| Basic Information | |
|---|---|
| Family ID | F063187 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MAGSLEFIKSASGTSVSSLSVTDCFSADYDVYYVSITKA |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 60.63 % |
| % of genes near scaffold ends (potentially truncated) | 96.92 % |
| % of genes from short scaffolds (< 2000 bps) | 93.08 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.154 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (56.154 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.077 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.769 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.15 % |
| All Organisms | root | All Organisms | 43.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876004|none_p0035235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 511 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10070698 | Not Available | 1421 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10160822 | Not Available | 758 | Open in IMG/M |
| 3300001419|JGI11705J14877_10133684 | Not Available | 689 | Open in IMG/M |
| 3300001472|JGI24004J15324_10021566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 2178 | Open in IMG/M |
| 3300005522|Ga0066861_10196609 | Not Available | 692 | Open in IMG/M |
| 3300005837|Ga0078893_10297569 | Not Available | 1077 | Open in IMG/M |
| 3300006025|Ga0075474_10149656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 733 | Open in IMG/M |
| 3300006029|Ga0075466_1120151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 697 | Open in IMG/M |
| 3300006737|Ga0098037_1071601 | Not Available | 1225 | Open in IMG/M |
| 3300006749|Ga0098042_1092220 | Not Available | 774 | Open in IMG/M |
| 3300006793|Ga0098055_1393477 | Not Available | 513 | Open in IMG/M |
| 3300006802|Ga0070749_10398961 | Not Available | 759 | Open in IMG/M |
| 3300006802|Ga0070749_10413560 | Not Available | 743 | Open in IMG/M |
| 3300006802|Ga0070749_10478816 | Not Available | 680 | Open in IMG/M |
| 3300006810|Ga0070754_10210831 | Not Available | 901 | Open in IMG/M |
| 3300006810|Ga0070754_10265257 | Not Available | 780 | Open in IMG/M |
| 3300006810|Ga0070754_10270348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
| 3300006810|Ga0070754_10276296 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 760 | Open in IMG/M |
| 3300006810|Ga0070754_10297127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 725 | Open in IMG/M |
| 3300006874|Ga0075475_10265464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 716 | Open in IMG/M |
| 3300006916|Ga0070750_10196717 | Not Available | 894 | Open in IMG/M |
| 3300006916|Ga0070750_10248253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 773 | Open in IMG/M |
| 3300006916|Ga0070750_10258504 | Not Available | 754 | Open in IMG/M |
| 3300006916|Ga0070750_10275512 | Not Available | 725 | Open in IMG/M |
| 3300006916|Ga0070750_10319490 | Not Available | 660 | Open in IMG/M |
| 3300006916|Ga0070750_10464419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 522 | Open in IMG/M |
| 3300006919|Ga0070746_10316520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 713 | Open in IMG/M |
