKAYAIASGYAVSIFSGDPVKLIDTGFVNLGS*
Ga0119960_102564513300014811AquaticMSSISAPFGFRASFHNSGQMRPKAYVIASTYAANIFSGTPDRDWETS
Ga0181338_103368823300015050Freshwater LakeMSSTSAPFGFRASYHNSGQMRPKAYVIASTYAANIFS
Ga0181339_101986823300017700Freshwater LakeMSSTSAPFGFRPSYHNSGQMRPKAYTITSTYAANIFSGDPVKLTD
Ga0181363_100521173300017707Freshwater LakeMSSTSAPFGFRPSYHNSGQMRPKAYVIASAYAANIFSGDPVKL
Ga0181350_109721723300017716Freshwater LakeMSSTSAPFGFRASFHNSGQIRPKAYTIASTYAANIF
Ga0181362_105693123300017723Freshwater LakeMSSTSAPFGFRASFHNSGQIRPKAYTIASTYAANIFSGDPVKLVDAGTVQLG
Ga0181398_107153533300017725SeawaterMSATSAPFGFRPSYHNSGRITAKAYVIASGYAQNIFQG
Ga0181365_110607613300017736Freshwater LakeMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFSGDPVKLTDNGVIQLGTS
Ga0181344_105149013300017754Freshwater LakeMSSTSAPFGFRPSYHNSGQMRPKACVIASAYAANIFSGDPVKLTDNGVVQLGTSDGTRSGTV
Ga0181344_113519223300017754Freshwater LakeMSSTSAPYGFRPSFHNSGQMRPKAYTIASTYATSIYSGDPVKLVAAGTIQLGTSDGTRSGTTDGISLLGIFAGVEYLDSTGK
Ga0181356_123034013300017761Freshwater LakeMSSTSAPFGFRASFHNSGQMRPKAYTIASTYAANI
Ga0181343_106855733300017766Freshwater LakeMSSTSAPFGFLHSYHHRGQMRPKAYTNASTYAENIFSGD
Ga0181358_119797113300017774Freshwater LakeMSSISAPFGFRASYHNSGQMRPKAYVIASAYAANIFSGDPVKLTDNGVIQLGS
Ga0181355_105488533300017785Freshwater LakeMSSISAPFGFRASYHNSGQMRPKAYVIASAYAANIF
Ga0181563_1007158713300018420Salt MarshMSSTSAPFGFRASFHNSGQIRPKAYVIASGYAANIFQGDPVKLVDAGTVQLGTSDGTRSG
Ga0181359_104308213300019784Freshwater LakeMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFQGDPVKLVDAGTVQLGTSDG
Ga0194112_1059018513300020109Freshwater LakeMSSTSAPFGFRPSYHNSGQMRPKAYTIASAYAANIFSGDPVKLTDNGVIQLGTSDG
Ga0211590_1003574433300020387MarineMSSVSAPFGFRASYHNSGQIIAKAYTIASGYAQNVFQG
Ga0194048_1006004133300021519Anoxic Zone FreshwaterMTATSAPFGFRASFHNSGQMRPKAYAIASGYAVSIFSGDPVKLIDTGFV
Ga0222713_1040017813300021962Estuarine WaterMSTTSAPYGFRPSFHNSGQIRPKAYTIATGYAATIFSGDPVKLISTG
Ga0222712_1058098713300021963Estuarine WaterMSSTSAPFGFRASFHNSGQMRPKAYVIASTYAANIFSGDPVKLTDNGVIQLGTS
Ga0212029_100079513300022063AqueousMSSTSAPFGFRPSFHNSGQMRPKAYVIASAYAVNIFAGDPVN
Ga0212029_107080023300022063AqueousMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFSGDPVKLTDNGVVQLGT
Ga0212031_101010133300022176AqueousMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFQGDPVKLTDAGVIQLGTSDGTRSV
Ga0181353_100208073300022179Freshwater LakeMSSTSAPFGFRPSFHNSGQMRPKAYVITSGYGVNIFSGDPVKLTDSGVVELGTSD
Ga0181353_102858713300022179Freshwater LakeMSSTSAPFGFRPSFHNSGQMRPKAYVITSGYGVNIFSGDPVKLTDNGVVELGTS
Ga0181354_106283033300022190Freshwater LakeMSSTSAPFGFRASYHNSGQMRPKAYTIASTYAANIFSGDPVKLTDNGVVQLGTSDGTRTG
Ga0228698_104445513300022745FreshwaterMSSTSAAFGFRPSYHNSGNIRPKAYTIATGYAANIFNGDPVKLVT
