Basic Information | |
---|---|
Family ID | F062737 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 130 |
Average Sequence Length | 43 residues |
Representative Sequence | VVHTAAEPPNHGRICLAMIGWTRNSRNDERKIVAA |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 34.62 % |
% of genes near scaffold ends (potentially truncated) | 63.85 % |
% of genes from short scaffolds (< 2000 bps) | 90.00 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.692 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.769 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.385 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.10% β-sheet: 0.00% Coil/Unstructured: 61.90% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF00549 | Ligase_CoA | 56.92 |
PF02629 | CoA_binding | 20.77 |
PF08328 | ASL_C | 3.08 |
PF01553 | Acyltransferase | 1.54 |
PF02782 | FGGY_C | 0.77 |
PF01642 | MM_CoA_mutase | 0.77 |
PF13180 | PDZ_2 | 0.77 |
PF08442 | ATP-grasp_2 | 0.77 |
PF01029 | NusB | 0.77 |
PF13344 | Hydrolase_6 | 0.77 |
COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
---|---|---|---|
COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 57.69 |
COG0074 | Succinyl-CoA synthetase, alpha subunit | Energy production and conversion [C] | 56.92 |
COG0015 | Adenylosuccinate lyase | Nucleotide transport and metabolism [F] | 3.08 |
COG0458 | Carbamoylphosphate synthase large subunit | Amino acid transport and metabolism [E] | 1.54 |
COG0026 | Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) | Nucleotide transport and metabolism [F] | 0.77 |
COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.77 |
COG1042 | Acyl-CoA synthetase (NDP forming) | Energy production and conversion [C] | 0.77 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.69 % |
Unclassified | root | N/A | 32.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090008|P3_DRAFT_NODE_260473_len_1005_cov_11_758209 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300000044|ARSoilOldRDRAFT_c005486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
3300000953|JGI11615J12901_11494905 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300001686|C688J18823_10047246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2976 | Open in IMG/M |
3300001686|C688J18823_11041295 | Not Available | 519 | Open in IMG/M |
3300004058|Ga0055498_10008017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1303 | Open in IMG/M |
3300004062|Ga0055500_10000208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5232 | Open in IMG/M |
3300004081|Ga0063454_101104611 | Not Available | 648 | Open in IMG/M |
3300004463|Ga0063356_104557732 | Not Available | 596 | Open in IMG/M |
3300005168|Ga0066809_10185364 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300005295|Ga0065707_10050202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
3300005336|Ga0070680_101132107 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300005438|Ga0070701_10767745 | Not Available | 655 | Open in IMG/M |
3300005526|Ga0073909_10477763 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300005564|Ga0070664_102289006 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005764|Ga0066903_108519909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
3300005836|Ga0074470_11308519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6097 | Open in IMG/M |
3300005844|Ga0068862_100361956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1348 | Open in IMG/M |
3300006578|Ga0074059_11590797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
3300006806|Ga0079220_10152146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1278 | Open in IMG/M |