| 3300006919|Ga0070746_10325764 | Not Available | 701 | Open in IMG/M |
| 3300006919|Ga0070746_10351871 | Not Available | 668 | Open in IMG/M |
| 3300006919|Ga0070746_10388132 | Not Available | 628 | Open in IMG/M |
| 3300006920|Ga0070748_1159436 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 837 | Open in IMG/M |
| 3300006920|Ga0070748_1261878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 620 | Open in IMG/M |
| 3300006920|Ga0070748_1282924 | Not Available | 592 | Open in IMG/M |
| 3300007344|Ga0070745_1195306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 749 | Open in IMG/M |
| 3300007344|Ga0070745_1197249 | Not Available | 745 | Open in IMG/M |
| 3300007344|Ga0070745_1204301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 728 | Open in IMG/M |
| 3300007345|Ga0070752_1237059 | Not Available | 714 | Open in IMG/M |
| 3300007539|Ga0099849_1206059 | Not Available | 738 | Open in IMG/M |
| 3300007542|Ga0099846_1106432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 1030 | Open in IMG/M |
| 3300007640|Ga0070751_1192823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 796 | Open in IMG/M |
| 3300007640|Ga0070751_1193949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
| 3300007640|Ga0070751_1308727 | Not Available | 588 | Open in IMG/M |
| 3300007760|Ga0105018_1126249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 864 | Open in IMG/M |
| 3300007960|Ga0099850_1199251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 788 | Open in IMG/M |
| 3300008012|Ga0075480_10593047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 525 | Open in IMG/M |
| 3300008012|Ga0075480_10602628 | Not Available | 520 | Open in IMG/M |
| 3300009001|Ga0102963_1071219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1427 | Open in IMG/M |
| 3300009071|Ga0115566_10550605 | Not Available | 650 | Open in IMG/M |
| 3300009193|Ga0115551_1402316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 588 | Open in IMG/M |
| 3300009426|Ga0115547_1257388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 545 | Open in IMG/M |
| 3300009790|Ga0115012_10048367 | All Organisms → Viruses → Predicted Viral | 2835 | Open in IMG/M |
| 3300010149|Ga0098049_1144093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 737 | Open in IMG/M |
| 3300010150|Ga0098056_1164397 | Not Available | 747 | Open in IMG/M |
| 3300010300|Ga0129351_1230883 | Not Available | 711 | Open in IMG/M |
| 3300010300|Ga0129351_1248429 | Not Available | 680 | Open in IMG/M |
| 3300010300|Ga0129351_1356233 | Not Available | 548 | Open in IMG/M |
| 3300010368|Ga0129324_10204589 | Not Available | 801 | Open in IMG/M |
| 3300010368|Ga0129324_10234639 | Not Available | 735 | Open in IMG/M |
| 3300010368|Ga0129324_10331482 | Not Available | 595 | Open in IMG/M |
| 3300017709|Ga0181387_1131123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 517 | Open in IMG/M |
| 3300017725|Ga0181398_1091823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 725 | Open in IMG/M |
| 3300017728|Ga0181419_1005622 | All Organisms → Viruses → Predicted Viral | 3883 | Open in IMG/M |
