NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062787

Metagenome / Metatranscriptome Family F062787

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062787
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 55 residues
Representative Sequence MRLQKPQLKEWEYKTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW
Number of Associated Samples 93
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 58.14 %
% of genes near scaffold ends (potentially truncated) 34.62 %
% of genes from short scaffolds (< 2000 bps) 78.46 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (33.846 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(40.000 % of family members)
Environment Ontology (ENVO) Unclassified
(80.769 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.462 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.22%    β-sheet: 33.33%    Coil/Unstructured: 44.44%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF14700RPOL_N 15.38
PF13619KTSC 3.85
PF02511Thy1 0.77
PF17212Tube 0.77
PF08273Prim_Zn_Ribbon 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 0.77
COG4643Uncharacterized domain associated with phage/plasmid primaseMobilome: prophages, transposons [X] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.31 %
UnclassifiedrootN/A27.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10199056Not Available643Open in IMG/M
3300000973|BBAY93_10112498Not Available690Open in IMG/M
3300001949|GOS2238_1026566All Organisms → Viruses → Predicted Viral1405Open in IMG/M
3300003069|Ga0051127_10077Not Available803Open in IMG/M
3300003069|Ga0051127_10134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24784Open in IMG/M
3300003069|Ga0051127_10487Not Available695Open in IMG/M
3300004829|Ga0068515_107645All Organisms → Viruses → Predicted Viral1367Open in IMG/M
3300004829|Ga0068515_113029All Organisms → Viruses → Predicted Viral1042Open in IMG/M
3300004829|Ga0068515_122032All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24796Open in IMG/M
3300004951|Ga0068513_1001422All Organisms → Viruses → Predicted Viral2446Open in IMG/M
3300004951|Ga0068513_1023208Not Available668Open in IMG/M
3300004951|Ga0068513_1023313All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24667Open in IMG/M
3300005057|Ga0068511_1054594Not Available661Open in IMG/M
3300005057|Ga0068511_1086194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24550Open in IMG/M
3300005215|Ga0069001_10095114All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24762Open in IMG/M
3300005510|Ga0066825_10062730All Organisms → Viruses → Predicted Viral1330Open in IMG/M
3300005837|Ga0078893_10808870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24522Open in IMG/M
3300006026|Ga0075478_10034578All Organisms → Viruses → Predicted Viral1679Open in IMG/M
3300006403|Ga0075514_1031469All Organisms → Viruses → Predicted Viral2167Open in IMG/M
3300006734|Ga0098073_1007870All Organisms → Viruses → Predicted Viral1957Open in IMG/M
3300006734|Ga0098073_1017891All Organisms → Viruses → Predicted Viral1089Open in IMG/M
3300006802|Ga0070749_10329879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1851Open in IMG/M
3300006810|Ga0070754_10214692All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae891Open in IMG/M
3300006810|Ga0070754_10242273All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales826Open in IMG/M
3300006810|Ga0070754_10423370All Organisms → Viruses580Open in IMG/M
3300006868|Ga0075481_10096927All Organisms → Viruses → Predicted Viral1097Open in IMG/M
3300006916|Ga0070750_10041798All Organisms → Viruses → Predicted Viral2246Open in IMG/M
3300006916|Ga0070750_10048696All Organisms → Viruses → Predicted Viral2059Open in IMG/M
3300006916|Ga0070750_10252798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1765Open in IMG/M
3300006919|Ga0070746_10129078All Organisms → Viruses → Predicted Viral1243Open in IMG/M
3300007234|Ga0075460_10298470Not Available529Open in IMG/M
3300007346|Ga0070753_1118158All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C241022Open in IMG/M