3300006844|Ga0075428_100002865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18808 | Open in IMG/M |
3300006847|Ga0075431_100995100 | Not Available | 805 | Open in IMG/M |
3300006847|Ga0075431_101597928 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300006852|Ga0075433_10002489 | All Organisms → cellular organisms → Bacteria | 14019 | Open in IMG/M |
3300006853|Ga0075420_101229535 | Not Available | 643 | Open in IMG/M |
3300006880|Ga0075429_101110738 | Not Available | 690 | Open in IMG/M |
3300006918|Ga0079216_10029969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2168 | Open in IMG/M |
3300006918|Ga0079216_10804967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 691 | Open in IMG/M |
3300007265|Ga0099794_10084628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1568 | Open in IMG/M |
3300009053|Ga0105095_10054879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2143 | Open in IMG/M |
3300009078|Ga0105106_10838149 | Not Available | 655 | Open in IMG/M |
3300009081|Ga0105098_10465720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 638 | Open in IMG/M |
3300009147|Ga0114129_10153117 | All Organisms → cellular organisms → Bacteria | 3155 | Open in IMG/M |
3300009156|Ga0111538_12882905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
3300009177|Ga0105248_11432821 | Not Available | 782 | Open in IMG/M |
3300009814|Ga0105082_1053817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
3300009840|Ga0126313_10992882 | Not Available | 687 | Open in IMG/M |
3300010322|Ga0134084_10387576 | Not Available | 542 | Open in IMG/M |
3300010361|Ga0126378_13386149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300010403|Ga0134123_11212130 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300010403|Ga0134123_12273163 | Not Available | 605 | Open in IMG/M |
3300012142|Ga0137343_1007706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1286 | Open in IMG/M |
3300012159|Ga0137344_1082884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 591 | Open in IMG/M |
3300012164|Ga0137352_1111112 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300012212|Ga0150985_100504499 | Not Available | 830 | Open in IMG/M |
3300012212|Ga0150985_105762329 | Not Available | 723 | Open in IMG/M |
3300012469|Ga0150984_119612939 | Not Available | 765 | Open in IMG/M |
3300012484|Ga0157333_1004622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 828 | Open in IMG/M |
3300012496|Ga0157353_1022535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 618 | Open in IMG/M |
3300012900|Ga0157292_10087897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 905 | Open in IMG/M |
3300012929|Ga0137404_11346394 | Not Available | 659 | Open in IMG/M |
3300012944|Ga0137410_11080629 | Not Available | 686 | Open in IMG/M |
3300012944|Ga0137410_11529511 | Not Available | 583 | Open in IMG/M |
3300012961|Ga0164302_10832331 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300012961|Ga0164302_11589028 | Not Available | 543 | Open in IMG/M |
3300015245|Ga0137409_10166088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2010 | Open in IMG/M |
3300015371|Ga0132258_11726552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1579 | Open in IMG/M |
3300015371|Ga0132258_12174758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1393 | Open in IMG/M |
3300018053|Ga0184626_10225481 | Not Available | 790 | Open in IMG/M |
3300018422|Ga0190265_10291256 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
3300018422|Ga0190265_12650781 | Not Available | 598 | Open in IMG/M |
