Metagenome Family F061932

Basic Information
Family ID	F061932
Family Type	Metagenome
Number of Sequences	131
Average Sequence Length	36 residues
Representative Sequence	MLTGILLRKKGKTKTLTIMLIVSALLLIGGILMLVK
Number of Associated Samples	93
Number of Associated Scaffolds	131

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	6.11 %
% of genes from short scaffolds (< 2000 bps)	80.15 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Most Common Taxonomy
Group	Bacteria (97.710 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (33.588 % of family members)
Environment Ontology (ENVO)	Unclassified (38.168 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (38.931 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 131 Family Scaffolds
PF00072	Response_reg	29.01
PF04397	LytTR	21.37
PF06580	His_kinase	20.61
PF14501	HATPase_c_5	16.79
PF00775	Dioxygenase_C	2.29
PF02771	Acyl-CoA_dh_N	1.53
PF01381	HTH_3	1.53
PF07681	DoxX	1.53
PF07452	CHRD	0.76
PF07715	Plug	0.76
PF13198	DUF4014	0.76
PF00583	Acetyltransf_1	0.76
PF04264	YceI	0.76

COG ID	Name	Functional Category	% Frequency in 131 Family Scaffolds
COG2972	Sensor histidine kinase YesM	Signal transduction mechanisms [T]	20.61
COG3275	Sensor histidine kinase, LytS/YehU family	Signal transduction mechanisms [T]	20.61
COG3485	Protocatechuate 3,4-dioxygenase beta subunit	Secondary metabolites biosynthesis, transport and catabolism [Q]	2.29
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	1.53
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	1.53
COG4270	Uncharacterized membrane protein	Function unknown [S]	1.53
COG2353	Polyisoprenoid-binding periplasmic protein YceI	General function prediction only [R]	0.76

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	97.71 %
Unclassified	root	N/A	2.29 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	97.71 %
Unclassified	root	N/A	2.29 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	97.71 %
Unclassified	root	N/A	2.29 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	97.71 %
Unclassified	root	N/A	2.29 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	97.71 %
Unclassified	root	N/A	2.29 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	97.71 %
Unclassified	root	N/A	2.29 %

Name	Rank	Taxonomy	Distribution
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	51.15 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	3.05 %
Unclassified	root	N/A	2.29 %
Sphingobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia	1.53 %

Name	Rank	Taxonomy	Distribution
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	51.15 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	3.05 %
Unclassified	root	N/A	2.29 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	1.53 %

Name	Rank	Taxonomy	Distribution
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	51.15 %
Unclassified	root	N/A	2.29 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	1.53 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	1.53 %
Spirosomaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae	0.76 %
Cyclobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae	0.76 %

Name	Rank	Taxonomy	Distribution
unclassified Chitinophagaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae	13.74 %
Flavihumibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter	12.21 %
Unclassified	root	N/A	2.29 %
Niabella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella	1.53 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	1.53 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	1.53 %
Aquiflexum	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Aquiflexum	0.76 %
Runella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Runella	0.76 %

Name	Rank	Taxonomy	Distribution
Flavihumibacter solisilvae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	9.92 %
Chitinophagaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	8.40 %
Chitinophagaceae bacterium IBVUCB2	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB2	5.34 %
Unclassified	root	N/A	2.29 %
Niabella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella	1.53 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	1.53 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	1.53 %
Flavihumibacter petaseus	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus	0.76 %
Aquiflexum balticum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Aquiflexum → Aquiflexum balticum	0.76 %
