| Basic Information | |
|---|---|
| Family ID | F063548 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSRRLRQAAVVFIVVFAAAQLVRPQRTNPATDVSRTIQAHVGTA |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.66 % |
| % of genes near scaffold ends (potentially truncated) | 94.57 % |
| % of genes from short scaffolds (< 2000 bps) | 94.57 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.698 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (6.977 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.783 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.310 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 31.94% β-sheet: 0.00% Coil/Unstructured: 68.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF12674 | Zn_ribbon_2 | 2.33 |
| PF05787 | DUF839 | 2.33 |
| PF02954 | HTH_8 | 2.33 |
| PF13380 | CoA_binding_2 | 1.55 |
| PF07883 | Cupin_2 | 1.55 |
| PF00561 | Abhydrolase_1 | 0.78 |
| PF07396 | Porin_O_P | 0.78 |
| PF02894 | GFO_IDH_MocA_C | 0.78 |
| PF13442 | Cytochrome_CBB3 | 0.78 |
| PF08241 | Methyltransf_11 | 0.78 |
| PF12704 | MacB_PCD | 0.78 |
| PF01022 | HTH_5 | 0.78 |
| PF05694 | SBP56 | 0.78 |
| PF10070 | DabA | 0.78 |
| PF00578 | AhpC-TSA | 0.78 |
| PF00903 | Glyoxalase | 0.78 |
| PF01979 | Amidohydro_1 | 0.78 |
| PF01292 | Ni_hydr_CYTB | 0.78 |
| PF00873 | ACR_tran | 0.78 |
| PF02627 | CMD | 0.78 |
| PF13941 | MutL | 0.78 |
| PF00072 | Response_reg | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG3211 | Secreted phosphatase, PhoX family | General function prediction only [R] | 2.33 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.78 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.78 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.78 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.78 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.78 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.78 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.78 |
| COG3746 | Phosphate-selective porin | Inorganic ion transport and metabolism [P] | 0.78 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.70 % |
| Unclassified | root | N/A | 9.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12435034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300000789|JGI1027J11758_12444172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300004281|Ga0066397_10145141 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300004480|Ga0062592_100600011 | Not Available | 935 | Open in IMG/M |
| 3300004480|Ga0062592_102310010 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005294|Ga0065705_10591381 | Not Available | 712 | Open in IMG/M |
| 3300005332|Ga0066388_100293521 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
| 3300005332|Ga0066388_102013130 | Not Available | 1036 | Open in IMG/M |
| 3300005332|Ga0066388_104673571 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005335|Ga0070666_11273970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300005343|Ga0070687_100608443 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005345|Ga0070692_10567977 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005354|Ga0070675_100419371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300005434|Ga0070709_10732767 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 771 | Open in IMG/M |