3300007539|Ga0099849_1050997All Organisms → Viruses → Predicted Viral1724Open in IMG/M
3300007539|Ga0099849_1194038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24767Open in IMG/M
3300007539|Ga0099849_1214198Not Available720Open in IMG/M
3300007542|Ga0099846_1053389All Organisms → Viruses → Predicted Viral1528Open in IMG/M
3300008012|Ga0075480_10478846Not Available602Open in IMG/M
3300010297|Ga0129345_1016505All Organisms → Viruses → Predicted Viral2867Open in IMG/M
3300010300|Ga0129351_1371758All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24535Open in IMG/M
3300010300|Ga0129351_1413513All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24502Open in IMG/M
3300010392|Ga0118731_107649016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24516Open in IMG/M
3300012523|Ga0129350_1064357Not Available596Open in IMG/M
3300012525|Ga0129353_1561256All Organisms → Viruses795Open in IMG/M
3300012525|Ga0129353_1875252All Organisms → Viruses879Open in IMG/M
3300013188|Ga0116834_1119160All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24564Open in IMG/M
3300017708|Ga0181369_1022740All Organisms → Viruses → Predicted Viral1515Open in IMG/M
3300017709|Ga0181387_1007840All Organisms → Viruses → Predicted Viral2092Open in IMG/M
3300017713|Ga0181391_1005862All Organisms → Viruses → Predicted Viral3270Open in IMG/M
3300017713|Ga0181391_1022718All Organisms → Viruses → Predicted Viral1554Open in IMG/M
3300017714|Ga0181412_1003924All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP15087Open in IMG/M
3300017726|Ga0181381_1081185Not Available693Open in IMG/M
3300017730|Ga0181417_1007619All Organisms → Viruses → Predicted Viral2855Open in IMG/M
3300017734|Ga0187222_1073671All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP1781Open in IMG/M
3300017735|Ga0181431_1075062Not Available759Open in IMG/M
3300017741|Ga0181421_1193096Not Available521Open in IMG/M
3300017742|Ga0181399_1015342All Organisms → Viruses → Predicted Viral2182Open in IMG/M
3300017742|Ga0181399_1175565Not Available508Open in IMG/M
3300017749|Ga0181392_1088890All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP1927Open in IMG/M
3300017749|Ga0181392_1239254Not Available513Open in IMG/M
3300017752|Ga0181400_1194283Not Available562Open in IMG/M
3300017755|Ga0181411_1148798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP1674Open in IMG/M
3300017756|Ga0181382_1141563Not Available632Open in IMG/M
3300017757|Ga0181420_1004727All Organisms → Viruses → Predicted Viral4817Open in IMG/M
3300017760|Ga0181408_1193571Not Available517Open in IMG/M
3300017764|Ga0181385_1018136All Organisms → Viruses → Predicted Viral2256Open in IMG/M
3300017769|Ga0187221_1151191All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP1687Open in IMG/M
3300017771|Ga0181425_1155817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24723Open in IMG/M
3300017781|Ga0181423_1205857All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae744Open in IMG/M
3300017949|Ga0181584_10368896All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP1904Open in IMG/M
3300017952|Ga0181583_10032601All Organisms → Viruses → Predicted Viral3750Open in IMG/M
3300017967|Ga0181590_11031071Not Available535Open in IMG/M
3300018421|Ga0181592_10505334All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24835Open in IMG/M
3300019765|Ga0194024_1014050All Organisms → Viruses → Predicted Viral1687Open in IMG/M
3300020252|Ga0211696_1000017All Organisms → Viruses33106Open in IMG/M
3300020264|Ga0211526_1000013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales45366Open in IMG/M
3300020366|Ga0211489_10119465All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24723Open in IMG/M
3300020384|Ga0211596_10072965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae1111Open in IMG/M
3300020438|Ga0211576_10006673All Organisms → Viruses7611Open in IMG/M
3300020439|Ga0211558_10133335All Organisms → Viruses → Predicted Viral1203Open in IMG/M