3300018432|Ga0190275_12432351 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300018920|Ga0190273_12413029 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300020202|Ga0196964_10103015 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
3300020202|Ga0196964_10285313 | Not Available | 780 | Open in IMG/M |
3300020202|Ga0196964_10510973 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300021066|Ga0196980_1053304 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300021082|Ga0210380_10325800 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300021090|Ga0210377_10368753 | Not Available | 861 | Open in IMG/M |
3300024246|Ga0247680_1010514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1359 | Open in IMG/M |
3300024284|Ga0247671_1033009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 790 | Open in IMG/M |
3300024287|Ga0247690_1032174 | Not Available | 607 | Open in IMG/M |
3300024290|Ga0247667_1018050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Ferrovales → Ferrovaceae → Ferrovum → Ferrovum myxofaciens | 1376 | Open in IMG/M |
3300024323|Ga0247666_1018909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1483 | Open in IMG/M |
3300025318|Ga0209519_10122010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1538 | Open in IMG/M |
3300025318|Ga0209519_10133325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1468 | Open in IMG/M |
3300025899|Ga0207642_10656042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 658 | Open in IMG/M |
3300025904|Ga0207647_10147398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Ferrovales → Ferrovaceae → Ferrovum → Ferrovum myxofaciens | 1377 | Open in IMG/M |
3300025906|Ga0207699_10818403 | Not Available | 685 | Open in IMG/M |
3300025906|Ga0207699_11311689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 536 | Open in IMG/M |
3300025929|Ga0207664_10917062 | Not Available | 786 | Open in IMG/M |
3300025931|Ga0207644_11038193 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300025937|Ga0207669_11784066 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300025938|Ga0207704_10144256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1670 | Open in IMG/M |
3300025944|Ga0207661_10776305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
3300025945|Ga0207679_11912708 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300025965|Ga0210090_1006407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1605 | Open in IMG/M |
3300026047|Ga0208658_1015537 | Not Available | 612 | Open in IMG/M |
3300026088|Ga0207641_10038359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4005 | Open in IMG/M |
3300026523|Ga0209808_1297179 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300026815|Ga0207442_101458 | Not Available | 917 | Open in IMG/M |
3300026820|Ga0207603_100895 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300027378|Ga0209981_1004563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1820 | Open in IMG/M |
3300027713|Ga0209286_1010363 | Not Available | 3296 | Open in IMG/M |
3300027775|Ga0209177_10313238 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300027821|Ga0209811_10034039 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
3300027882|Ga0209590_10953987 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300027886|Ga0209486_10145201 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
3300027886|Ga0209486_11023765 | Not Available | 556 | Open in IMG/M |
3300027886|Ga0209486_11113380 | Not Available | 537 | Open in IMG/M |
3300027903|Ga0209488_11040240 | Not Available | 564 | Open in IMG/M |
3300027979|Ga0209705_10106448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1523 | Open in IMG/M |