Runella zeae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Runella → Runella zeae	0.76 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000559\|F14TC_100052420	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Aquiflexum → Aquiflexum balticum	581	Open in IMG/M
3300000559\|F14TC_100052421	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	562	Open in IMG/M
3300000956\|JGI10216J12902_104151870	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	1339	Open in IMG/M
3300000956\|JGI10216J12902_106088293	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	1635	Open in IMG/M
3300000956\|JGI10216J12902_114007881	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1524	Open in IMG/M
3300002100\|JGI24809J26612_1000016	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	28049	Open in IMG/M
3300002100\|JGI24809J26612_1021973	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	1100	Open in IMG/M
3300005543\|Ga0070672_100331545	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1295	Open in IMG/M
3300005543\|Ga0070672_100977335	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	750	Open in IMG/M
3300005543\|Ga0070672_101998323	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	522	Open in IMG/M
3300005577\|Ga0068857_100068879	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	3150	Open in IMG/M
3300005617\|Ga0068859_100476609	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1343	Open in IMG/M
3300005617\|Ga0068859_100489134	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1326	Open in IMG/M
3300005617\|Ga0068859_100516278	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Runella → Runella zeae	1290	Open in IMG/M
3300005618\|Ga0068864_100072674	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2998	Open in IMG/M
3300005618\|Ga0068864_100121050	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2340	Open in IMG/M
3300005841\|Ga0068863_100576026	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1113	Open in IMG/M
3300006046\|Ga0066652_100019846	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella	4596	Open in IMG/M
3300006046\|Ga0066652_102001080	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	516	Open in IMG/M
3300006237\|Ga0097621_100893590	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	827	Open in IMG/M
3300006844\|Ga0075428_100067233	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella	3924	Open in IMG/M
3300006853\|Ga0075420_101778926	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	527	Open in IMG/M
3300006871\|Ga0075434_102541062	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	513	Open in IMG/M
3300006894\|Ga0079215_11576119	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	521	Open in IMG/M
3300009094\|Ga0111539_10530687	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1371	Open in IMG/M
3300009094\|Ga0111539_10620387	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	1259	Open in IMG/M
3300009100\|Ga0075418_10561243	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	1228	Open in IMG/M
3300009156\|Ga0111538_10573464	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	1431	Open in IMG/M
3300009156\|Ga0111538_12749022	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	617	Open in IMG/M
3300009156\|Ga0111538_13523480	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	543	Open in IMG/M
3300009174\|Ga0105241_11360088	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	678	Open in IMG/M
3300009553\|Ga0105249_10054877	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	3644	Open in IMG/M
3300009553\|Ga0105249_11285969	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	803	Open in IMG/M
3300009609\|Ga0105347_1420826	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus	576	Open in IMG/M
3300009610\|Ga0105340_1365504	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	640	Open in IMG/M
3300010036\|Ga0126305_10045950	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	2457	Open in IMG/M
3300010037\|Ga0126304_10227000	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	1225	Open in IMG/M
3300010397\|Ga0134124_10415400	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	1283	Open in IMG/M
3300010403\|Ga0134123_12332959	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	599	Open in IMG/M