Ga0228703_107630113300022747FreshwaterMSSTSAPFGFRPSFHNSGNIRSKVYTIAAAYSTAIFTGDLVT
Ga0228702_107018733300022748FreshwaterMSSTSAPFGFRPSFHNSGNIRSKVYTIAAAYSTAIFTGDLVTLTLDGVINQAGV
Ga0214923_1025466933300023179FreshwaterMSSTSAPFGFRASFHNSGQIRPKAYVIASGYAANIFQGDPVKLVDAGTVQLGTSDGT
Ga0210003_124594813300024262Deep SubsurfaceMSATSAPFGFRPSYHNSGRITAKAYVIASGYAQNVFQGDPVKLTDAGIIQLATSD
Ga0256347_106015423300024545FreshwaterMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFLG
Ga0256308_100739353300024549FreshwaterMASVSAPFGFRASFHNSGQIRPKAYVIASGYATSIYSGDPVKLVDAGTVQLGTSDGT
Ga0256345_105828023300024552FreshwaterMSSTSAPFGFRPSFHNSGQMRPKAYTIASTYAANIFSGDPVKLTDDGVIELGTSDGTRSG
Ga0256307_110057923300024567FreshwaterMSSTSAPFGFRPSYHNSGQMRPKAYVIASAYAANIF
Ga0255282_104041423300024850FreshwaterMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAASIFSGDPVKLTDNGVIQLGT
Ga0208158_103410613300025110MarineMSATSAPFGFRPSYHNSGRITAKAYVIASGYAQNVF
Ga0209336_1012776513300025137MarineMSATSAPFGFRPSYHNSGRITAKAYVIASGYAQNVFQGDPVKLTDNGVVQLATSD
Ga0208032_109327813300025266Deep OceanMSSTTEAFGFRASYHNSGRITAKAYTIASGYAQNVFS
Ga0208162_120050823300025674AqueousMSSTSAPFGFRPSYHNSGQMRPKAYTIASGYAVGIFSGDPVKLTDA
Ga0256296_102505223300026405FreshwaterMSSTSAPFGFRPSYHNSGQMRPKAYVIASAYAANIFSGDPVKLTDNGVV
Ga0255082_102931533300027139FreshwaterMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFSGDPVKLTDNGVIQ
Ga0255083_108705513300027153FreshwaterMSSTSAPFGFRASYHNSGQMRPKAYVIASTYAANIFSGDPVKLTDNGVIQLGSSDGTR
Ga0208554_102888133300027212EstuarineMSTTSAPYGFRPSFHNSGQIRPKAYTIATGYAATIFSGDPVKLVSTGTIQIGSSDGT
Ga0255094_104050713300027494FreshwaterMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFSGDPVKLTDNGVVQLGTSDGT
Ga0209482_117686223300027668MarineMSATTEAFGFRASYHNSGRITAKAYTIASGYNQNVFSGDPVKLVDAGTVQLATSNG
Ga0209704_104266613300027693Freshwater SedimentMSSTSAPFGFRPSFHNSGQMRPKAYTITSGFAANIFQGDPVKLTDNGVIELGTS
Ga0209442_125275413300027732Freshwater LakeMSSTSAPFGFRPSFHNSGQMRPKAYTIASTYAANIFSGD
Ga0209297_124484913300027733Freshwater LakeMSTTSAPYGFRPAFHNSGQMRPKAYTIASTYAASI
Ga0209593_1004884913300027743Freshwater SedimentMSSTSAPFGFRPSFHNSGQMRPKAYTIASTYAANVFQGDPVKLTDNGVVQLGTSDGTRDGTVDGILL
Ga0209355_108077433300027744Freshwater LakeMSSTSAPFGFRPSYHNSGQMRPKAYTIASTYAANIFQGDPVKLVDAGTVQLGTSDGT
Ga0209192_1021300323300027752MarineMSATTEAFGFRASYHNSGRITAKAYTIASGYAQNIFSGDPV
Ga0209088_1018758313300027763Freshwater LakeMSTTSAPYGFRPAFHNSGQMRPKAYTIASTYAASIYSGDPVKLVTAGTIQLGTSD
Ga0209246_1030570913300027785Freshwater LakeMSTTSAPYGFRPSFHNSGQMRPKAYTIASAYAASIY
Ga0209972_1032239113300027793Freshwater LakeMSSTSAPFGFRPSYHNSGQMRPKAYVIASAYAANIFSGDPVKLTDNGVIQLG
Ga0209090_1048711013300027813MarineMSATTEAFGFRASYHNSGRITAKAYTIASGYAQNIFSGDPVKLVDAGTIQLATSNGTR