| 3300005446|Ga0066686_10870964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300005456|Ga0070678_101558289 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005459|Ga0068867_100946640 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300005526|Ga0073909_10038906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1674 | Open in IMG/M |
| 3300005536|Ga0070697_101684801 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005564|Ga0070664_100865141 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300005617|Ga0068859_102943995 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005618|Ga0068864_101142434 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005764|Ga0066903_101213582 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300005764|Ga0066903_104887726 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005764|Ga0066903_107643334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300005764|Ga0066903_108910681 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005836|Ga0074470_10137850 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005844|Ga0068862_101796935 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006791|Ga0066653_10650516 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006797|Ga0066659_10942343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300006845|Ga0075421_101803323 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300006852|Ga0075433_10175178 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300006854|Ga0075425_101789457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300006854|Ga0075425_102750957 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006871|Ga0075434_101774522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300006876|Ga0079217_10187891 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300007004|Ga0079218_12126205 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300009093|Ga0105240_12770370 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009094|Ga0111539_10607068 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300009098|Ga0105245_13168199 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300009100|Ga0075418_10179150 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
| 3300009100|Ga0075418_10511378 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300009100|Ga0075418_13017312 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009167|Ga0113563_11275464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → unclassified Thermoanaerobaculia → Thermoanaerobaculia bacterium | 858 | Open in IMG/M |
| 3300010043|Ga0126380_11107389 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010047|Ga0126382_11541038 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010358|Ga0126370_10845155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300010360|Ga0126372_11006594 | Not Available | 845 | Open in IMG/M |
| 3300010360|Ga0126372_11226104 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300010366|Ga0126379_12857813 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010375|Ga0105239_11571607 | Not Available | 760 | Open in IMG/M |
| 3300010398|Ga0126383_12918552 | Not Available | 558 | Open in IMG/M |
| 3300010401|Ga0134121_12198197 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300010403|Ga0134123_11992484 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300011444|Ga0137463_1250516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300012134|Ga0137330_1042947 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012206|Ga0137380_11226616 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012207|Ga0137381_10830256 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300012212|Ga0150985_121617631 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012354|Ga0137366_10026191 | All Organisms → cellular organisms → Bacteria | 4535 | Open in IMG/M |