| 3300017729|Ga0181396_1096716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 602 | Open in IMG/M |
| 3300017756|Ga0181382_1106292 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 757 | Open in IMG/M |
| 3300017765|Ga0181413_1081006 | Not Available | 993 | Open in IMG/M |
| 3300017772|Ga0181430_1088915 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 927 | Open in IMG/M |
| 3300017776|Ga0181394_1019492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 2457 | Open in IMG/M |
| 3300017776|Ga0181394_1091765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 976 | Open in IMG/M |
| 3300017782|Ga0181380_1098510 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300017782|Ga0181380_1162077 | Not Available | 759 | Open in IMG/M |
| 3300017783|Ga0181379_1162938 | Not Available | 791 | Open in IMG/M |
| 3300017786|Ga0181424_10247447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 747 | Open in IMG/M |
| 3300017962|Ga0181581_10598170 | Not Available | 672 | Open in IMG/M |
| 3300017967|Ga0181590_10429588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 933 | Open in IMG/M |
| 3300017967|Ga0181590_10650047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 716 | Open in IMG/M |
| 3300018041|Ga0181601_10122141 | Not Available | 1642 | Open in IMG/M |
| 3300018080|Ga0180433_10737939 | Not Available | 730 | Open in IMG/M |
| 3300018421|Ga0181592_10740549 | Not Available | 652 | Open in IMG/M |
| 3300018424|Ga0181591_10615643 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 775 | Open in IMG/M |
| 3300018876|Ga0181564_10102868 | All Organisms → Viruses → Predicted Viral | 1784 | Open in IMG/M |
| 3300019756|Ga0194023_1110394 | Not Available | 558 | Open in IMG/M |
| 3300020194|Ga0181597_10181757 | Not Available | 1039 | Open in IMG/M |
| 3300021958|Ga0222718_10354758 | Not Available | 745 | Open in IMG/M |
| 3300021964|Ga0222719_10381956 | Not Available | 882 | Open in IMG/M |
| 3300021964|Ga0222719_10536365 | Not Available | 694 | Open in IMG/M |
| 3300021964|Ga0222719_10677698 | Not Available | 586 | Open in IMG/M |
| 3300022065|Ga0212024_1059751 | Not Available | 673 | Open in IMG/M |
| 3300022068|Ga0212021_1082888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 658 | Open in IMG/M |
| 3300022069|Ga0212026_1044334 | Not Available | 667 | Open in IMG/M |
| 3300022069|Ga0212026_1052851 | Not Available | 613 | Open in IMG/M |
| 3300022069|Ga0212026_1059990 | Not Available | 576 | Open in IMG/M |
| 3300022149|Ga0196907_106177 | Not Available | 627 | Open in IMG/M |
| 3300022167|Ga0212020_1036341 | Not Available | 830 | Open in IMG/M |
| 3300022187|Ga0196899_1109477 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 808 | Open in IMG/M |
| 3300022200|Ga0196901_1190585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300022937|Ga0255770_10275811 | Not Available | 791 | Open in IMG/M |
| 3300023110|Ga0255743_10255104 | Not Available | 929 | Open in IMG/M |
| 3300025132|Ga0209232_1125041 | Not Available | 845 | Open in IMG/M |
| 3300025610|Ga0208149_1040876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 1231 | Open in IMG/M |