3300028293|Ga0247662_1030078 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300028590|Ga0247823_11205770 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300028802|Ga0307503_10636280 | Not Available | 593 | Open in IMG/M |
3300028812|Ga0247825_10632714 | Not Available | 767 | Open in IMG/M |
3300030006|Ga0299907_10914538 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300030294|Ga0311349_10186788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1950 | Open in IMG/M |
3300031152|Ga0307501_10231696 | Not Available | 542 | Open in IMG/M |
3300031199|Ga0307495_10061696 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
3300031538|Ga0310888_10326842 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300031538|Ga0310888_10641015 | Not Available | 648 | Open in IMG/M |
3300031720|Ga0307469_10013893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4099 | Open in IMG/M |
3300031731|Ga0307405_10848069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
3300031852|Ga0307410_11801172 | Not Available | 544 | Open in IMG/M |
3300031854|Ga0310904_11414768 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300031892|Ga0310893_10159606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 883 | Open in IMG/M |
3300031903|Ga0307407_11311566 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300031908|Ga0310900_11205975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
3300032002|Ga0307416_103895529 | Not Available | 500 | Open in IMG/M |
3300032017|Ga0310899_10264872 | Not Available | 786 | Open in IMG/M |
3300032144|Ga0315910_10343315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1138 | Open in IMG/M |
3300032144|Ga0315910_10401788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
3300032211|Ga0310896_10312661 | Not Available | 816 | Open in IMG/M |
3300032256|Ga0315271_11048027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
3300033550|Ga0247829_10732903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 823 | Open in IMG/M |
3300033551|Ga0247830_10613983 | Not Available | 861 | Open in IMG/M |
3300034384|Ga0372946_0025997 | Not Available | 2584 | Open in IMG/M |
3300034417|Ga0364941_013753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1565 | Open in IMG/M |
3300034819|Ga0373958_0175452 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.46% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.15% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.38% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.38% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.08% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 3.08% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.08% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.31% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.31% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.31% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.54% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.54% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.54% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.54% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.54% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.54% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.54% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.54% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.77% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.77% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.77% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.77% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.77% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