| 3300012359|Ga0137385_10983683 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012360|Ga0137375_10598389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium RBG_13_65_8 | 919 | Open in IMG/M |
| 3300012469|Ga0150984_110649013 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300012503|Ga0157313_1040641 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012672|Ga0137317_1031295 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012931|Ga0153915_10195936 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
| 3300012931|Ga0153915_11680662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300012931|Ga0153915_12364749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 622 | Open in IMG/M |
| 3300013297|Ga0157378_10048434 | All Organisms → cellular organisms → Bacteria | 3779 | Open in IMG/M |
| 3300014262|Ga0075301_1048282 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300014318|Ga0075351_1149227 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300014326|Ga0157380_10932191 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300014326|Ga0157380_12370860 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300015372|Ga0132256_103004118 | Not Available | 567 | Open in IMG/M |
| 3300015372|Ga0132256_103790967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300015373|Ga0132257_103871087 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300015374|Ga0132255_103107665 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300016422|Ga0182039_10814369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300017966|Ga0187776_10358275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300018084|Ga0184629_10171889 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300018084|Ga0184629_10487704 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300018089|Ga0187774_10863567 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300018469|Ga0190270_11041513 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300018481|Ga0190271_11780443 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300019361|Ga0173482_10184037 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300019362|Ga0173479_10111125 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300021560|Ga0126371_10777786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1104 | Open in IMG/M |
| 3300024290|Ga0247667_1113052 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300025906|Ga0207699_11049271 | Not Available | 603 | Open in IMG/M |
| 3300025906|Ga0207699_11442977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300025930|Ga0207701_11042852 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300025935|Ga0207709_11445729 | Not Available | 570 | Open in IMG/M |