3300020453|Ga0211550_10026933All Organisms → Viruses → Predicted Viral2793Open in IMG/M
3300021335|Ga0213867_1006294All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP15077Open in IMG/M
3300021335|Ga0213867_1093907Not Available1081Open in IMG/M
3300021356|Ga0213858_10259498All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24835Open in IMG/M
3300021356|Ga0213858_10379835Not Available665Open in IMG/M
3300021356|Ga0213858_10487760Not Available570Open in IMG/M
3300021364|Ga0213859_10022435All Organisms → Viruses → Predicted Viral2942Open in IMG/M
3300021368|Ga0213860_10100478All Organisms → Viruses → Predicted Viral1263Open in IMG/M
3300022057|Ga0212025_1082511Not Available552Open in IMG/M
3300022067|Ga0196895_1034688All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium578Open in IMG/M
3300022069|Ga0212026_1067577Not Available542Open in IMG/M
3300022149|Ga0196907_108838Not Available542Open in IMG/M
3300022159|Ga0196893_1027033Not Available536Open in IMG/M
3300022168|Ga0212027_1018206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP1961Open in IMG/M
3300022187|Ga0196899_1014604All Organisms → Viruses → Predicted Viral3014Open in IMG/M
3300022187|Ga0196899_1020449All Organisms → Viruses → Predicted Viral2436Open in IMG/M
3300022187|Ga0196899_1023087All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP12260Open in IMG/M
3300022187|Ga0196899_1138702All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP1685Open in IMG/M
3300022200|Ga0196901_1121372Not Available893Open in IMG/M
3300022200|Ga0196901_1142576All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae804Open in IMG/M
3300022929|Ga0255752_10288083All Organisms → Viruses704Open in IMG/M
3300025057|Ga0208018_110595Not Available1285Open in IMG/M
3300025057|Ga0208018_129376All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24588Open in IMG/M
3300025083|Ga0208791_1001039All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae10802Open in IMG/M
3300025093|Ga0208794_1008568All Organisms → Viruses → Predicted Viral2655Open in IMG/M
3300025151|Ga0209645_1106507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24903Open in IMG/M
3300025610|Ga0208149_1142058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium552Open in IMG/M
3300025647|Ga0208160_1129804All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP1629Open in IMG/M
3300025674|Ga0208162_1042620All Organisms → Viruses → Predicted Viral1572Open in IMG/M
3300025674|Ga0208162_1073435All Organisms → Viruses → Predicted Viral1076Open in IMG/M
3300025674|Ga0208162_1153786All Organisms → Viruses628Open in IMG/M
3300025674|Ga0208162_1172740Not Available572Open in IMG/M
3300025674|Ga0208162_1196504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24515Open in IMG/M
3300025769|Ga0208767_1234169Not Available588Open in IMG/M
3300025815|Ga0208785_1130594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae592Open in IMG/M
3300025828|Ga0208547_1159696Not Available637Open in IMG/M
3300025853|Ga0208645_1105557All Organisms → Viruses → Predicted Viral1156Open in IMG/M
3300029318|Ga0185543_1048108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24914Open in IMG/M
3300029319|Ga0183748_1053033All Organisms → Viruses → Predicted Viral1135Open in IMG/M
3300029319|Ga0183748_1081570Not Available796Open in IMG/M
3300029753|Ga0135224_1013610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24723Open in IMG/M
3300032212|Ga0316207_10299906Not Available602Open in IMG/M
3300034374|Ga0348335_091077All Organisms → Viruses992Open in IMG/M
3300034374|Ga0348335_118431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae790Open in IMG/M
3300034375|Ga0348336_031852All Organisms → Viruses → Predicted Viral2467Open in IMG/M
3300034375|Ga0348336_061553All Organisms → Viruses → Predicted Viral1465Open in IMG/M
3300034375|Ga0348336_152822Not Available683Open in IMG/M
3300034375|Ga0348336_199043Not Available536Open in IMG/M
3300034418|Ga0348337_030001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae2516Open in IMG/M