3300011241\|Ga0137476_105046	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	786	Open in IMG/M
3300011422\|Ga0137425_1061661	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	865	Open in IMG/M
3300011430\|Ga0137423_1238797	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	539	Open in IMG/M
3300012882\|Ga0157304_1090366	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	542	Open in IMG/M
3300012883\|Ga0157281_1066126	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	590	Open in IMG/M
3300012885\|Ga0157287_1066008	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	605	Open in IMG/M
3300012891\|Ga0157305_10003743	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	2011	Open in IMG/M
3300012891\|Ga0157305_10046109	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	916	Open in IMG/M
3300012892\|Ga0157294_10064250	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	867	Open in IMG/M
3300012893\|Ga0157284_10177293	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	625	Open in IMG/M
3300012896\|Ga0157303_10071819	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	771	Open in IMG/M
3300012898\|Ga0157293_10153017	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	654	Open in IMG/M
3300012898\|Ga0157293_10184480	Not Available	617	Open in IMG/M
3300012899\|Ga0157299_10100949	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	746	Open in IMG/M
3300012900\|Ga0157292_10283584	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	588	Open in IMG/M
3300012904\|Ga0157282_10105377	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	797	Open in IMG/M
3300012907\|Ga0157283_10125709	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	723	Open in IMG/M
3300012985\|Ga0164308_11297762	Not Available	661	Open in IMG/M
3300013306\|Ga0163162_10345209	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	1621	Open in IMG/M
3300014326\|Ga0157380_11264823	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	784	Open in IMG/M
3300015200\|Ga0173480_10551740	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	699	Open in IMG/M
3300015201\|Ga0173478_10025122	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	1742	Open in IMG/M
3300015371\|Ga0132258_12534433	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter	1282	Open in IMG/M
3300015371\|Ga0132258_12778393	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1220	Open in IMG/M
3300015373\|Ga0132257_102490603	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	672	Open in IMG/M
3300017792\|Ga0163161_10368619	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	1145	Open in IMG/M
3300018067\|Ga0184611_1000627	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	6783	Open in IMG/M
3300018067\|Ga0184611_1067250	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	1215	Open in IMG/M
3300018067\|Ga0184611_1125507	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	902	Open in IMG/M
3300018072\|Ga0184635_10000165	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	14242	Open in IMG/M
3300018073\|Ga0184624_10035671	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	1947	Open in IMG/M
3300018083\|Ga0184628_10298692	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	846	Open in IMG/M
3300018084\|Ga0184629_10226039	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	974	Open in IMG/M
3300018469\|Ga0190270_10676889	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1019	Open in IMG/M
3300018469\|Ga0190270_11953873	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	644	Open in IMG/M
3300018476\|Ga0190274_10000814	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	18155	Open in IMG/M
3300018476\|Ga0190274_10552265	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	1166	Open in IMG/M
3300018476\|Ga0190274_10793921	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1003	Open in IMG/M
3300018476\|Ga0190274_10920127	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	943	Open in IMG/M
3300018481\|Ga0190271_10020739	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	5057	Open in IMG/M
3300018481\|Ga0190271_12461710	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	623	Open in IMG/M
3300019361\|Ga0173482_10169775	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	867	Open in IMG/M
3300019361\|Ga0173482_10179837	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	850	Open in IMG/M