.77% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.77% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.77% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.77% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.77% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.77% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.77% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.77% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.77% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012142 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT499_2 | Environmental | Open in IMG/M |
3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012484 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510 | Environmental | Open in IMG/M |
3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
3300021066 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_10-13C | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026047 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026815 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A4w-12 (SPAdes) | Environmental | Open in IMG/M |
3300026820 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-A (SPAdes) | Environmental | Open in IMG/M |
3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P3_DRAFT_00913650 | 2088090008 | Soil | MHVVHTAAEPPNQGRMIFAMIGWTSNNRNADRKIVAA |
ARSoilOldRDRAFT_0054862 | 3300000044 | Arabidopsis Rhizosphere | PAEPPNQGRICFAMIGWTRNSRNDERKIVAAYGSVATREYGLASV* |
JGI11615J12901_114949051 | 3300000953 | Soil | HGRICLAMIGWTRNSRNDERKIVAAYGSVPSREYGRTRV* |
C688J18823_100472465 | 3300001686 | Soil | VHTPAEPPNHGRICLAMIGCTRNSRNDERKIVVAYGSVAASG* |
C688J18823_110412952 | 3300001686 | Soil | PAEPPNHGRICFAMIGCTRNSRNDERKIVPAYGIVLNSGVRIT* |
Ga0055498_100080173 | 3300004058 | Natural And Restored Wetlands | PNHGRICLAMIGWTRNSRNDERKIVAAYGRVAASGARITWA* |
Ga0055500_100002084 | 3300004062 | Natural And Restored Wetlands | MHVVHTAAPPPNQGRIRRAISGWTRNSRNDDRKIVTAYSRGAGFRC* |
Ga0063454_1011046112 | 3300004081 | Soil | PAEPPNHGRICLAMIGCTRNSRNDERKIVVAYGSVAASG* |
Ga0063356_1045577321 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ASSTLWKNTRQVVHTAAEPPNHGRICLAMIGWTRNSRNDERKMVAAYGSVATSG* |
Ga0066809_101853642 | 3300005168 | Soil | VFQTPAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVATRE* |
Ga0065707_100502022 | 3300005295 | Switchgrass Rhizosphere | VVQTPAEPPNHGRICFAMIGWTRNSRNDERKIVAAYGSVATREYGLTSV* |
Ga0070680_1011321072 | 3300005336 | Corn Rhizosphere | RQVVHTPAEPPNHGRICLAMIGWTRNSRNDDRKIVPAYGMVLNSGVRIT* |
Ga0070701_107677452 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VHTAAEPPNHGRICLAMIGCTRKSRNDERKIVPAYGSVASRG* |
Ga0073909_104777632 | 3300005526 | Surface Soil | KNTRQVVHTAAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVATRE* |
Ga0070664_1022890062 | 3300005564 | Corn Rhizosphere | PNHGRICLAMIGWTRNSRNDERKIVAAYGSVPSREYGRTRV* |
Ga0066903_1085199092 | 3300005764 | Tropical Forest Soil | NHGRICLAMIGWTRNSRNDDRKMVAAYGSVASSGWRIT* |
Ga0074470_113085194 | 3300005836 | Sediment (Intertidal) | MQVVHTAAVPPNQGRIWRAISGCTRNNRNEDRKIVAA* |
Ga0068862_1003619563 | 3300005844 | Switchgrass Rhizosphere | RMLWKNTRHVVHTAAEPPNHGRICLAMIGCTRNSRKDERKMVAA* |
Ga0074059_115907972 | 3300006578 | Soil | VVQTPAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVATRE* |
Ga0079220_101521463 | 3300006806 | Agricultural Soil | EPPNHGRICLAMIGCTRNSRNDERKIVAAYGSVAASGVRIT* |
Ga0075428_1000028656 | 3300006844 | Populus Rhizosphere | VVQTPAEPPNHGRICLAMIGWTRNSRNDERKIVAA* |
Ga0075431_1009951002 | 3300006847 | Populus Rhizosphere | QVVHTAAEPPNHGRICLAMIGCTRNSRNEERKIVPA* |