3300034418|Ga0348337_033921All Organisms → Viruses → Predicted Viral2296Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous40.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater16.92%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine9.23%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.69%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.38%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water3.85%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.85%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.31%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water2.31%
CoralHost-Associated → Cnidaria → Unclassified → Unclassified → Unclassified → Coral2.31%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.77%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.77%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.77%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.77%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.77%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.77%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.77%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300001949Marine microbial communities from Panama City, Panama - GS022EnvironmentalOpen in IMG/M
3300003069Coral viral communities from Mount Irvine Bay, Buccoo, Tobago - bleached coralsHost-AssociatedOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300004951Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVsEnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005215Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2EnvironmentalOpen in IMG/M
3300005510Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45EnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013188Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_MetagenomeEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300020252Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX555968-ERR599022)EnvironmentalOpen in IMG/M
3300020264Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158)EnvironmentalOpen in IMG/M
3300020366Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX556091-ERR599146)EnvironmentalOpen in IMG/M
3300020384Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556023-ERR599110)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020453Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022149Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022159Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025093Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029753Marine harbor viral communities from the Indian Ocean - SRH3EnvironmentalOpen in IMG/M
3300032212Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-week pyriteEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1019905613300000116MarineLAVLKKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW*
BBAY93_1011249813300000973Macroalgal SurfaceGRQLMRLQKPQLKEWEFKTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKRCDEW*
GOS2238_102656643300001949MarineMRLQKPQLKEWEYTQTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKNVKLCDEW*
Ga0051127_1007723300003069CoralMRLQKSSLDEYEYRTTDGQVRYLLAPNLEHAAWAAAELSGGTQFLKDVKRCDEW*
Ga0051127_1013423300003069CoralMRLQKQSLKEWQYTRTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKRCDEW*
Ga0051127_1048723300003069CoralMRLQNSSLKEWQYTQTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW*
Ga0068515_10764523300004829Marine WaterMRLQKQPLSEWQYTTTDGQVRYLLAPNLEHAAWAAAELSGGTQFLKDVKRCDEW*
Ga0068515_11302923300004829Marine WaterMRLQKPQLKEWEFKTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW*
Ga0068515_12203223300004829Marine WaterMRLQKQPLDEWQYTTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKRCDEW*
Ga0068513_100142213300004951Marine WaterMRLQKTSLDEYEYTTTDGQVRYLLAPNLEHAAWAAAELSGGTQFLKDVKRCDEW
Ga0068513_102320833300004951Marine WaterNSSLKEWEYTQTDGQVRYLLAPDLEHAAWAAAELSGGTKFVKDVRLCDEW*
Ga0068513_102331313300004951Marine WaterMRLQNSSLKEWEYTQTDGQVRYLLAPDLEHAAWAAAELSGGTKFVKDVRLCDEW*