3300019361\|Ga0173482_10415043	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	630	Open in IMG/M
3300019361\|Ga0173482_10491289	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	593	Open in IMG/M
3300019362\|Ga0173479_10016585	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	2021	Open in IMG/M
3300019362\|Ga0173479_10519501	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	605	Open in IMG/M
3300019362\|Ga0173479_10554703	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	592	Open in IMG/M
3300019884\|Ga0193741_1041162	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	1193	Open in IMG/M
3300019996\|Ga0193693_1070984	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	509	Open in IMG/M
3300020000\|Ga0193692_1012040	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	2118	Open in IMG/M
3300020009\|Ga0193740_1000426	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	11555	Open in IMG/M
3300020009\|Ga0193740_1031664	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	837	Open in IMG/M
3300020018\|Ga0193721_1073459	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	890	Open in IMG/M
3300020020\|Ga0193738_1000127	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	48478	Open in IMG/M
3300020020\|Ga0193738_1000186	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	43078	Open in IMG/M
3300020020\|Ga0193738_1006459	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	4000	Open in IMG/M
3300022880\|Ga0247792_1010801	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1402	Open in IMG/M
3300022893\|Ga0247787_1070853	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	533	Open in IMG/M
3300022899\|Ga0247795_1004761	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	2191	Open in IMG/M
3300022899\|Ga0247795_1009572	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1545	Open in IMG/M
3300022903\|Ga0247774_1144519	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	563	Open in IMG/M
3300023168\|Ga0247748_1009048	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	1297	Open in IMG/M
3300025893\|Ga0207682_10034892	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	2030	Open in IMG/M
3300025918\|Ga0207662_10314089	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1045	Open in IMG/M
3300025923\|Ga0207681_10886918	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	747	Open in IMG/M
3300025942\|Ga0207689_10281626	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	1377	Open in IMG/M
3300025960\|Ga0207651_10129763	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	1927	Open in IMG/M
3300025961\|Ga0207712_10014284	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	5104	Open in IMG/M
3300026041\|Ga0207639_10760488	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	901	Open in IMG/M
3300026089\|Ga0207648_10610160	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	1006	Open in IMG/M
3300026095\|Ga0207676_10009325	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	6984	Open in IMG/M
3300026095\|Ga0207676_10374616	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	1323	Open in IMG/M
3300026116\|Ga0207674_10068064	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	3584	Open in IMG/M
3300027513\|Ga0208685_1100440	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	622	Open in IMG/M
3300027695\|Ga0209966_1118490	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	606	Open in IMG/M
3300027778\|Ga0209464_10046799	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter	1415	Open in IMG/M
3300027831\|Ga0209797_10316724	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	646	Open in IMG/M
3300027907\|Ga0207428_10249389	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae	1324	Open in IMG/M
3300027907\|Ga0207428_10760613	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	690	Open in IMG/M
3300027993\|Ga0247749_1044041	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	535	Open in IMG/M
3300031226\|Ga0307497_10541072	Not Available	581	Open in IMG/M
3300031538\|Ga0310888_10303252	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB2	913	Open in IMG/M
3300031538\|Ga0310888_10751578	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB2	601	Open in IMG/M
3300031538\|Ga0310888_10784505	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB2	589	Open in IMG/M
3300031538\|Ga0310888_11000104	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	525	Open in IMG/M