| 3300025961|Ga0207712_11743559 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026067|Ga0207678_10494704 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300026095|Ga0207676_11327262 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300026121|Ga0207683_10835219 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300026316|Ga0209155_1090614 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300026843|Ga0208126_1002616 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300026886|Ga0207982_1006326 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300027614|Ga0209970_1048785 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300027765|Ga0209073_10359463 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300027915|Ga0209069_10249342 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300028381|Ga0268264_11812861 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300028803|Ga0307281_10079420 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300031679|Ga0318561_10393062 | Not Available | 761 | Open in IMG/M |
| 3300031716|Ga0310813_11627816 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031720|Ga0307469_12085140 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031833|Ga0310917_10257701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1175 | Open in IMG/M |
| 3300031852|Ga0307410_11528720 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031890|Ga0306925_10161734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2411 | Open in IMG/M |
| 3300031896|Ga0318551_10591750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300031897|Ga0318520_10691369 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031908|Ga0310900_11101961 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031910|Ga0306923_10586215 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300031911|Ga0307412_11778208 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031912|Ga0306921_10311916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1841 | Open in IMG/M |
| 3300031945|Ga0310913_11319054 | Not Available | 500 | Open in IMG/M |
| 3300031954|Ga0306926_11171699 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300031995|Ga0307409_101199146 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300032094|Ga0318540_10535347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300032179|Ga0310889_10477002 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300032211|Ga0310896_10345066 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300033433|Ga0326726_12163464 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300033480|Ga0316620_12127166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → unclassified Thermoanaerobaculia → Thermoanaerobaculia bacterium | 558 | Open in IMG/M |
| 3300033513|Ga0316628_102794840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300033513|Ga0316628_103629511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300033551|Ga0247830_10740634 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300034151|Ga0364935_0145944 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.10% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.88% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.33% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.33% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.55% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.55% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.78% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.78% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.78% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012134 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012672 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026843 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA (SPAdes) | Environmental | Open in IMG/M |
| 3300026886 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_124350341 | 3300000789 | Soil | MSRRMKQAAIVFVAVFAAAQFVRPERATPATDVSRTIQ |