| 3300025630|Ga0208004_1087505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300025653|Ga0208428_1094599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 848 | Open in IMG/M |
| 3300025671|Ga0208898_1080434 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1050 | Open in IMG/M |
| 3300025671|Ga0208898_1083989 | Not Available | 1015 | Open in IMG/M |
| 3300025671|Ga0208898_1165855 | Not Available | 577 | Open in IMG/M |
| 3300025674|Ga0208162_1124882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300025674|Ga0208162_1131667 | Not Available | 705 | Open in IMG/M |
| 3300025687|Ga0208019_1164151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 614 | Open in IMG/M |
| 3300025759|Ga0208899_1146482 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 813 | Open in IMG/M |
| 3300025759|Ga0208899_1161972 | Not Available | 752 | Open in IMG/M |
| 3300025771|Ga0208427_1137969 | Not Available | 814 | Open in IMG/M |
| 3300025806|Ga0208545_1058337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 1117 | Open in IMG/M |
| 3300025810|Ga0208543_1106615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 666 | Open in IMG/M |
| 3300025818|Ga0208542_1134730 | Not Available | 682 | Open in IMG/M |
| 3300025853|Ga0208645_1158290 | Not Available | 852 | Open in IMG/M |
| 3300025853|Ga0208645_1183315 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 759 | Open in IMG/M |
| 3300025869|Ga0209308_10195331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 900 | Open in IMG/M |
| 3300025889|Ga0208644_1202348 | Not Available | 861 | Open in IMG/M |
| 3300025889|Ga0208644_1335626 | Not Available | 584 | Open in IMG/M |
| 3300034374|Ga0348335_136963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 694 | Open in IMG/M |
| 3300034374|Ga0348335_139294 | Not Available | 683 | Open in IMG/M |
| 3300034375|Ga0348336_016086 | All Organisms → Viruses → Predicted Viral | 4112 | Open in IMG/M |
| 3300034375|Ga0348336_114615 | Not Available | 877 | Open in IMG/M |
| 3300034375|Ga0348336_148461 | Not Available | 701 | Open in IMG/M |
| 3300034375|Ga0348336_148913 | Not Available | 699 | Open in IMG/M |
| 3300034375|Ga0348336_158472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 661 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 56.15% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.69% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.69% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.62% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.08% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.08% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.54% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.77% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.77% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.77% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.77% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.77% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.77% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.77% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876004 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p1-ETM-15m | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007760 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022149 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_00352351 | 2236876004 | Marine Estuarine | MAGSLEFIKSASGTSVGTLSITDCFSADYDVYQITISKM |