Ga0075431_1015979281 | 3300006847 | Populus Rhizosphere | TAAEPPNQGRICLAMIGCTRNSRNDERKIVAAYGSVAASG* |
Ga0075433_1000248920 | 3300006852 | Populus Rhizosphere | VVQTPAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVPSREYGRTRV* |
Ga0075420_1012295352 | 3300006853 | Populus Rhizosphere | NTRQVVHTAAEPPNHGRICLAMIGCTRNSRNDERKIVAAYGSVATSGVRAARV* |
Ga0075429_1011107382 | 3300006880 | Populus Rhizosphere | ASSTLWKNTRQVVHTAAEPPNHGRICLAMIGCTRNSRNDERKIVAAYGSVATSGVRAARV |
Ga0079216_100299693 | 3300006918 | Agricultural Soil | VVHTPAEPPNQGRICLAMIGWTRNSRNDERKIVAA* |
Ga0079216_108049672 | 3300006918 | Agricultural Soil | VVHTAAEPPNHGRICLAMIGWTRNSRNDDRKIVAA* |
Ga0099794_100846283 | 3300007265 | Vadose Zone Soil | WKNTRQVAHTAAEPPNHGRICFAMIGCTRNSRNDERKIVAA* |
Ga0105095_100548793 | 3300009053 | Freshwater Sediment | VVQTAAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGRVAASGSLAT* |
Ga0105106_108381491 | 3300009078 | Freshwater Sediment | NSNRNWKNTRQVVHTAADPPNHGRICFAMTGWTRKSKKALVNIVAA* |
Ga0105098_104657202 | 3300009081 | Freshwater Sediment | VVHTAAEPPNQGRICLAMMGWTRNSRNDERNIVAAYGSVASSESGVATE* |
Ga0114129_101531175 | 3300009147 | Populus Rhizosphere | VVHTPAEPPNHGRICLAMIGCTRNSRNDDRKIVAAYGSAAASG* |
Ga0111538_128829052 | 3300009156 | Populus Rhizosphere | VVHTPAEPPNHGRICLAMIGWTRNSRKDERKIVAA* |
Ga0105248_114328211 | 3300009177 | Switchgrass Rhizosphere | AWKNTRQVAQTATLPPKRGRISLAMIGWTRNSRNDERKIVAA* |
Ga0105082_10538172 | 3300009814 | Groundwater Sand | VVHTAAEPPNQGRICLAMIGWTRNSRNDDRKIVAAYGSVATSEYRVARV* |
Ga0126313_109928822 | 3300009840 | Serpentine Soil | LWKNTRQVVHTPAEPPNHGRICFAMIGCTRNSRNDERKIVPA* |
Ga0134084_103875761 | 3300010322 | Grasslands Soil | NTMHVVHTAADPPNHGRICLAMIGCTRNSRNDERKIVAA* |
Ga0126378_133861491 | 3300010361 | Tropical Forest Soil | MHVVHTAADPPNHGRINLAKTGWIRNRRNAAKKIADP* |
Ga0134123_112121302 | 3300010403 | Terrestrial Soil | AEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVPSREYGRTRV* |
Ga0134123_122731632 | 3300010403 | Terrestrial Soil | AEPPNQGRICLAMIGWTRNSRNDDRKIVPAYGRVASRG* |
Ga0137343_10077062 | 3300012142 | Soil | VVQTAAEPPNHGRICLAMIGWTRKSRNDDRKIVAA* |
Ga0137344_10828842 | 3300012159 | Soil | VVQTAAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVATSEYRVARV* |
Ga0137352_11111122 | 3300012164 | Soil | VVQTAAEPPNHGRICLAMIGWTRNSRNDERKIVAA* |
Ga0150985_1005044992 | 3300012212 | Avena Fatua Rhizosphere | PNHGRICLAMIGCTRNSRNDERNIVAAYGSVATIG* |
Ga0150985_1057623292 | 3300012212 | Avena Fatua Rhizosphere | VVQTPAEPPNQGRICLAMIGWTRNSRNDERKIVAA* |
Ga0150984_1196129391 | 3300012469 | Avena Fatua Rhizosphere | EPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVANSEYGLTSV* |
Ga0157333_10046222 | 3300012484 | Soil | VVQTPAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVATREYGLASV* |
Ga0157353_10225352 | 3300012496 | Unplanted Soil | MQVVQTAEVPPNQGRICLAMIGWTRNSRNDERKIVAA* |
Ga0157292_100878972 | 3300012900 | Soil | VVHTAAEPPNHGRICLAMIGWTRNSRNDERKVVAAYGSVATRE* |
Ga0137404_113463941 | 3300012929 | Vadose Zone Soil | NTRQVVHTAAEPPNHGRICLAMIGWTRNSRNDERKMVAAYGRLASSGKRIT* |
Ga0137410_110806292 | 3300012944 | Vadose Zone Soil | MLWKKTRQVVHTAAEPPNHGRICLAMIGWTRNSRNEERKIVAA* |
Ga0137410_115295112 | 3300012944 | Vadose Zone Soil | GRICLAMIGCTRNSRNDERKIVAAYGIDPNSGVRIT* |
Ga0164302_108323311 | 3300012961 | Soil | VVQTPAEPPNHGRICLAMIGCTRNSRNDERKIVAAYGSVAIRE* |
Ga0164302_115890282 | 3300012961 | Soil | NQGRICLAMIGWTRNSRNDDRKIVPAYGRVASRG* |
Ga0137409_101660882 | 3300015245 | Vadose Zone Soil | MQVVHTAEVPPNHGRICLAMIGWTRNSRNDERKIVAA* |
Ga0132258_117265522 | 3300015371 | Arabidopsis Rhizosphere | VVQTPAEPPNQGRICFAMIGWTRNSRNDERKIVAAYGSVATREYGLASV* |