| JGI1027J11758_124441721 | 3300000789 | Soil | MSRRMKQAAIVFVAVFAAAQFVRPERATPATDVSRTXXAQ |
| Ga0066397_101451411 | 3300004281 | Tropical Forest Soil | MSRRLKQAAVVFVVVFAVAQLVRPEHANPATDPTRTIRAHMGDASGLPAVLDRACG |
| Ga0062592_1006000111 | 3300004480 | Soil | MKRRLRQGALVLVVAFAAAQLVRPQRANPPIDPARTIRAHVSPSSRLPAVLDR |
| Ga0062592_1023100102 | 3300004480 | Soil | VSTRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQAHVGTASGLVAV |
| Ga0065705_105913811 | 3300005294 | Switchgrass Rhizosphere | MSRRLRQAAVVFIVVFAAAQLVRPQRTNPATDVSRTIQAHVGTA |
| Ga0066388_1002935214 | 3300005332 | Tropical Forest Soil | VGRRLLQVAVVVVVLFAAAQLVRPPHSNPPIDASRTIEAHLGAANGLAAVLNRSC |
| Ga0066388_1020131301 | 3300005332 | Tropical Forest Soil | MSRRLKQAAVVFVAVLAAAQLIRPEHVNPPTDATRTIQAHETTKGLA |
| Ga0066388_1046735712 | 3300005332 | Tropical Forest Soil | MNRRLKQGAFVLVVVFAAAQLVRPERANPPTDVSRTIEAHVGTTSGLGAVLNRACSD |
| Ga0070666_112739702 | 3300005335 | Switchgrass Rhizosphere | MSRRMKQAATVFVAVFAAAQFVRPERAPPTTDVSRTIQAQIGTANGLAAVLD |
| Ga0070687_1006084432 | 3300005343 | Switchgrass Rhizosphere | VSRRLKQAAIALVAVFAAAQLVRPERANPPTGAHRTIQAHMPTGSGLVA |
| Ga0070692_105679771 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRRPKQAAVVFIIVFAAAQFVRPERANPATDARRTIQAHVG |
| Ga0070675_1004193711 | 3300005354 | Miscanthus Rhizosphere | VSRQLKRAAVVFIVVFAAAQLVRPERANPATDERRTIQAHVGTANGLVAVLDRACR |
| Ga0070709_107327672 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRRLKNAAIILIILFAAAQLVRPSHANPPTDASRAIQAHVSTHGLATILD |
| Ga0066686_108709641 | 3300005446 | Soil | MRRLKQAAVVFVVVFAAAQFVRPERANPATDPNRTIRAHMGTA |
| Ga0070678_1015582892 | 3300005456 | Miscanthus Rhizosphere | MRRRLKQAAVVFVVIFAAAQLVRPERTNPATDASHTIQAHVG |
| Ga0068867_1009466402 | 3300005459 | Miscanthus Rhizosphere | LKQAAVVFIIVFAAAQFVRPERANPATDVHRTIQAHVETASAR* |
| Ga0073909_100389063 | 3300005526 | Surface Soil | VRRRLKQAAVIFVVVFAAAQLVRPGRANPATDPSRTIQAHVGTASGLVAVLD |
| Ga0070697_1016848011 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRLQLAAIVVAAVFAAAQLIRPDRANPPTDAGRTIQAHPGTASGLVAVLDRACR |
| Ga0070664_1008651412 | 3300005564 | Corn Rhizosphere | MSRRMKQAATVFVAVFAAAQFVRPERAPPTTDVSRTIQA |
| Ga0068859_1029439951 | 3300005617 | Switchgrass Rhizosphere | MPKRLKQGAVVFIVVGAAAQLVRPDRANPATDDSRTIHAYLGAAAGLTAVLDRSCRD |
| Ga0068864_1011424341 | 3300005618 | Switchgrass Rhizosphere | MSRGVKQAAVVFVIVLAAAQLVRPEHANPATDATRTIQAHAGTTSELVAVLDRS |
| Ga0066903_1012135821 | 3300005764 | Tropical Forest Soil | MNRRTKQVAVVFVVLLAAAQLIRPDSTNPATDASHTIEAVVGTHDGLVAVLDRSC |
| Ga0066903_1048877262 | 3300005764 | Tropical Forest Soil | MRTRLKQAAIVFVVVFAAAQLVRPGRTNPTIDPSRTIQAHEGTTSELVAVLDR |
| Ga0066903_1076433341 | 3300005764 | Tropical Forest Soil | MSKRLKQAAVIFIVVLAAAQLVRPERANPPTDASRTIQAHVGTASGLAAVL |
| Ga0066903_1089106811 | 3300005764 | Tropical Forest Soil | VRTRVKRAAVVLTVVIVAAQLVRPGRANPATDASRTFAAHAG |
| Ga0074470_101378501 | 3300005836 | Sediment (Intertidal) | MKKRLKQATVAFLAVFALAQLVRPERANPPIDAGRTIRAH |
| Ga0068862_1017969351 | 3300005844 | Switchgrass Rhizosphere | MRRRLTQAVVIFGVVFAAAQLVRPDRTNPPIDPSRTIQAH |
| Ga0066653_106505161 | 3300006791 | Soil | VSRRLKQAVVVLVVVFAAAQLVRPGRGNPPTNPSRTIQAHVPTTSGLAAV |
| Ga0066659_109423431 | 3300006797 | Soil | MNRRLKQAVLVFIVVFAAAQLIRPERANPATDVSRTIEAHV |
| Ga0075421_1018033231 | 3300006845 | Populus Rhizosphere | VSRRLKQSVVVFVVVFAAAQLVRPERANPATDATRAIQAHAGTTSELVA |
| Ga0075433_101751783 | 3300006852 | Populus Rhizosphere | VSRRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQARVGTASGES* |