Ga0068511_105459433300005057Marine WaterMRLQKPQLKEWQYTTTDGQVQYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW*
Ga0068511_108619423300005057Marine WaterMRLQKQPLSEWQYTTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW*
Ga0069001_1009511423300005215Natural And Restored WetlandsMRLQKPQLKEWQYTQTDGQVRYLLAPNLEHAAWAAAELSGGTKFVKDVRLCDEW*
Ga0066825_1006273023300005510MarineMRLQKPQLKEWEYKTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW*
Ga0078893_1080887023300005837Marine Surface WaterMRLQKQPLKEWQYTQTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW*
Ga0075478_1003457843300006026AqueousVLNVRLAKPQLKEYEFKQTDGQVRYLLAPDSEHAAWAAAELSGGSQYVLDVRLCDEW*
Ga0075514_103146943300006403AqueousVLKKQTLKEYEYKRTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW*
Ga0098073_100787013300006734MarineGELNVRLAKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQYVLDVRLCDEW*
Ga0098073_101789123300006734MarineMKTQPLKEYQYTTTSGEVRYLLAPDSEHAAWAAAELSNGTNNVLDVRLCDEW*
Ga0098074_101861783300006790MarineMKKQPLKEYQFTLKTGEVRYLLAPDSEHAAWAAAELSNGTNNVLDV
Ga0070749_1032987913300006802AqueousHNVNTTRTNHNHGELNVHLAKQTLKEYEYRKTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW*
Ga0070754_1021469213300006810AqueousVRLAKPQLKEYEFKQTDGQVRYLLAPDSEHAAWAAAELSGGSQYVLDVRLCDE
Ga0070754_1024227313300006810AqueousVLQKPQLKEYEYKTTTDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDV
Ga0070754_1042337023300006810AqueousVLKKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW*
Ga0075481_1009692743300006868AqueousVRLAKPQLKEYEFKQTDGQVRYLLAPDSEHAAWAAAELSGGSQYVLDVRLCDEW*
Ga0070750_1004179833300006916AqueousMRLQKQPLKEWQYTRTDGQVQYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW*
Ga0070750_1004869633300006916AqueousVLQKPQLKEYEYKTTTDSQVRYLLAPDSEHAAWAAAELSGGSQNVLDVRLCDEW*
Ga0070750_1025279823300006916AqueousMRQNLALKEYEYKTTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW*
Ga0070746_1012907833300006919AqueousMKLQNSSLKEWQYTQTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW*
Ga0075460_1029847013300007234AqueousKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW*
Ga0070753_111815833300007346AqueousMKKQPLKEYEFTTTDGEVRYLLARDSEHAAWAAAELSNGTDKVLNVRLCDEW*
Ga0099849_105099733300007539AqueousMRLQKPQLKEWEYKTTDGQVRYLIAPDLEHAAWAAAELSGGTQFLKDVKLCDEW*
Ga0099849_119403833300007539AqueousMIKTQPLKEYEYTTTDGEVRYLLAPDSEHAAWAAAELSNGTNNVLNVRLCDEW*
Ga0099849_121419833300007539AqueousMRLQKQPLKEWQYTQTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKNVKLCDEW*
Ga0099846_105338933300007542AqueousMKLQNSSLKEWEYTQTDGQVRYLLAPDLEHAAWAAAELSGGTKFVKDVRLCDEW*
Ga0075480_1047884613300008012AqueousQTLKEYEYKRTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW*
Ga0129345_101650513300010297Freshwater To Marine Saline GradientKLKEYEYKRTNDRQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW*
Ga0129351_137175813300010300Freshwater To Marine Saline GradientMRLQKSSLDEYEYTTTDGQVRYLLAPNLEHAAWAAAELSGGTQFLKDVKRCDEW*
Ga0129351_141351323300010300Freshwater To Marine Saline GradientMKLQNSSLKEWEYTQTDGQVRYLLAPDLEHAAWAAAELSGGTKFVKDVR
Ga0118731_10764901623300010392MarineMQLQNSSLKEWEYTQTDGQVCYLLAPDSEHAAWAAAELSGGTEFLKNVRLCDEW*
Ga0129350_106435713300012523AqueousLNVHLAKQTLKEYEYRKTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW*
Ga0129353_156125613300012525AqueousKEYEYRRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW*
Ga0129353_187525213300012525AqueousMRLQNSSLKEWEYIQTDGQVRYLLAPDLEHAAWAAAELSGGTKFVKDVRLCDEW*
Ga0116834_111916023300013188MarineMRLQKSSLDEYEYKTTDGQVRYLLAPNLEHAAWAAAELSGGTQFLKDVKRCDEW*
Ga0181369_102274033300017708MarineMQLQNSSLKEWQYTQTDGQVCYLLAPDSEHAAWAAAELSGGTKFLKDVRLCDEW
Ga0181387_100784033300017709SeawaterMQLQNFSLKEWEYTQTDGQVCYLLAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0181391_100586243300017713SeawaterMRLQNSSLKEWEYTQTNGQVRYLLAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0181391_102271833300017713SeawaterMRLQKSSLKEWKYTQTNGQVCYLLAPDSEHAAWTAAELSGGTKFLKDVRLCDEW
Ga0181412_100392473300017714SeawaterMQLQKSSLKEWQYTQTDGQVRYILAPDSEHAAWAAAELSGGVEFLKNVRLCDEW