3300031562\|Ga0310886_10076796	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB2	1600	Open in IMG/M
3300031858\|Ga0310892_11149243	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	552	Open in IMG/M
3300031943\|Ga0310885_10229756	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB2	931	Open in IMG/M
3300031944\|Ga0310884_10789782	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB2	580	Open in IMG/M
3300032144\|Ga0315910_10000302	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	52778	Open in IMG/M
3300032157\|Ga0315912_10111340	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB2	2146	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	67.94%
Host-Associated	Host-Associated	32.06%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	57.25%
Plants	Host-Associated → Plants	32.06%
Aquatic	Environmental → Aquatic	10.69%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	56.49%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.79%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.50%
Sediment	Environmental → Aquatic → Sediment	9.16%
Freshwater	Environmental → Aquatic → Freshwater	1.53%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.76%
Roots	Host-Associated → Plants → Roots	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	54.20%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.21%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	9.16%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.58%
Loam	Environmental → Terrestrial → Soil → Loam	2.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.29%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.53%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.76%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	38.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.21%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	9.16%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	6.11%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.34%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.58%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.29%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.53%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.53%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.76%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.76%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.76%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	33.59%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	8.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	6.11%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	6.11%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	5.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	4.58%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	3.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.05%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.29%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.29%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.29%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	1.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.53%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.53%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.53%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.53%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.53%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.53%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.53%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.76%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.76%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.76%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.76%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.76%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300002100	Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011241	Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 11 - S13.2.50.a - transect 2, age 50 years, surface depth).	Environmental	Open in IMG/M
3300011422	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2	Environmental	Open in IMG/M
3300011430	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2	Environmental	Open in IMG/M
3300012882	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2	Environmental	Open in IMG/M