| Ga0075425_1017894571 | 3300006854 | Populus Rhizosphere | VSRAPRRIAVSRRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQARVGTASGES* |
| Ga0075425_1027509571 | 3300006854 | Populus Rhizosphere | MTRAKQAAVVLILVLAAAQLVRPERANPPIDPSRTIQAQLGTASE |
| Ga0075434_1017745221 | 3300006871 | Populus Rhizosphere | VNRRVKQAVIVIVVVVAAAQLVRPERANPPTDADRTIQ |
| Ga0079217_101878912 | 3300006876 | Agricultural Soil | VSTRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQAHV |
| Ga0079218_121262051 | 3300007004 | Agricultural Soil | VSGRLKQAAVVFIIVLAAAQFVRPERANPATDARRTIQAHVGTASGLVAV |
| Ga0105240_127703701 | 3300009093 | Corn Rhizosphere | VSRRLKQAAIVILAVFAAAQLVRPARTNPATDSSRT |
| Ga0111539_106070683 | 3300009094 | Populus Rhizosphere | VSTRLKQAAVVFIVVFAAAQLVRPERANPATDATRTIQAHTGTT |
| Ga0105245_131681992 | 3300009098 | Miscanthus Rhizosphere | MNRRLKQAAVVFVFVFAAAQFVRPERANPATDVGRTIQAHGGTTSGLVAV |
| Ga0075418_101791504 | 3300009100 | Populus Rhizosphere | MSRRLTLVAVTVVLAFAVAQLVRPARANPPTDPSRTIQAHLGTAPE |
| Ga0075418_105113781 | 3300009100 | Populus Rhizosphere | MTRRLRQAAILFVVVFAAAQLIRPERANPPTDPSHTFQAQAGTA |
| Ga0075418_130173122 | 3300009100 | Populus Rhizosphere | MIRRLKQAAVVLVIVLAAAQLVRPDRENPATNATRTIRAHAGTT |
| Ga0113563_112754643 | 3300009167 | Freshwater Wetlands | MSRRMKQAGVVFVVVFAAAQLVRPDRRNPATDATRTI* |
| Ga0126380_111073891 | 3300010043 | Tropical Forest Soil | MSRRLKQAAVVFVVVFAAAQLVRPEHANPATDPTRTIRAHMGEASGLPAVLDRACREC |
| Ga0126382_115410381 | 3300010047 | Tropical Forest Soil | MARRLKQAAVLFVVVFATAQLVRPERANPSTDESRTIQAHVKNAGGMV |
| Ga0126370_108451551 | 3300010358 | Tropical Forest Soil | MGRRLKQAAIVFVVLFAAAQLVRPSRANPPTDPGRTIQAHETTRGL |
| Ga0126372_110065941 | 3300010360 | Tropical Forest Soil | MSRRLKRVAVVFVVVLAAAQLVRPERTNPATDAGR |
| Ga0126372_112261041 | 3300010360 | Tropical Forest Soil | MRRRLTQAVVVFLVLFAAAQLVRPGRTNPPTDPSRTIR |
| Ga0126379_128578132 | 3300010366 | Tropical Forest Soil | MTKRLAYAAIIVVVVLAGAQLIRPNRANPPTDPSRTIQAHLGA |
| Ga0105239_115716072 | 3300010375 | Corn Rhizosphere | MSRRLKQVAGVFFIVFAAAQFVRPERANPPTDVSRAIQAQVGTGSALVAVLDRACSD* |
| Ga0126383_129185522 | 3300010398 | Tropical Forest Soil | MSRRLKQGAIVLVVVLAVAQLIRPSRANPPIDPARTIQAHET |
| Ga0134121_121981971 | 3300010401 | Terrestrial Soil | MPKRLKKGAVVFVVVVAAAQLVRPDRANPATDASRSI |
| Ga0134123_119924841 | 3300010403 | Terrestrial Soil | MRRRLVQASVLFVVVFAAAQLVRPERTNPVTDPTRTIRAHVAETSQLPV |
| Ga0137463_12505161 | 3300011444 | Soil | MSRRLKQIAIVFIVVFAAAQLIRPERTNPPTDPSRTIEAQMKTASGLVAVL |
| Ga0137330_10429472 | 3300012134 | Soil | VSRRLKQAAVVFIIVLAAAQFVRPGRANPASDARRTIQAQVGTASGLVAVLDRAC |
| Ga0137380_112266162 | 3300012206 | Vadose Zone Soil | MPISRRLKQAAVVFVVVFAAAQLVRPERANPATDVSRTIQ |
| Ga0137381_108302561 | 3300012207 | Vadose Zone Soil | MPISRRLKQAAVVFVVVFAAAQLVRPERANPATDVSRTIQAHAG |
| Ga0150985_1216176312 | 3300012212 | Avena Fatua Rhizosphere | VSKRLKQAAIVIVVLFAAAQLLRPDQTNPPTDPGRTIQAQVGTA |
| Ga0137366_100261915 | 3300012354 | Vadose Zone Soil | MSRRLKLAAVVFVVFAAAQLVRPERANPATNASHTIQAEAGTAIGLVAV |
| Ga0137385_109836831 | 3300012359 | Vadose Zone Soil | MPISRRLKQAAVVFVVVFAAAQLVRPERANPATDVSRTIQAHAGTATELVAVLDRACRD |
| Ga0137375_105983893 | 3300012360 | Vadose Zone Soil | MSRRLKLAAIVFVVFAAAQLVRPERANPATDASRTIQAH |
| Ga0150984_1106490131 | 3300012469 | Avena Fatua Rhizosphere | LTQAAILIAVVVVAAQLVRPERATPVTDANRTIQAQMPTGSELVAVLDRSC |
| Ga0157313_10406412 | 3300012503 | Arabidopsis Rhizosphere | MRRRLVQATVLFVVVFAAAQLVRPERTNPATDPTRTIRAHVAEASQLPAVL |