| DelMOSpr2010_100706981 | 3300000116 | Marine | MATELQFIKSASGTSVSSLDVTDCFSADYDVYQVLVSKIDQAT |
| DelMOSpr2010_101608223 | 3300000116 | Marine | MAGSLEFITSASGTSVSSLDVTDCFSADYDVYQVLVSK |
| JGI11705J14877_101336842 | 3300001419 | Saline Water And Sediment | MPVGNLEFIKSASGSSVSSLSVTDCFSAKYDVYFISITD |
| JGI24004J15324_100215665 | 3300001472 | Marine | MATNLQFIKSASGSGVSSLSVTDCFSSNYDVYQVLVTKLQTSTSANI |
| Ga0066861_101966091 | 3300005522 | Marine | MATNLEFIKKESADSVSSFTITDIFSANYDVYQVYITGNGSQ |
| Ga0078893_102975691 | 3300005837 | Marine Surface Water | MATNLEFIKSASGSGVSSLSVTDCFSATYDVYFISMTKLDKSTLEW |
| Ga0075474_101496562 | 3300006025 | Aqueous | MATNLQFIKSQSGTDVTTLSVTDCFNADYDVYAIYLTKIDTT |
| Ga0075466_11201511 | 3300006029 | Aqueous | MATNLEFIKSASGTSVSSLSVTDLFSADYDVYEVYITSADQSSTA |
| Ga0098037_10716011 | 3300006737 | Marine | MAGSLEFIKSANTTSNVSSLSVTDCFSDKYDVYKVI |
| Ga0098042_10922203 | 3300006749 | Marine | MAGSLELIKSQTLSGSVALVDVTNVFSDKYDVYKITMN |
| Ga0098055_13934772 | 3300006793 | Marine | MSTNLEFISSVTPDGTSSSLSVTNCFSANYDVYVV |
| Ga0070749_103989611 | 3300006802 | Aqueous | MAGNLEFIKSASGTSVSSLSVTDCFSADYDVYYVSISKADFTTNA |
| Ga0070749_104135602 | 3300006802 | Aqueous | MATNLEFIKSASGTSVVSVDVTDCFSDKYDVYQVLIAKSDVSA |
| Ga0070749_104788162 | 3300006802 | Aqueous | MPVGNLEFIKSASGTSVTSLEVTDCFSASYDVYAFAITKVDA |
| Ga0070754_101700361 | 3300006810 | Aqueous | MAGNLEFITSASGTTVSALDLTDCFSADYDVYYLTSSL |
| Ga0070754_102108313 | 3300006810 | Aqueous | MAGSLEFIKSVSGTSVNTLSVTDCFSADYDVYYVSLTKVDTSADG |
| Ga0070754_102652571 | 3300006810 | Aqueous | MATELQFIKSASGTSVSSLDVTDCFSADYDVYQVLVSKIDQATAQY |
| Ga0070754_102703481 | 3300006810 | Aqueous | MAGNLEFIKSVTGTSVGTLDVTDCFSADYDVYKIIISKLDNDTD |
| Ga0070754_102762961 | 3300006810 | Aqueous | MAGSLEFITSASGTSVNTLSVTDCFSADYDVYYVSLTKVDTSADGSVYIQT |
| Ga0070754_102971272 | 3300006810 | Aqueous | MAGSLEFIKSASGTSVSEFSVTDCFSDKYDVYKIY |
| Ga0075475_102654641 | 3300006874 | Aqueous | MAGSLEFIKSASGTSVSSLSVTDCFSADYDVYYVSITKA |
| Ga0070750_101967171 | 3300006916 | Aqueous | MVGNLEFIKSASGTSVSSLSVTDCFSADYDVYYVSISKADF |
| Ga0070750_102482531 | 3300006916 | Aqueous | MATNLEFIKSASGTSVSSLDVTDCFSADYDVYQVLVS |
| Ga0070750_102585042 | 3300006916 | Aqueous | MPVGNLEFIKSETGTSVTSLSVTDCFSADYDVYQVLISKLNGL |
| Ga0070750_102755122 | 3300006916 | Aqueous | MAVGNLEFIKSASGTSVSSLDVTDCFSANYDVYQVL |
| Ga0070750_103194902 | 3300006916 | Aqueous | MPVGNLEFIKSATGTSVSNLSVTDCFSASYDVYYVSA |
| Ga0070750_104644191 | 3300006916 | Aqueous | MATNLEFIKSASGTSVSSLSVTDCFSAKYDVYKVDIP |
| Ga0070746_103165202 | 3300006919 | Aqueous | MAGSLQFIKSASGTSVTSLSVTDCFSDTYDVYQLQVNY |
| Ga0070746_103257641 | 3300006919 | Aqueous | MAVGNLEFIKSASGTSVSSLSVTDCFSADYDVYYVSISKADFT |
| Ga0070746_103518712 | 3300006919 | Aqueous | MAVGNLEFIKSASGTSVVSVDVTDCFSDKYDVYQVLIA |