3300012883	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1	Environmental	Open in IMG/M
3300012885	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1	Environmental	Open in IMG/M
3300012891	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2	Environmental	Open in IMG/M
3300012892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1	Environmental	Open in IMG/M
3300012893	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1	Environmental	Open in IMG/M
3300012896	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2	Environmental	Open in IMG/M
3300012898	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012900	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1	Environmental	Open in IMG/M
3300012904	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1	Environmental	Open in IMG/M
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018067	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300019884	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2	Environmental	Open in IMG/M
3300019996	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2	Environmental	Open in IMG/M
3300020000	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1	Environmental	Open in IMG/M
3300020009	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1	Environmental	Open in IMG/M
3300020018	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2	Environmental	Open in IMG/M
3300020020	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1	Environmental	Open in IMG/M
3300022880	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6	Environmental	Open in IMG/M
3300022893	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4	Environmental	Open in IMG/M
3300022899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6	Environmental	Open in IMG/M
3300022903	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6	Environmental	Open in IMG/M
3300023168	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027513	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)	Environmental	Open in IMG/M
3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)	Host-Associated	Open in IMG/M
3300027778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)	Environmental	Open in IMG/M
3300027831	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027993	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F061932

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F14TC_1000524202	3300000559	Soil	MLTGLLLRKRGKIKTLIVLFIVSSLLLIGGILMLVK*
F14TC_1000524212	3300000559	Soil	MLTGILLRKKGKTKTLIILFIVFTLLLIGGIIILVK*
JGI10216J12902_1041518702	3300000956	Soil	MLTGLLLRKKGKTKTLIVMLITSSLLLIGGILMLIK*
JGI10216J12902_1060882932	3300000956	Soil	MLTGILLRKKGKTKTLVIMLIASSLLLIGGILILVK*
JGI10216J12902_1140078813	3300000956	Soil	MLTGLLLRKKGKTKTLIVMLIASSLLLIGGILMVIK*
JGI24809J26612_100001616	3300002100	Soil	MLTGLLLRKRGKTKTLITLIIVSSLLLIGGILMLVK*
JGI24809J26612_10219732	3300002100	Soil	MLTGLLLREKGKTKTLIMMLIVSSLLLIGGILILVK*
Ga0070672_1003315452	3300005543	Miscanthus Rhizosphere	MLTGILLKKKGKTKTLTIMLIVSALLLIGGILMLVK*
Ga0070672_1009773352	3300005543	Miscanthus Rhizosphere	MLTGLLLRKKGKTKTLVALVIVSSLLLIGGILMLVK*
Ga0070672_1019983232	3300005543	Miscanthus Rhizosphere	MLTGLLLRKKGKTKTRIILFIGSLLLLIGGILMLLQ*
Ga0068857_1000688792	3300005577	Corn Rhizosphere	MLTGLLLRSKGKTKTLITLLIVSSLLLVTGILILVK*
Ga0068859_1004766092	3300005617	Switchgrass Rhizosphere	MLTGILLRKKGKTKTLTIMMIVSALLLIGGILMLIK*
Ga0068859_1004891342	3300005617	Switchgrass Rhizosphere	MLTGLLLRKKGKIKTLITLFIVSSLLLIGGILMLIK*
Ga0068859_1005162782	3300005617	Switchgrass Rhizosphere	MLTGLLLKKKEKNKTLILLSIAFALLLIGGILLLVK*
Ga0068864_1000726743	3300005618	Switchgrass Rhizosphere	MLTGIFLKKKGKTKTLTIMLIVSALLLIGGILMLVK*
Ga0068864_1001210502	3300005618	Switchgrass Rhizosphere	MLTGILLRKKGKDKALFIMLIASSLLLLIGGILILVK*
Ga0068863_1005760262	3300005841	Switchgrass Rhizosphere	MLTGLLLRKKGKTKTLIMLVIVSSLLLIGGILMLVK*
Ga0066652_1000198465	3300006046	Soil	MLTGILLRKKGKKKILILFLIAFALLLIAGIIILIK*
Ga0066652_1020010802	3300006046	Soil	MLTGILLRKKGKTKTLAIMLIVSALLLIGGILMLVK*
Ga0097621_1008935902	3300006237	Miscanthus Rhizosphere	MLTGLLLRKKGKTKTLVALVIVSSLLLIGGILTLVK*
Ga0075428_1000672333	3300006844	Populus Rhizosphere	MLTGLLLRQKGKTKTLIIMLIVSSLLLIGGILMLVK*
Ga0075420_1017789262	3300006853	Populus Rhizosphere	MLTGILLREKRKTKTLIIMLIASSLLLIGGILMLVK*
Ga0075434_1025410622	3300006871	Populus Rhizosphere	MLTGLLLRRKGKNKTLTTMLIVSALLLMGGILMLVR*