Ga0209990_1017844933300027816Freshwater LakeMSSTSAPFGFRPSFHNSGQMRPKAYTITSTYAANIFSGDPVKLTDNGVVELGTSDGTR
Ga0209820_108110013300027956Freshwater SedimentMSSTSAPFGFRPSFHNSGQMRPKAYTIASTYAANIFQGDP
Ga0265593_107444733300028178Saline WaterMSSTSAPFGFVPSYHNSGQMRPKAYTVASTYATNIFSGDPVKLVD
Ga0268280_110175813300028298Saline WaterMASTSAPFGFRPSFHNSGQMRPKAYAIASGYAASIFSG
Ga0304728_126847623300028393Freshwater LakeMSTTSAPYGFRPSFHNSGQMRPKAYTIASAYAASIF
Ga0308145_104297923300031378MarineMSSTSSPFGFRPSYHNSGRITAKAYVITSGYAQNIFSGDP
Ga0308010_118225923300031510MarineMSATTEAFGFRASYHNSGRITAKAYTIASGYAQNVFSG
Ga0307376_1009129943300031578SoilMSATSAPFGFRPSYHNSGRITAKAYVIASGYAQNVFQGDPVKLT
Ga0307993_105808123300031602MarineMSATTEAFGFRASYHNSGRITAKAYTIASGYAQNVFSGDPVKLVDTGVIQLAT
Ga0302138_1018096633300031637MarineMSATTEAFGFRASYHNSGRITAKAYTIASGYAQNVFSGDPVKLVDAGTVQLAT
Ga0315909_1095707323300031857FreshwaterMSSTSAPFGFRASFHNSGQMRPKAYVIASTYAANIFSGDPVKLTDNGVIQLGTSDGTR
Ga0315904_1089608023300031951FreshwaterMSSISAPFGFRASYHNSGQMRPKAYVIASAYAANIFSGDPVKLT
Ga0315274_1068754313300031999SedimentMSSTSAPFGFRASFHNSGQIRPKAYVIASTYAASIFSGDPVKLVDAGTIQL
Ga0315289_1128625713300032046SedimentMSSTSAPFGFRASFHNSGQMRPKAYTIASTYAANIFEGDPVKLVDAGTVQL
Ga0315906_1059781413300032050FreshwaterMSSTSAPFGFRPSFHNSGQMRPKAYTITSTYAANIFSGDP
Ga0315284_1063870833300032053SedimentMSSTSAPFGFRASFHNSGQIRPKAYTIASTYAANIFSGDPVKLVDAGTVQLGTSDG
Ga0315902_1095501023300032093FreshwaterMSAISAPFGFRPSYHNSGQMRPKAYTITSAYAANIFSGDPVKLTDNGVIQLGTSDGTRS
Ga0315903_1044231113300032116FreshwaterMSSISAPFGFRASYHNSGQMRPKAYVIASAYAANIFSGDPVKLTDNGVIQLGSSDGTRT
Ga0315903_1059356623300032116FreshwaterMSSTSAPFGFRASYHNSGQMRPKAYTIASTYAANIFSGDPVKLTDAGVIQ
Ga0315903_1117144613300032116FreshwaterMSSTSAPFGFRPSFHNSGQMRPKAYTIASTYAANIFSGDPVKLT
Ga0334722_1108903423300033233SedimentMSSTSAAFGLRPSYHNSGQIRAKAYTLATGYAVNVFSGDTVKLTDAGVITLGTSDGTRT
Ga0335004_0198968_1_1203300034021FreshwaterMPSTSAPFGFRPSFHNSGQIRPKAYTIASTYATNIFSNDP
Ga0335000_0251596_948_11093300034063FreshwaterMSSTSAPFGFRPSFHNSGQMRPKAYAIASTYAANIFSGDPVKLTDNGVVQLGTS
Ga0335012_0149475_1095_12713300034093FreshwaterMSSTSAPFGFRASFHNSGQMRPKAYVIASTYAANIFSGDPVKLTDNGVIQLGTSDGTRS
Ga0335022_0406186_603_7343300034095FreshwaterMPSTSAPFGFRPSFHNSGQIRPKAYTIASTYATNIFSNDPVKLV
Ga0335027_0400958_745_8883300034101FreshwaterMSSTSAPFGFRPSFHNSGQMRPKAYVIASTYAANIFSGDPVKLTDNGV
Ga0335030_0530126_578_7363300034103FreshwaterMSSTSAPFGFRPSFHNSGQMRPKAYVIASTYAANIFSGDPVKLTDNGVIQLGT
Ga0335036_0553727_2_1153300034106FreshwaterMSSTSAPFGFRPSYHNSGQMRPKAYTIASAYAANIFSG
Ga0335056_0265301_830_9643300034120FreshwaterMSSTSAPFGFRASFHNSGQMRPKAYVIASTYAANIFSGDPVKLTD
Ga0335060_0235908_3_1763300034122FreshwaterMSSTSAPFGFRASYHNSGQIRPKAYTITSTYAANIFSGDPVKLTDNGVIQLGTSDGTR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.