| Ga0070746_103881322 | 3300006919 | Aqueous | MAGSLEFIKSASGTSVTSIDVTGCFSDKYDVYAVTVT |
| Ga0070748_11594363 | 3300006920 | Aqueous | MATNLEFIKSASGTSVSSLSVTDLFSADYDVYEVYITS |
| Ga0070748_12618782 | 3300006920 | Aqueous | MAGNLEFITSASGSGVSSLDVTDCFSANYDVYKIIIKDLHSANQVNF |
| Ga0070748_12829241 | 3300006920 | Aqueous | MATNLQFIKSASGTSVSSLSVTDLFSADYDVYEVYITSA |
| Ga0070745_11953061 | 3300007344 | Aqueous | MAGSLEFIKSVSGTSVNTLSVTDCFSADYDVYYVSLTKVDTSADGSV |
| Ga0070745_11972491 | 3300007344 | Aqueous | MATNLEFIKSSSGSSVSSLSVTDCFSDKYDVYKIYVSD |
| Ga0070745_12043011 | 3300007344 | Aqueous | MAGSLEFIKSASGTSVSEFSVTDCFSDKYDVYKIYVSD |
| Ga0070752_12370592 | 3300007345 | Aqueous | MATELQFIKSASVTSVSSLDVTDCFSADYDVYQVLVSKID |
| Ga0099849_12060592 | 3300007539 | Aqueous | MATNLEFIKSASGTSVTSLEVTDCFSASYDVYAFAITKVDATS |
| Ga0099846_11064321 | 3300007542 | Aqueous | MATNLEFIKSASGTSVSSLSVTDCFSANYDVYQVLI |
| Ga0070751_11928232 | 3300007640 | Aqueous | MATNLEFIKSASGTSVSSLSVTDCFSADYDVYEIYVTSYEQS |
| Ga0070751_11939491 | 3300007640 | Aqueous | MAGNLEFIKSVTGTSVGTLDVTDCFSADYDVYKIIISKLDNDTDGRTRLRL |
| Ga0070751_13087272 | 3300007640 | Aqueous | MAGSLEFIKSASGTSVSSLDVTDCFSADYDVYQVLVSKIDQATAQYLWV |
| Ga0105018_11262493 | 3300007760 | Marine | MATNLQFIKSASGTSVSSLSVTDCFSANYDVYFVQV |
| Ga0099850_11992513 | 3300007960 | Aqueous | MATELQFIKSASGTSVSSLSVTDCFSADYDVYYISLTKVDTTSDT |
| Ga0075480_105930472 | 3300008012 | Aqueous | MATNLQFIKSVSGTSVSSLSVTDCFSADYDVYQVLVSKIDQA |
| Ga0075480_106026281 | 3300008012 | Aqueous | MAGNLEFIKSASGTSVTTLDITDCFSDKYDVYYCTV |
| Ga0102963_10712191 | 3300009001 | Pond Water | MAVGNLEFIKSASGTSVSSLDVTDCFSDKYDVYEVHITDY |
| Ga0115566_105506052 | 3300009071 | Pelagic Marine | MATNLEFIKSVSGTSVSSLDVTDCFSATYDVYFISLA |
| Ga0115551_14023162 | 3300009193 | Pelagic Marine | MATNLQFIKSQSGTDVSTLSITDCFNANYDVYAIYLTKIDTTQDNSS |
| Ga0115547_12573881 | 3300009426 | Pelagic Marine | MAGSLEFIKSVSGTSVSSLSVTDCFSANYDVYKILI |
| Ga0115012_100483677 | 3300009790 | Marine | MPGSLEFIKSANTTSNVSSLSVTDCFSGKYDVYKVIL |
| Ga0098043_11703931 | 3300010148 | Marine | MAGSLEFIKSANTTSNVSSLSVTDCFSDKYDVYKVILEVNE |
| Ga0098049_11440931 | 3300010149 | Marine | MATNLQFIKSASGTSVSTLSVTDCFSAKYDVYKIV |
| Ga0098056_11643972 | 3300010150 | Marine | VATSLQFIKSASGTSVSTLSVTDCFSAKYDVYKIVISKIDVTAT |
| Ga0129351_12308831 | 3300010300 | Freshwater To Marine Saline Gradient | MAVGNLEFIKSASGTSVSSLSVTDCFSASYDVYYVSVTDLN |
| Ga0129351_12484292 | 3300010300 | Freshwater To Marine Saline Gradient | MAVGNLEFIKSASGTASTLSVTDCFSNKYDVYQLIV |
| Ga0129351_13562332 | 3300010300 | Freshwater To Marine Saline Gradient | MAGNLEFIKSASGTSVSSLSVTDCFSASYDVYYFALAVTNQ |
| Ga0129324_102045893 | 3300010368 | Freshwater To Marine Saline Gradient | MAGNLEFIKSASGTSVSSLSVTDCFSADYDVYQVTVTKLQTS |
| Ga0129324_102346392 | 3300010368 | Freshwater To Marine Saline Gradient | MAGSLEFIKSASGTSVSSLSVTDCFSADYDVYEVTATF |
| Ga0129324_103314821 | 3300010368 | Freshwater To Marine Saline Gradient | MAGNLEFIKSASGTIVSSLSVTDCFSADYDVYYLSITKIDQS |
| Ga0181387_11311232 | 3300017709 | Seawater | MSTNLQFIKSASGTSISTLSITDCFNAQYDVYEVFIT |