Ga0132258_121747583 | 3300015371 | Arabidopsis Rhizosphere | WKKTRQVVHTPAEPPNHGRICLAMIGCTRNSRNDERKIVAA* |
Ga0184626_102254812 | 3300018053 | Groundwater Sediment | VDWKKTRHVVQTAAEPPNHGRICLAMIGWTRNSRNDERKMVAA |
Ga0190265_102912563 | 3300018422 | Soil | VVHTAAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGRVAARGRRAT |
Ga0190265_126507811 | 3300018422 | Soil | LWKNTRQVVHTAAEPPNHGRICLAMIGWTRNSRNDDRKMVAAYGSVATSG |
Ga0190275_124323511 | 3300018432 | Soil | VVHTAAEPPNHGRICLAMIGWTRNSRNDERKMVAAYGSVATSG |
Ga0190273_124130292 | 3300018920 | Soil | VVHTPAEPPNHGRICLAMIGYTRNSRNDERKIVAA |
Ga0196964_101030151 | 3300020202 | Soil | PAEPPNHGRICLAMIGWTRNSRNDDRKIVPAYGSVAAKVRRAT |
Ga0196964_102853132 | 3300020202 | Soil | EPPNHGRICLAMIGWTRNRRNEERKIVAAYGSVASSG |
Ga0196964_105109732 | 3300020202 | Soil | PASSTLWKKTRHVVQTAAEPPNHGRICLAMIGWTRNSRNDERKIVAA |
Ga0196980_10533042 | 3300021066 | Soil | WKNTRQVVQTAAEPPNHGRICLAMIGCTRNSRNEDRKTVAA |
Ga0210380_103258001 | 3300021082 | Groundwater Sediment | VVQTPAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVATRE |
Ga0210377_103687532 | 3300021090 | Groundwater Sediment | ASSRLWKNTMQVVHTPAEPPNQGRICLAMTGWTRNSRNDERKIVAA |
Ga0247680_10105141 | 3300024246 | Soil | HTPAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVPSREYGRTRV |
Ga0247671_10330092 | 3300024284 | Soil | VVHTAAEPPNHGRICLAMIGWTRNSRNDERKIVPA |
Ga0247690_10321741 | 3300024287 | Soil | LVQPITAAEPPNHGRICLAMIGWTRNSRNDERKIVPA |
Ga0247667_10180501 | 3300024290 | Soil | TRHVVHTPAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVPSREYGRTRV |
Ga0247666_10189093 | 3300024323 | Soil | PAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVPSREYGRTRV |
Ga0209519_101220103 | 3300025318 | Soil | PARSTLWKKTRQVVQTAAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGRVAASGSLAT |
Ga0209519_101333252 | 3300025318 | Soil | VVHTPAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVAASG |
Ga0207642_106560422 | 3300025899 | Miscanthus Rhizosphere | MHVVQTAALPPNQGRMSRAISGCTRKSRNDERNIVAAYGSVATIG |
Ga0207647_101473981 | 3300025904 | Corn Rhizosphere | WKNTRQVVQTPAEPPNHGRICLAMIGWTRNSRNDERKIVAA |
Ga0207699_108184032 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TRQVVHTLAEPPNHGRICLAMIGCTRKSRNDERKIVAAYGSVATSG |
Ga0207699_113116891 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VVHTAALPPNHGRISRAISGWTRNSRNDDRKIVAA |
Ga0207664_109170621 | 3300025929 | Agricultural Soil | WKKTRQVVHTLAEPPNHGRICLAMIGCTRKSRNDERKIVAAYGSVATSG |
Ga0207644_110381931 | 3300025931 | Switchgrass Rhizosphere | VVQTPAEPPNHGRICLAMIGWTRNSRNDERKIVAA |
Ga0207669_117840662 | 3300025937 | Miscanthus Rhizosphere | MQVVQTTAVPPNQGRICLARRGWTRKSRKALRKIVAA |
Ga0207704_101442561 | 3300025938 | Miscanthus Rhizosphere | MLWKNTRHVVHTAAEPPNHGRICLAMIGCTRNSRNDERKIVAA |
Ga0207661_107763052 | 3300025944 | Corn Rhizosphere | QVVQTLAAPPNHGRICFAMIGWTRNSRNDDRKIVAAYGNVAASG |
Ga0207679_119127082 | 3300025945 | Corn Rhizosphere | PNHGRICLAMIGWTRNSRNDERKIVAAYGSVPSREYGRTRV |
Ga0210090_10064072 | 3300025965 | Natural And Restored Wetlands | SMHVVHTAAPPPNQGRIRRAISGWTRNSRNDDRKIVTAYSRGAGFRC |
Ga0208658_10155372 | 3300026047 | Natural And Restored Wetlands | TLWKNTRQVVHTAAEPPNHGRICLAMMGWTRNSRNDERKIVAAYGRVAARGARITWA |
Ga0207641_100383592 | 3300026088 | Switchgrass Rhizosphere | VFQTPAEPPNHGRICLAMIGWTRNSRNDERKIVAA |
Ga0209808_12971792 | 3300026523 | Soil | AYPASSTLWKKTRQVVHTPAEPPNHGRICLAMIGCTRNSRNDDRKIVPA |
Ga0207442_1014582 | 3300026815 | Soil | MQVVHTAALPPNHGRICLAMIGWTRNSRKDERKIVAA |
Ga0207603_1008952 | 3300026820 | Soil | VFQTPAEPPNHGRICLAMIGWTRNSRNDERKVVAAYGSVATRE |