| Ga0137317_10312952 | 3300012672 | Soil | VSTRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQA |
| Ga0153915_101959361 | 3300012931 | Freshwater Wetlands | MSRRLKRAAVVLLVVFAAAQLVRPNRANPPTDVSRTMQAQV |
| Ga0153915_116806621 | 3300012931 | Freshwater Wetlands | MSRRLKQVAIVFVVVVVAAQLVRPGRANPATDASRTIQAHMGTASGLVAVLDR |
| Ga0153915_123647491 | 3300012931 | Freshwater Wetlands | MSRRLKQAAVVLVVVFAAAQLVRPNRANPPTDVSRT |
| Ga0157378_100484346 | 3300013297 | Miscanthus Rhizosphere | MRRRLKQAAVVFVVIFAAAQLVRPERTDPAPDASHTIQAH |
| Ga0075301_10482821 | 3300014262 | Natural And Restored Wetlands | MTRRLKWVAVVFVVVFAAAQLVRPDRSNPATDANRTIQ |
| Ga0075351_11492271 | 3300014318 | Natural And Restored Wetlands | MSRRVKQAAVVFVVVFAAAQLIRPERAKPPTDVSRTIQAHVGAASG |
| Ga0157380_109321912 | 3300014326 | Switchgrass Rhizosphere | VSRRLKSAAVVFVAVFAAAQLVRPERANPATDVSRTIQAQVGTANG |
| Ga0157380_123708602 | 3300014326 | Switchgrass Rhizosphere | MAVSRRLKQATIVIIVVFAAAQLVRPERTNPTTDVGRALQAQMPTGSGLVAVLDR |
| Ga0132256_1030041182 | 3300015372 | Arabidopsis Rhizosphere | MSRRLMQAAVVFLIAFAGAQLVRPGPANLPVDDSRTIAAHVGTASGLAGGGPRREQRK |
| Ga0132256_1037909672 | 3300015372 | Arabidopsis Rhizosphere | MRRRHQAVVVFVAVFAAAQLIRPGRTNPPTDGSRTIEAHVGTTSGLA |
| Ga0132257_1038710872 | 3300015373 | Arabidopsis Rhizosphere | MRTRLKQAAVVFVIVVAAAQLIRPGRANPAIDVNRTIQAHAGTASGLV |
| Ga0132255_1031076653 | 3300015374 | Arabidopsis Rhizosphere | MRRLKQALLVFVILFAAAQLVRPERANPAIETSRTIAAHLGAANGLT |
| Ga0182039_108143693 | 3300016422 | Soil | MSRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGRTIQAHAGTAS |
| Ga0187776_103582752 | 3300017966 | Tropical Peatland | MSKRVKQIVIGVVAVFAAAQLIRPARTNPPVDSSRTIQAHVATASGLGAVLDRAC |
| Ga0184629_101718892 | 3300018084 | Groundwater Sediment | VVFVVIVAAAQLFRPERANPAIDASRTIQAHPGTASGLVA |
| Ga0184629_104877041 | 3300018084 | Groundwater Sediment | MSRRVKQAAAVFGSVSAAAQFVRPERANPATDATRTIQAHVGTTRELVAVLDRSCRD |
| Ga0187774_108635671 | 3300018089 | Tropical Peatland | MSRRLTQATVVFVVIFAGAQLVRPDRANPPTDPSRTIQAHTGAS |
| Ga0190270_110415133 | 3300018469 | Soil | VSRRLKQAAVIFIIVLAAAQLVRPERANPATDARRTIQAHVGTARGLVAVL |
| Ga0190271_117804432 | 3300018481 | Soil | MRRRLKQVGVVFVVAFAAAQLVRPERANPPTDPSRTIQAHIGSASG |
| Ga0173482_101840371 | 3300019361 | Soil | MKRLKRAALVFIVVFAAAQLVRPERANPPIDPALTIQTYVGTESGL |
| Ga0173479_101111251 | 3300019362 | Soil | MGRRLKQAAVVFVVIVAAAQLIRPERANPPTDVSRTIQAQVGTASGLVAVLDRSCRD |
| Ga0126371_107777862 | 3300021560 | Tropical Forest Soil | MSRRLKWAAVVIVAVLAAAQLIRPERTNPPTDEGRTIQAH |
| Ga0247667_11130522 | 3300024290 | Soil | MKRRVKQAAVVFVVVLAAAQLVRPERANPPIDTSRTIQAHMGTSS |
| Ga0207699_110492712 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRMKHVAIVFAAVFSAAQFVRPERGTPQTDVSRTIQAQVGT |
| Ga0207699_114429771 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRMKQAATVFVAVFAAAQFVRPERAPPTTDVSRT |
| Ga0207701_110428521 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRLVQATVLFVVVFAAAQLVRPERTNPATDPTRTI |
| Ga0207709_114457292 | 3300025935 | Miscanthus Rhizosphere | MSKRIKQAAMVFVAVFAAAQFVRPERTQPPTDVSRAIQAQIGTASGLAAVLDRACSD |
| Ga0207712_117435591 | 3300025961 | Switchgrass Rhizosphere | VSRRLKQAAIALVAVFAAAQLVRPERANPPTGAHRTIQAHMPTGSGL |
| Ga0207678_104947041 | 3300026067 | Corn Rhizosphere | VSRRSKQAAVVFVIVFAAAQLVRPERANPAIDARRTIQAHVGTASGLVADLDRACSD |
| Ga0207676_113272621 | 3300026095 | Switchgrass Rhizosphere | MSRGVKQAAVVFVIVLAAAQLVRPEHANPATDATRTIQAHAGTTSELVAVLD |