| Ga0181398_10918231 | 3300017725 | Seawater | MATNLEFIKSASGTSVSSLSVTDCFSANYDVYYVSITKAD |
| Ga0181419_10056227 | 3300017728 | Seawater | MAVGNLEFIKSASGTSVSSLSVTDCFSANYDVYKIVGH |
| Ga0181396_10967161 | 3300017729 | Seawater | MATNLQFIKSDSGTSVSSLSITDCFSANYDVYQVVIDNIDFVSADLTFRF |
| Ga0181382_11062921 | 3300017756 | Seawater | MATNLEFIKSASGTSVSSLDVTDCFSANYDVYAFLIDKVDAQAGGY |
| Ga0181413_10810063 | 3300017765 | Seawater | MAVGNLEFIKSGSGTSVSDLSITDCFSSKYDVYQVVILSL |
| Ga0181430_10889153 | 3300017772 | Seawater | MATELQFIKSASATSVGTLSVTDCFSANYDVYKITISKMEQT |
| Ga0181394_10194925 | 3300017776 | Seawater | MATNLQFIKSASGTSVGTLSVTDCFSANYDVYQITIAKMEQ |
| Ga0181394_10917651 | 3300017776 | Seawater | MATNLQFIKSASATSVGTLSVTDCFSANYDVYQITIAKMEQT |
| Ga0181380_10985101 | 3300017782 | Seawater | MATNLEFIKSASGTSVSSLDVTDCFSANYDVYAFLIDKVDAQAGGYFN |
| Ga0181380_11620771 | 3300017782 | Seawater | MKGSLRFIKSASGTSVSSLDVTNCFSADYDVYAFSIDKVDAQAGGYFN |
| Ga0181379_11629381 | 3300017783 | Seawater | MKGSLRFIKSASGTSVSSLDVTNCFSADYDVYAFSIDKVDAQAGG |
| Ga0181424_102474472 | 3300017786 | Seawater | MAGSLEFIKSVSGTSVGTLDVTDIFSTDYDVYKITIS |
| Ga0181581_105981702 | 3300017962 | Salt Marsh | MAVGNLEFIKSASGSSVSSLSVTDCFSADYDVYFIYCE |
| Ga0181590_104295881 | 3300017967 | Salt Marsh | MATNLEFIKSASGTSVSSLSVTDCFSADYDVYKVFIPTDDLSST |
| Ga0181590_106500472 | 3300017967 | Salt Marsh | MATNLEFIKSASGTSVSSLSVTDCFSADYDVYQIH |
| Ga0181601_101221414 | 3300018041 | Salt Marsh | MAGSLEFIKSASGSGINSFSVTDCFSDKYDVYYVSV |
| Ga0180433_107379391 | 3300018080 | Hypersaline Lake Sediment | MAGNLEFIKSASGTSVSSLSVTDCFSDNYDVYQLQVNYNNG |
| Ga0181592_107405491 | 3300018421 | Salt Marsh | MAVGNLEFIKSASGSSVSSLSVTDCFSDKYDVYAIKL |
| Ga0181591_106156431 | 3300018424 | Salt Marsh | MATNLEFIKSASGTSVSSLSVTDCFSDKYDVYEVFIPTD |
| Ga0181564_101028685 | 3300018876 | Salt Marsh | MAGNLEFIKSTTGSSVTSLDVTDCFSADYDVYQFNLVQF |
| Ga0194023_11103941 | 3300019756 | Freshwater | MATNLEFIKSASGTQVSTLDVTDCFSDKYDVYKIIFNGTNTD |
| Ga0181597_101817571 | 3300020194 | Salt Marsh | MAGSLEFIKSASGSGINSFSVTDCFSDKYDVYYVSVTKVDIAQ |
| Ga0213862_102275341 | 3300021347 | Seawater | MATNLQFIKSASGTSVSGLSITDCFSDKYDVYQVVMNTI |
| Ga0222718_103547581 | 3300021958 | Estuarine Water | MAGSLEFIKSATGSGVSNLSVTDCFSDKYDVYYIDVVTFVPTSNA |
| Ga0222719_103819563 | 3300021964 | Estuarine Water | MAGSLEFIKSASGTSVSTLDVTDCFSADYDVYKIVTSKVDLVSN |
| Ga0222719_105363651 | 3300021964 | Estuarine Water | MAGSLEFIKSATGSGVSNLSVTDCFSDKYDVYYIDVVT |
| Ga0222719_106776981 | 3300021964 | Estuarine Water | MAGSLELVKSANGTSVTSIDVTDCFSDKYDVYAVTVTD |
| Ga0212024_10597512 | 3300022065 | Aqueous | MAGSLEFIKSVTGTSVSTLDIPDCFSDDYDVYAIILGK |
| Ga0212021_10828882 | 3300022068 | Aqueous | MATNLEFIKSETGTSVTSLSVTDCFSADYDVYQVLISKLNG |
| Ga0212026_10443341 | 3300022069 | Aqueous | MAGSLEFIKSASGTSVSSLDVTDCFSADYDVYYVSLTKVDTSLDCSIQ |
| Ga0212026_10528512 | 3300022069 | Aqueous | MATNLEFIKSATGSSVTSIDVTDCFSDKYDVYAITYT |
| Ga0212026_10599902 | 3300022069 | Aqueous | MATNLEFIKSASGSSVSSLSVTDCFSADYDVYQVVISEYKGT |
| Ga0196907_1061771 | 3300022149 | Aqueous | MATNLEFIKSASGTSVSSLSVTDCFSADYDVYAISVTKLDMASD |
| Ga0212020_10363413 | 3300022167 | Aqueous | MAVGNLEFIKSATGTSVSNLSVTDCFSASYDVYQVLITN |
| Ga0196899_11094771 | 3300022187 | Aqueous | MAGSLEFITSASGTSVNTLSVTDCFSADYDVYYVSLTKVDTSADGSVY |
| Ga0196901_11905851 | 3300022200 | Aqueous | MAVGNLEFIKSASGTSVSSLDVTDCFSADYDVYYVT |
| Ga0255770_102758111 | 3300022937 | Salt Marsh | MATNLEFIKSASGTSVSSLSVTDCFSDNYDVYKVVISKIDVSTSNSST |
| Ga0255743_102551041 | 3300023110 | Salt Marsh | MAGSLEFIKSTSGTNVASIDVTDCFSDKYDVYKIT |
| Ga0209232_11250411 | 3300025132 | Marine | MPGSLEFVKSNSTTSNVSSLSVDDCFTTEYDIYKCVLEIDEVGT |
| Ga0208149_10408763 | 3300025610 | Aqueous | MATNLQFIKSQSGTDVTTLSVTDCFNADYDVYAIYL |
| Ga0208004_10875051 | 3300025630 | Aqueous | MAGNLEFIKSASGTSVTSLEVTDCFSASYDVYAFAITKVDATSDGN |
| Ga0208428_10945991 | 3300025653 | Aqueous | MATNLQFIKSQSGTDVTTLSVTDCFNADYDVYAIYLTKID |
| Ga0208898_10804343 | 3300025671 | Aqueous | MAGSLEFITSASGTSVNTLSVTDCFSADYDVYYVSLTKVDTSADGSVYIQTVD |
| Ga0208898_10839891 | 3300025671 | Aqueous | MAGNLEFITSASGTSVSSLDVTDCFSADYDVYQVLVSKID |
| Ga0208898_11658551 | 3300025671 | Aqueous | MAGNLEFIKSVTGTSVGTLDVTDCFSADYDVYKIIISKLD |
| Ga0208162_11248821 | 3300025674 | Aqueous | MPVGNLEFIKSASGTSVNNLSVTNCFTSNYDVYYV |
| Ga0208162_11316672 | 3300025674 | Aqueous | MATNLEFIKSASGTSVTSLEVTDCFSASYDVYAFAITKVD |
| Ga0208019_11641512 | 3300025687 | Aqueous | MATNLEFIKSASGTSVSSLSVTDCFSANYDVYQVLIAKLDSTATTYG |
| Ga0208899_11464822 | 3300025759 | Aqueous | MATNLEFIKSASGTSVSSLSVTDCFSADYDVYYIDIVKANAPTSD |
| Ga0208899_11619721 | 3300025759 | Aqueous | MAGNLEFIKSASGTSVSSLSVTDCFSADYDVYYVSISKADFTTNAY |
| Ga0208427_11379693 | 3300025771 | Aqueous | MAGSLEFIKSASGTSVSSLSVTDCFSADYDVYYVSITKADLTSQSWGIGF |
| Ga0208545_10583371 | 3300025806 | Aqueous | MATNLQFIKSASGTSVGTLDVTDIFSADYDVYKIT |
| Ga0208543_11066152 | 3300025810 | Aqueous | MAGNLEFIKSASGTSVTNLDVTDCFSADYDVYYVTGN |
| Ga0208542_11347301 | 3300025818 | Aqueous | MGNLEFIKSASGTSVSSLDVTDCFNANYDVYKVVIPN |
| Ga0208645_11582901 | 3300025853 | Aqueous | MATELQFIKSASGTSVSSLDVTDCFSADYDVYQVLVSKIDQATAQYL |
| Ga0208645_11833152 | 3300025853 | Aqueous | MAGSLEFIKSASGTSVSSLDVTDCFSADYDVYQVLVSKIDQATAQYL |
| Ga0209308_101953311 | 3300025869 | Pelagic Marine | MAGSLEFIKSASGTSVSSLSVTDCFSADYDVYQVVI |
| Ga0208644_12023483 | 3300025889 | Aqueous | MPVGNLEFIKSETGTSVTSLSVTDCFSADYDVYQVLISKL |
| Ga0208644_13356262 | 3300025889 | Aqueous | MATNLEFIKSASGTSVSSLSVTDCFSVKYDVYDITFN |
| Ga0348335_136963_589_693 | 3300034374 | Aqueous | MAGSLEFIKSVSGTSVNTLSVTDCFSADYDVYYVS |
| Ga0348335_139294_559_681 | 3300034374 | Aqueous | MAGSLEFIKSASGTSVSSLSVTDCFSADYDVYYVSITKADL |
| Ga0348336_016086_2_136 | 3300034375 | Aqueous | MATNLQFIKSVSGSGVSSLSVTDCFSANYDVYQVLVSKIDQATAQ |
| Ga0348336_114615_753_875 | 3300034375 | Aqueous | MAGNLEFITSASGTSVSSLDVTDCFSADYDVYQVLVSKIDQ |
| Ga0348336_147918_595_702 | 3300034375 | Aqueous | MAGNLEFIKSETLTSSASELLVTDCFNQGYDVYKIL |
| Ga0348336_148461_585_701 | 3300034375 | Aqueous | MAGSLEFIKSVSGTSVNTLSVTDCFSADYDVYYVSLTKV |
| Ga0348336_148913_2_109 | 3300034375 | Aqueous | MAGSLEFIKSASGTSVSEFSVTDCFSDKYDVYKIYV |
| Ga0348336_158472_550_660 | 3300034375 | Aqueous | MATNLEFIKSASGTSVSSLSVTDCFSADYDVYEIYVT |
| ⦗Top⦘ |