Ga0181381_108118513300017726SeawaterNHDAQSAGKHPMQLQNFSLKEWEYTQTDGQVCYLLAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0181417_100761943300017730SeawaterMQLQKSSLKEWEYTQTDGQVCYLLAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0187222_107367133300017734SeawaterQNHDAQSAGKHPMQLQNFSLKEWEYTQTDGQVCYLLAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0181431_107506243300017735SeawaterQLQNSSLKEWKYTQTNGQVCYLLAPDSEHAAWTAAELSGGTKFLKDVRLCDEW
Ga0181421_119309613300017741SeawaterNHDAQNAGKHPMQLQNSSLKEWEYTQTDGQVCYLLAPDSEQAAWAAAELSGGTEFLKNVRLCDEW
Ga0181399_101534263300017742SeawaterMQLQNSSLKEWKYTQTNGQVCYLLAPDSEHAAWTAAELSGGTKFLKDVRLCDEW
Ga0181399_117556523300017742SeawaterLKEWEYTQTDGQVCYLLAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0181392_108889013300017749SeawaterNHDAQSAGKLQMQLQNSSLKEWKYTQTNGQVCYLLAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0181392_123925423300017749SeawaterQKSSLKEWKYTQTNGQVCYLLAPDSEHAAWTAAELSGGTKFLKDVRLCDEW
Ga0181400_119428323300017752SeawaterKEWQYTQTNGQVRYILAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0181411_114879823300017755SeawaterMQLQKSSLKEWQYTQTDGQVRYILAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0181382_114156333300017756SeawaterVLQKQQLKEYEYKTTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW
Ga0181420_100472743300017757SeawaterMQLQNSSLKEWKYTQTNGQVCYLLAPDSEHAAWTAAELSGGTKFLKEVRLCDEW
Ga0181408_119357113300017760SeawaterGKHPMQLQNFSLKEWEYTQTDGQVCYLLAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0181385_101813633300017764SeawaterMQLQKSSLKEWQYTQTNGQVRYILAPDSEHAAWAAAELSGGVEFLKNVRLCDEW
Ga0187221_115119113300017769SeawaterRTPPNQLHAVLQKQQLKEYEYKTTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW
Ga0181425_115581713300017771SeawaterMQLQNSSLKKWEYTQTDGQVCYLLAPDSEHAAWAAAELSGGTEFLKNVRL
Ga0181423_120585723300017781SeawaterMQLQNFYLKEWEYTQTDGQVCYLLAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0181584_1036889633300017949Salt MarshVLKKQTLKEYEYKRTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0181583_1003260153300017952Salt MarshVLKKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0181590_1103107133300017967Salt MarshLKKQTLKEYEYKRTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0181592_1050533433300018421Salt MarshMRLQKPQLKEWQYTQTDGQVRYLLAPNLEHAAWAAAELSGGTKFVKDVRLCDEW
Ga0194024_101405043300019765FreshwaterVHLAKQTLKEYEYRKTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0211696_1000017353300020252MarineVLQKQQLKEYEYKTTTDSQVRYLLAPDSEHAAWAAAELSGGSQYVLDVRLCDEW
Ga0211526_1000013253300020264MarineMRLQKPQLKEWEYKTTDGQVRYLIAPDLEHAAWAAAELSGGTQFLKDVKLCDEW
Ga0211489_1011946513300020366MarineMRLQKQPLKEWQYTQTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKRCDEW
Ga0211596_1007296523300020384MarineMRLQKQPLKEWQYTRTDGQLQYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW
Ga0211576_1000667373300020438MarineMRLQSSSLKEWKYTQTNGQVCYLLAPDSEHAAWTAAELSGGTKFLKDVRLCDEW
Ga0211558_1013333543300020439MarineMRLQKPQLKEWEYKTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW
Ga0211550_1002693393300020453MarineMRLQRQPLKEWQYTQTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDV
Ga0213867_100629433300021335SeawaterMRLQKPQLKEWQYTQTDGQVRYLLAPDLEHAAWAAAELSGGTKFVKDVRLCDEW
Ga0213867_109390723300021335SeawaterMQLQNSSLKEWEYTQTDGQVCYLLAPDSEHAAWAAAELSGGTEFLKNVRLCDEW
Ga0213858_1025949823300021356SeawaterMRLQKTQLEEYQYKTTDGQVRYLLAPDSEHAAWAAAELSGGSQFVLNVTRCDEW
Ga0213858_1037983513300021356SeawaterMRLKKPQLKEWEYKTTDGQVRYLLAPNLEHAAWAAAELSGGTQFLKNVKLCDEW
Ga0213858_1048776013300021356SeawaterLQKPQLKEWEFKTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVRLCDEW
Ga0213859_1002243533300021364SeawaterMRLQNSSLKEWEYKTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKRCDEW
Ga0213860_1010047833300021368SeawaterMRLQKSSLDEYEYRTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKRCDEW
Ga0212025_108251113300022057AqueousDGELNVHLAKQTLKEYEYRKTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0196895_103468823300022067AqueousVNTTLTNHNHGELNVRLAKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0212026_106757713300022069AqueousKHGEHVLKKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0196907_10883833300022149AqueousELNVHLAKQTLKEYEYRKTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0196893_102703323300022159AqueousVNTTRTNHNHGELNVHLAKQTLKEYEYRKTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0212027_101820633300022168AqueousVNTTHTNHNHGELNVHLAKQTLKEYEYRKTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0196899_1014604103300022187AqueousVRLAKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDV
Ga0196899_102044933300022187AqueousVRLAKPQLKEYEFKQTDGQVRYLLAPDSEHAAWAAAELSGGSQYVLDVRLCDEW
Ga0196899_102308793300022187AqueousVNTTRTNHNHGELNVRLAKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDV
Ga0196899_113870213300022187AqueousLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0196901_112137223300022200AqueousVLRKQKLKEYEYKRTNDRQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0196901_114257613300022200AqueousVRLAKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0255752_1028808313300022929Salt MarshPSVGRQLMRLQKPQLKEWEYKTTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDE
Ga0208018_11059513300025057MarineNISKDAIQKMLKMQSLKEYQYTTKDGEVRYLLAPDSEHAAWAAAELSNGTNNVLDVRLCDEW
Ga0208018_12937613300025057MarinePSRTQHKRQINCNRMKTQPLKEYQYTTTDGEVRYLLAPDSEHAAWAAAELSNGTNNVLDVRLCDEW
Ga0208791_1001039253300025083MarineVLQKPQLKEYEYKTTTDSQVRYLLAPDSEHAAWAAAELSGGSQNVLDVRLCDEW
Ga0208794_100856833300025093MarineMRLQKSSLDEYEYRTTDGQVRYLLAPNLEHAAWAAAELSGGTQFLKDVKRCDE
Ga0209645_110650713300025151MarineMRLQKQPLKEWQYTQTDGQVQYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW
Ga0208149_114205823300025610AqueousVLNVRLAKPQLKEYEFKQTDGQVRYLLAPDSEHAAWAAAELSGGSQYVLDVRLCDEW
Ga0208160_112980423300025647AqueousMKLQNSSLKEWEYTQTDGQVRYLLAPDLEHAAWAAAELSGGTKFVKDVRLCDEW
Ga0208162_104262023300025674AqueousMRLQNSSLKEWEYTQTDGQVRYLLAPDLEHAAWAAAELSGGTKFVKDVRLCDEW
Ga0208162_107343533300025674AqueousMRLQNSSLKEWKYTQTNGQVRYLLAPDLEHAAWAAAELSGGTKFVKDVRLCDEW
Ga0208162_115378613300025674AqueousKLKEYEYKRTNDRQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0208162_117274033300025674AqueousYPNHVPLSVGRQLMRLQKPQLKEWEYKTTDGQVRYLIAPDLEHAAWAAAELSGGTQFLKDVKLCDEW
Ga0208162_119650413300025674AqueousMIKTQPLKEYEYTTTDGEVRYLLAPDSEHAAWAAAELSNGTNNVLNVRLCDEW
Ga0208767_123416913300025769AqueousPNHAQLSVGRQLMRLQKPQLKEWQYTQTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW
Ga0208785_113059413300025815AqueousVLKKQTLKEYEYKRTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDE
Ga0208547_115969613300025828AqueousEYEYKRTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0208645_110555723300025853AqueousVHLAKQTLKEYEYKRTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0185543_104810833300029318MarineMKLQNSSLKEWQYTQTDGQVRYLLAPDLEHAAWAAAELSGGTQFLKDVKLCDEW
Ga0183748_105303313300029319MarineMRLQNSSLKEWEYTQTDGQVRYLLAPNLEHAAWAAAELSGGTKFVKDVRLCDEW
Ga0183748_108157033300029319MarineMRLQKQPLSEWQYTTTDGQVRYLLAPNLEHAAWAAAELSGGTQFLKDVKLCDEW
Ga0135224_101361023300029753Marine HarborMRLQKSSLDEYEYRTTDGQVRYLLAPNLEHAAWAAAELSGGTQFLKDVKRCDEW
Ga0316207_1029990613300032212Microbial MatVLQKQQLKEYEYKTTTDSQVRYLLAPDSEHAAWAAAELSGGSQNVLDVRLCDEW
Ga0348335_091077_371_5353300034374AqueousMLKKQTLKEYEYKRTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0348335_118431_158_3253300034374AqueousMHLAKQTLKEYEYKRTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0348336_031852_1865_20293300034375AqueousMRLAKPQLKEYEFKQTDGQVRYLLAPDSEHAAWAAAELSGGSQYVLDVRLCDEW
Ga0348336_061553_3_1643300034375AqueousMRLAKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDE
Ga0348336_152822_1_2013300034375AqueousTHTNHNHGELNVHLAKQTLKEYEYRKTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0348336_199043_2_1693300034375AqueousHVLKKQTLKEYEYKRTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0348337_030001_1916_20833300034418AqueousMRLAKQTLKEYEYKRTDDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW
Ga0348337_033921_1846_20133300034418AqueousMHLAKQTLKEYEYRKTNDSQVRYLLAPDSEHAAWAAAELSGGSQFVLDVRLCDEW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.