| Ga0207683_108352193 | 3300026121 | Miscanthus Rhizosphere | MRRRLKQAAVVFVVIFAAAQLVRPERTNPATDASHTIQAHVGTANGLVAI |
| Ga0209155_10906142 | 3300026316 | Soil | MRRLKQAAVVFVVVFAAAQFVRPERANPATDPNRTIRAHMGTASTLTAV |
| Ga0208126_10026162 | 3300026843 | Soil | MSRRLKQAAVVFIVVLVAAQFVRPDRTNPATDASRSIDAQAGTGSEFVA |
| Ga0207982_10063263 | 3300026886 | Soil | MAKRLKLAAVVFIVLLVAAQFVRPDRTNPATDASRSIEAQVGTGS |
| Ga0209970_10487853 | 3300027614 | Arabidopsis Thaliana Rhizosphere | VSRRLTQAAVVFIIVFAAAQFVRPERANPATDARRTIQAHVGTASGLVAVLDRACS |
| Ga0209073_103594632 | 3300027765 | Agricultural Soil | MSRRLKQAAVVLVVVFAAAQLIRPERANPATDVHHTIQSQ |
| Ga0209069_102493423 | 3300027915 | Watersheds | MSRRVKQAAVVFVIVFAAAQLVRPERANPTTDATRTIQAHVGTTGELAAV |
| Ga0268264_118128611 | 3300028381 | Switchgrass Rhizosphere | MRRRLKQAAVVFVVIFAAAQLVRPERTNPATDASHTIQAHVGTANGLVA |
| Ga0307281_100794204 | 3300028803 | Soil | MGRRFWLVAGVFVVAFAAAQLIRPDGANPATDASRTIRAHM |
| Ga0318561_103930622 | 3300031679 | Soil | MSRRLEQAAVVFVVALAAAQLIRPGRANPPTDATRTIHAHETTR |
| Ga0310813_116278162 | 3300031716 | Soil | VRRRFQQAVVAFVVLIAAAQLVRPAHTNPTTDPSRAIQAAPGTN |
| Ga0307469_120851402 | 3300031720 | Hardwood Forest Soil | MSRRLKQAAVVFVIVFAAAQLVRPERANPTIDPSRTIRAHVAESSQLPAV |
| Ga0310917_102577012 | 3300031833 | Soil | MSRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGRTIQAHAGTASAL |
| Ga0307410_115287201 | 3300031852 | Rhizosphere | VIRRLKQAAIVIVAVFAAAQLVRPDRTNPATDVSRPIQA |
| Ga0306925_101617341 | 3300031890 | Soil | MGRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGRTIQAHAGTAS |
| Ga0318551_105917501 | 3300031896 | Soil | MSRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGRTIQAHAGTASALAAVLDRS |
| Ga0318520_106913693 | 3300031897 | Soil | MHKRLTQAAVVFIVVLAAAQFVRPVRANPAIDVSRTIQAQASELGAVLD |
| Ga0310900_111019612 | 3300031908 | Soil | MGRRLKQAAVVFVVIVAAAQLIRPERANPPTDVSRTIQAQVGGRADCPPS |
| Ga0306923_105862151 | 3300031910 | Soil | MRTRLKQAAVLVVVAVAAAQLVRPSRANPPIDASRTIGAHVEPSSGLAPILD |
| Ga0307412_117782082 | 3300031911 | Rhizosphere | MRRLKYVAVAFVILLATAQFVRPERANPVTNPDRTIKAHVG |
| Ga0306921_103119161 | 3300031912 | Soil | MSRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGR |
| Ga0310913_113190542 | 3300031945 | Soil | MRKRLKQAAVALLGVFAAAQFVRPARANPPTDVTRTIQSR |
| Ga0306926_111716991 | 3300031954 | Soil | MSGVSGGWRRLKQAAVVVVVVFAAAQLVRPERTNPPVDPGRTIQAHAGTPSGLP |
| Ga0307409_1011991462 | 3300031995 | Rhizosphere | VSRRLKQAALVIVSVFAAAQLVRPERTNPTTDVSRTIQAHMPTGSGLVAV |
| Ga0318504_101760543 | 3300032063 | Soil | VSRRLTRIAVVFVGAFAAAQIVRPDLANPATDPTRSIQA |
| Ga0318540_105353472 | 3300032094 | Soil | MSRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGRTIQAHAGTASALAAVLD |
| Ga0310889_104770021 | 3300032179 | Soil | VSTRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQAHVGTASGLVAVLDRACS |
| Ga0310896_103450661 | 3300032211 | Soil | VSRRLKEAAVVFIIVVAAAQFVRPERVSPATDACRTTQAHVGTA |
| Ga0326726_121634641 | 3300033433 | Peat Soil | MRSRLKQAAVVFAVIIAAAQFVRPDRSNPATEASRTIRAH |
| Ga0316620_121271661 | 3300033480 | Soil | MNKRLKQAAVAFAVAFAAAQLVRPERANPPIDAGRTIQARVGTASGLSAVLNRACGQCH |
| Ga0316628_1027948401 | 3300033513 | Soil | VSRRLKRAAVVFVVVFSAAQLVRPERANPPTDARRTIQA |
| Ga0316628_1036295112 | 3300033513 | Soil | VSRRLKQTAVVLVLAFAAAQLVRPDFANPATDVDRTIQA |
| Ga0247830_107406343 | 3300033551 | Soil | MSRRLKQGAVAFVVVIAAAQLVRPERSNPATDVKRTIQAHAGTASGLVAV |
| Ga0364935_0145944_3_116 | 3300034151 | Sediment | MSTRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQ |
| ⦗Top⦘ |