Ga0079215_115761192	3300006894	Agricultural Soil	MLTGILLRKKGKTKTLTTMLIVSALLLIGGILMLVK*
Ga0111539_105306873	3300009094	Populus Rhizosphere	MLTGLLLRKRGKTKTLITLFIVSSLLLIGGILMLVK*
Ga0111539_106203872	3300009094	Populus Rhizosphere	MLTGILLRKKGKTKTLTIMLIVSALLLIGGILMLIK*
Ga0075418_105612432	3300009100	Populus Rhizosphere	MLTGILLREKRKTKTLIIMLIASSLLLIGGILILVK*
Ga0111538_105734642	3300009156	Populus Rhizosphere	MLTGILLRKKGKTKTLIIMLIASSLLLIGGILILAK*
Ga0111538_127490222	3300009156	Populus Rhizosphere	MLTGILLRKNGKNRTVIILLIASGLLLIGGILMLVK*
Ga0111538_135234802	3300009156	Populus Rhizosphere	MLTGLLLRKKGKTKTLIMMLIVSSLLLIGGILMLVK*
Ga0105241_113600882	3300009174	Corn Rhizosphere	MLTGILLSKKGKTKTLTIILIISALLLIGGILMLVE*
Ga0105249_100548773	3300009553	Switchgrass Rhizosphere	MLTGLLLRKKGKIKTLIILFMVSVLLLIGGVLIIIK*
Ga0105249_112859692	3300009553	Switchgrass Rhizosphere	MLTGLLLKKKEKNKTLILLSIAFALSLIGGILLLVK*
Ga0105347_14208262	3300009609	Soil	MLTGILLRKKGKTKTLTTMLIVSALLLIGGILMLLK*
Ga0105340_13655042	3300009610	Soil	MLTGILLRKKGKTKTLIIMLIASSLLLIGGILILVK*
Ga0126305_100459502	3300010036	Serpentine Soil	MLTGLLLRKRGKTKTLVILFIVSSLLLIGGILMLLK*
Ga0126304_102270002	3300010037	Serpentine Soil	MLTGILLRKKGKTKTLTIILLVSALLLIGGILMLVK*
Ga0134124_104154002	3300010397	Terrestrial Soil	MLTGLLLRKKGKTKTLVALVIVSTLLLFGGILMLVK*
Ga0134123_123329592	3300010403	Terrestrial Soil	MLTGLLLRRKGKNKTLTIMLIVSALLLIAGILMLVK*
Ga0137476_1050462	3300011241	Glacier Forefield Soil	MLTGLLLRKKGKTKTLVVLFVVSIMLLVGGILILIK*
Ga0137425_10616612	3300011422	Soil	MLTGILLRKAGKTKTLIIMLIASSLFLIGGILILVK*
Ga0137423_12387972	3300011430	Soil	MLTGILLRKAGKTKTLIIMLIASSLLLIGGILMLLK*
Ga0157304_10903661	3300012882	Soil	TGLLLRRKGKNKTLTIMLIVSALLLIGGILMLVK*
Ga0157281_10661262	3300012883	Soil	MLTGLLLRNKGKTKTLITLLIVSSLLLVTGILILVK*
Ga0157287_10660082	3300012885	Soil	MLTGILLRKKGKNRTVIILLIASGLLLIGGILMLVK*
Ga0157305_100037434	3300012891	Soil	MLTGLLLRKKGKIKTLITMLIASSLLLIGGILMLLK*
Ga0157305_100461092	3300012891	Soil	MLTGILLRKAGKTKTLIILFIVSSLLLVGGILMLVK*
Ga0157294_100642502	3300012892	Soil	MLTGILLRKKGKYKTITVLVIIFSLLLIGGILMLVK*
Ga0157284_101772932	3300012893	Soil	MLTGILLRKKGKTKTLTIMLIVSALLLIGGILMLVK*
Ga0157303_100718192	3300012896	Soil	NLKFKTMLTGILLRKKGKTKTLTIMLIVSALLLIGGILMLIK*
Ga0157293_101530172	3300012898	Soil	MLTGLLLRKKGKTKTLIVFLIVSLLLLIGGILMLVK*
Ga0157293_101844802	3300012898	Soil	MLTGILLRKKGKNRPVIILLIASGLLLIGGILMLVK*
Ga0157299_101009492	3300012899	Soil	MLTGLLLRKKGKTKTLIMMLIVSSLLLIGGILMLIK*
Ga0157292_102835842	3300012900	Soil	MLTGLLLRKKGKTKTLVMLFIVSSLLLIGGILMLLQ*
Ga0157282_101053772	3300012904	Soil	MLTGLLLRRKGKNKTLTIMLIVSALLLIGGILMLVK*
Ga0157283_101257092	3300012907	Soil	MLTGLLLRKKGKIKTLITLFIVSSLLLIGGILMLI
Ga0164308_112977622	3300012985	Soil	MLTGILLSKKGKTKTLTIILIISALLIIGGILMLVE*
Ga0163162_103452092	3300013306	Switchgrass Rhizosphere	MLTGLLLRKKGKTKTLVALVIVSTLLLIGGILMLVK*
Ga0157380_112648232	3300014326	Switchgrass Rhizosphere	MLTGLLLRRKGKNKTLTIMLMVSALLLIGGILMLVK*
Ga0173480_105517402	3300015200	Soil	MLTGLLLRRKGKNKTLTIMLIVSALLLIGGILMLIK*
Ga0173478_100251222	3300015201	Soil	MLTGILLRKAGKTKTLIIMLVASSLLLIGGILMLLK*
Ga0132258_125344332	3300015371	Arabidopsis Rhizosphere	MLTGLLLKKKGKNKTLIILSIAFALLLIGGILILAK*
Ga0132258_127783932	3300015371	Arabidopsis Rhizosphere	MLTGLLLRKKGKTKTLIILFVVSSLLLIGGILMLVK*
Ga0132257_1024906032	3300015373	Arabidopsis Rhizosphere	MLTGLLVRKKGKTKTLIIMLIVSSLLLIGGILMLVK*
Ga0163161_103686192	3300017792	Switchgrass Rhizosphere	MLTGIFLKKKGKTKTLAIMLIVSALLLIGGILMLVK
Ga0184611_10006276	3300018067	Groundwater Sediment	MLTGILLRKKGKTKTLIIMLIASSLLLIGGILILAK
Ga0184611_10672502	3300018067	Groundwater Sediment	MLTGLLLRKKGKTKTLIMMLIVSSLLLIGGILMLVK
Ga0184611_11255072	3300018067	Groundwater Sediment	MLTGLLLRRKGKNKTLIIMLMVSALLLIGGILMLVK
Ga0184635_100001653	3300018072	Groundwater Sediment	MLTGILLRKKGKTKTLIIMLIASSLLLIGGILILVK
Ga0184624_100356712	3300018073	Groundwater Sediment	MLTGILLKKKGKTKTLTIMLIVSALLLIGGILMLVK
Ga0184628_102986922	3300018083	Groundwater Sediment	MLTGILLRKKGKIKTLTLMLIVSAILLIGGILMLVK
Ga0184629_102260392	3300018084	Groundwater Sediment	MLTGILLKKKGKTKTLTTMLIVSALLLIGGILMLLK
Ga0190270_106768892	3300018469	Soil	MLTGILLREKGKTKTQTMMLIVSALLLIGGILMLVR
Ga0190270_119538732	3300018469	Soil	MLTGILLRKKRKTKTLTIMLVVSALLLIGGILMLVK
Ga0190274_1000081417	3300018476	Soil	MLTGILLRKKGKTKTLAIMLIVSALLLIGGILMLVK
Ga0190274_105522652	3300018476	Soil	MLTGILLRKKGKNKTLTIMVIVAALILIGGILMLVK