Ga0209981_10045633 | 3300027378 | Arabidopsis Thaliana Rhizosphere | STLWKKTRQVVHTAAEPPNQGRICLAMIGCTRNSRNDERKIVAA |
Ga0209286_10103633 | 3300027713 | Freshwater Sediment | VVQTAAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGRVAASGSLAT |
Ga0209177_103132381 | 3300027775 | Agricultural Soil | TRQVVHTPAEPPNHGRICLAMIGCTRNSRNDERKIVAAYGSVAASGVRIT |
Ga0209811_100340392 | 3300027821 | Surface Soil | VVHTAAEPPNHGRICLAMIGWTRNSRNEERKIVPA |
Ga0209590_109539872 | 3300027882 | Vadose Zone Soil | TRQVVQTPAEPPNQGRICLAMIGWTRNSRNEERKIVPA |
Ga0209486_101452012 | 3300027886 | Agricultural Soil | VVQTAAEPPNHGRICLAMIGWTRNSRNDDRKIVAA |
Ga0209486_110237651 | 3300027886 | Agricultural Soil | RQVVHTAAEPPNHGRICLAMIGWTRNSRNDDRKMVAAYGNVATSG |
Ga0209486_111133801 | 3300027886 | Agricultural Soil | TLWKKTRQVVHTAAEPPNHGRICFAMIGCTRNSRNDERKIVAAYGSVATSE |
Ga0209488_110402402 | 3300027903 | Vadose Zone Soil | LWKNTMQVVHTAAEPPNHGRICLAMIGCTRNSRNEERKIVPA |
Ga0209705_101064483 | 3300027979 | Freshwater Sediment | KNTRHVVHTAAEPPNHGRICLAMIGWTRNSRNDERKIVAA |
Ga0247662_10300782 | 3300028293 | Soil | AYPASSTLWKKTRQVVHTPAEPPNHGRICLAMIGCTRNNRNDERKIVAA |
Ga0247823_112057701 | 3300028590 | Soil | LWKNNRQVVHTAAEPPNQGRICLAMIGCTRKSRNEDRKMVAAYGRVATSGVRAASV |
Ga0307503_106362801 | 3300028802 | Soil | WKNTMQVVHTPAEPPNQGRICLAITGCTRNSRNDDRKIVAA |
Ga0247825_106327141 | 3300028812 | Soil | KKTRQVVHTAAEPPNQGRICLAMIGCTRNSRKDERKIVAAYGSVATRE |
Ga0299907_109145382 | 3300030006 | Soil | VVQTPAEPPNQGRICLAMIGCTKNSRNDERKIVAAYGSVASRE |
Ga0311349_101867882 | 3300030294 | Fen | VLWKKTRQVVQTAAEPPNHGRICFAMIGWSRNSRNALVKIVRADYSMGGCDR |
Ga0307501_102316961 | 3300031152 | Soil | RQVVQTPAEPPNHGRICLAMIGWTRNSRNDERKIVPA |
Ga0307495_100616961 | 3300031199 | Soil | QTPAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVATREYGLARV |
Ga0310888_103268421 | 3300031538 | Soil | WKNTRQVVQTPAEPPNHGRICLAMIGCTRNSRNDERKIVAAYGSVATRE |
Ga0310888_106410151 | 3300031538 | Soil | RQVVQTAAEPPNQGRICPAMIGCTRNSRNDERKIVAAYGSVATREYGLARV |
Ga0307469_100138931 | 3300031720 | Hardwood Forest Soil | PPNHGRICLAMIGWTRNSRKDERKMVAAYGRLASSGKRIT |
Ga0307405_108480692 | 3300031731 | Rhizosphere | VVHTAAEPPNHGRICLAMIGWTRNSRNDERKIVAA |
Ga0307410_118011722 | 3300031852 | Rhizosphere | TRQVVHTAAEPPNQGRICLAMIGCTRNSRNDDRKMVAAYGSVATSGVRAASV |
Ga0310904_114147681 | 3300031854 | Soil | VVHTAADPPNHGRICFAMIGWTRNSRNDDRKIVPAYGSVASRG |
Ga0310893_101596062 | 3300031892 | Soil | MQVVHTAEVPPNHGRICLAMIGWTRNSRNDERKIVAA |
Ga0307407_113115662 | 3300031903 | Rhizosphere | PAEPPNQGRICLAMIGWTRNSRNDDRNIVAAYGNVPASE |
Ga0310900_112059752 | 3300031908 | Soil | KKTMHVVHTPSEPPNHGRICLAITGCTRNSRNDDRNIVAA |
Ga0307416_1038955291 | 3300032002 | Rhizosphere | TLWKKTRHVVQTAAEPPNHGRICLAMIGCTMNSRNDERKIVPAYGSVASNG |
Ga0310899_102648721 | 3300032017 | Soil | VVQTPAEPPNQGRICLAMIGCTRNSRNDERKIVAA |
Ga0315910_103433152 | 3300032144 | Soil | VVHTPAEPPNHGRICLAMIGWTRNSRNDERKIVAA |
Ga0315910_104017882 | 3300032144 | Soil | WKNTLQVVHTPADPPNHGRICLAMTGCTRNSRNDDRNIVAA |
Ga0310896_103126612 | 3300032211 | Soil | VHTAAEPPNHGRICLAMIGCTRNSRNDERKIVAAYGSVATREYGLARV |
Ga0315271_110480271 | 3300032256 | Sediment | NSMQVVYTAAVPPNQGRICRAINGCTRNSKNEDKKIVAA |
Ga0247829_107329032 | 3300033550 | Soil | VVQTAAEPPNQGRICLAMMGWTRNSRNDERNIVAAYGSVASSESGVATE |
Ga0247830_106139831 | 3300033551 | Soil | QVVHTPAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVASSE |
Ga0372946_0025997_2471_2578 | 3300034384 | Soil | VVQTAAEPPNQGRICLAMIGCTRNSRNDERKIVAA |
Ga0364941_013753_906_1037 | 3300034417 | Sediment | VVQTPAEPPNHGRICLAMIGWTRNSRNDERKIVAAYGSVATRD |
Ga0373958_0175452_2_121 | 3300034819 | Rhizosphere Soil | PAEPPNHGRICLAMIGCTRNSRNDERKIVAAYGSVATRE |
⦗Top⦘ |