Ga0190274_107939211	3300018476	Soil	LTGILLRKKGKNKTVIILLIASSLLLIGGILMLVK
Ga0190274_109201272	3300018476	Soil	MLTGLLLRKKGKIKTLITLFIVSSLLLIGGILMLIK
Ga0190271_100207398	3300018481	Soil	MLTGILLRKKGKTKTLTTMLIVSALLLIGGILMLVK
Ga0190271_124617102	3300018481	Soil	MLTGILLRKKGKTKTLTLMLIVSALLLIGGILMLAK
Ga0173482_101697752	3300019361	Soil	MLTGILLRKKGKTKTLTIMLIVSALLLIGGILMLIK
Ga0173482_101798372	3300019361	Soil	LKFKTMLTGLLLRKKGKTKTLIIMLIVSSLLLIGGILMLVQ
Ga0173482_104150432	3300019361	Soil	MLTGLLLRKKGKTKTLIMLVIVSSLLLIGGILMLVK
Ga0173482_104912892	3300019361	Soil	MLTGLLLRNKGKTKTLITLLIVSSLLLVTGILILVK
Ga0173479_100165852	3300019362	Soil	MLTGILLRKKGKTKTLTIMLIVSALLLIGGILMLVK
Ga0173479_105195012	3300019362	Soil	MLTGILLRKKGKNRTVIILLIASGLLLIGGILMLVK
Ga0173479_105547032	3300019362	Soil	MLTGLLLRNKGKTTTLITLLIVSSLLLVTGISILVK
Ga0193741_10411622	3300019884	Soil	MLTGILLRKAGKTKTLIIMLIASSLLLIGGILMLLK
Ga0193693_10709842	3300019996	Soil	MLTGILLSKKGETKTLTIMLIVSALLLVGGILMLLK
Ga0193692_10120404	3300020000	Soil	MLTGILLSKKGKTKTLTIMLIVSALLLVGGILMLLK
Ga0193740_100042613	3300020009	Soil	MLTGILLRKKGKTKTLTIMLIVSALLLIGGILMLLK
Ga0193740_10316642	3300020009	Soil	MLTGILLREKGKTKTLTIMLIVSALLLIGGILMLVK
Ga0193721_10734592	3300020018	Soil	MLTGILLRAKGKTKTRIVLFIGFSLLLIAGILILIK
Ga0193738_100012713	3300020020	Soil	MLTGILLRKKGKTKTLIIMFIVSALILVGGILLLVK
Ga0193738_100018633	3300020020	Soil	MLTGILLRKKGKTKTLTIMFIVSAFLLIGGILMLVK
Ga0193738_10064595	3300020020	Soil	MLTGLLLRKKGKNKTLTILVIVSIILLAGGILILVK
Ga0247792_10108012	3300022880	Soil	MLTGLLLRKKGKTKTLVMLFIVSSLLLIGGILMLLQ
Ga0247787_10708532	3300022893	Soil	MLTGILLRKKGKTKTLAIMLIVSALLLIGGILMLIK
Ga0247795_10047614	3300022899	Soil	MLTGLLLRKKGKTKTLIIMLIVSSLLLIGGILMLVQ
Ga0247795_10095722	3300022899	Soil	MLTGLLLKKKEKNKTLILLSIAFALLLIGGILLLVK
Ga0247774_11445191	3300022903	Plant Litter	MLTGLLLRRKGKNKTLTIMLIVSALLLIGGILMLVK
Ga0247748_10090482	3300023168	Soil	MLTGILLRKAGKTKTLIIMLVASSLLLIGGILMLLK
Ga0207682_100348921	3300025893	Miscanthus Rhizosphere	MLTGLLLRRKGKNKTLTIMLMVSALLLIGGILMLVK
Ga0207662_103140892	3300025918	Switchgrass Rhizosphere	MLTGILLRKKGKTKTLTIMMIVSALLLIGGILMLIK
Ga0207681_108869182	3300025923	Switchgrass Rhizosphere	MLTGLLLRKKGKTKTLVALVIVSSLLLIGGILMLVK
Ga0207689_102816263	3300025942	Miscanthus Rhizosphere	KFKTMLTGILLKKKGKTKTLTIMLIVSALLLIGGILMLVK
Ga0207651_101297633	3300025960	Switchgrass Rhizosphere	MLTGILLRKKGKTKTLIIILIVSALLLIGGILMLVK
Ga0207712_100142843	3300025961	Switchgrass Rhizosphere	MLTGLLLRKKGKIKTLIILFMVSVLLLIGGVLIIIK
Ga0207639_107604881	3300026041	Corn Rhizosphere	MLTGILLKKKGKTKTLIIILIVSVILLIGGILMLLK
Ga0207648_106101602	3300026089	Miscanthus Rhizosphere	MLTGLLLRKKGKTKTLVALVIVSTLLLFGGILMLVK
Ga0207676_100093252	3300026095	Switchgrass Rhizosphere	MLTGILLRKKGKDKALFIMLIASSLLLLIGGILILVK
Ga0207676_103746162	3300026095	Switchgrass Rhizosphere	MLTGIFLKKKGKTKTLTIMLIVSALLLIGGILMLVK
Ga0207674_100680642	3300026116	Corn Rhizosphere	MLTGLLLRSKGKTKTLITLLIVSSLLLVTGILILVK
Ga0208685_11004402	3300027513	Soil	MLTGILLRKKGKTKTLTTMLIVSALLLIGGILMLLK
Ga0209966_11184902	3300027695	Arabidopsis Thaliana Rhizosphere	MLTGLLLRKKGKIKTLITMLIASSLLLIGGILMLLK
Ga0209464_100467992	3300027778	Wetland Sediment	MLTGLLLRKKGKYKTLAILLIVSVILLIGGILILIK
Ga0209797_103167241	3300027831	Wetland Sediment	MLTGLLLRKKGKTKTLAIFLIISVILLAGGILILVK
Ga0207428_102493892	3300027907	Populus Rhizosphere	MLTGLLLRRKGKNKTLTTMLIVSALLLMGGILMLVR
Ga0207428_107606132	3300027907	Populus Rhizosphere	MLTGLLLRERGKTKTLITLFIVSSLLLIGGILMLVK
Ga0247749_10440412	3300027993	Soil	MLTGILLRKKGKYKTITVLVIIFSLLLIGGILMLVK
Ga0307497_105410722	3300031226	Soil	MLTGLLLRKKGKTKTLVMMVIVSSLLLIGGILMLVK
Ga0310888_103032522	3300031538	Soil	MLTGILLRKKGKTKTLATMLIISALLLIGGILMLVK
Ga0310888_107515782	3300031538	Soil	MLTGILLRKKGKAKTLTIMVIVSALLLIGGILMLIK
Ga0310888_107845052	3300031538	Soil	MLTGILLRKNAKTKTLIVLFVVSSLLLIGGILISLK
Ga0310888_110001042	3300031538	Soil	MLTGILLRKKGKTKTFIVLFIVSSLFLIGGILILLK
Ga0310886_100767963	3300031562	Soil	MLTGILLRKKGKAKTLTIMVIVSALLLIGGILMLI
Ga0310892_111492431	3300031858	Soil	MLTGILLRKKGKAKTLTIMVIVSALLLIGGVLMLIK
Ga0310885_102297562	3300031943	Soil	MLTGILLRKKGKAKTLTMMVIVSALLLIGGVLMLIK
Ga0310884_107897822	3300031944	Soil	MLTGVLLRKKGKTKTLTIMLVVSALLLIGGILMLVK
Ga0315910_1000030242	3300032144	Soil	MLTGMLLRKKGEIKILTAVLIASSLLLIGGILILIK
Ga0315912_101113403	3300032157	Soil	MLTGLLLRKKGKTNTLIIMLIASSLLLIGGILMLVK

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign