NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061134

Metagenome / Metatranscriptome Family F061134

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061134
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 44 residues
Representative Sequence PGNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM
Number of Associated Samples 116
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.48 %
% of genes from short scaffolds (< 2000 bps) 96.97 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.394 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(9.091 % of family members)
Environment Ontology (ENVO) Unclassified
(36.364 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.909 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.35%    β-sheet: 24.64%    Coil/Unstructured: 71.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF14579HHH_6 11.36
PF01336tRNA_anti-codon 10.61
PF02566OsmC 2.27
PF02736Myosin_N 0.76
PF12146Hydrolase_4 0.76
PF00528BPD_transp_1 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 2.27
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 2.27


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.39 %
UnclassifiedrootN/A35.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908040|B4_c_ConsensusfromContig129954Not Available873Open in IMG/M
2170459014|G1P06HT01ARGEXAll Organisms → cellular organisms → Bacteria → Proteobacteria614Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100797167Not Available964Open in IMG/M
3300000443|F12B_10600611All Organisms → cellular organisms → Bacteria → Proteobacteria772Open in IMG/M
3300000787|JGI11643J11755_11659834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium542Open in IMG/M
3300000891|JGI10214J12806_10675298Not Available762Open in IMG/M
3300004479|Ga0062595_100386678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium995Open in IMG/M
3300004479|Ga0062595_100770879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium786Open in IMG/M
3300005205|Ga0068999_10140312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069507Open in IMG/M
3300005332|Ga0066388_102767501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069896Open in IMG/M
3300005334|Ga0068869_100261465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1385Open in IMG/M
3300005337|Ga0070682_100407788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1030Open in IMG/M
3300005339|Ga0070660_101896834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium508Open in IMG/M
3300005364|Ga0070673_102288574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium514Open in IMG/M
3300005434|Ga0070709_10244644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1289Open in IMG/M
3300005434|Ga0070709_10930645All Organisms → cellular organisms → Bacteria → Proteobacteria689Open in IMG/M
3300005454|Ga0066687_10595766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium656Open in IMG/M
3300005458|Ga0070681_11362519Not Available633Open in IMG/M
3300005459|Ga0068867_101061536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria737Open in IMG/M
3300005544|Ga0070686_101299085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium608Open in IMG/M
3300005563|Ga0068855_101649747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium655Open in IMG/M
3300005563|Ga0068855_101692817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii645Open in IMG/M
3300005564|Ga0070664_100366003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1314Open in IMG/M
3300005564|Ga0070664_102255815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium516Open in IMG/M
3300005614|Ga0068856_101799877Not Available624Open in IMG/M
3300005617|Ga0068859_100457319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1372Open in IMG/M
3300005618|Ga0068864_102445582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium528Open in IMG/M
3300006086|Ga0075019_10831160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium590Open in IMG/M
3300006175|Ga0070712_100243072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1435Open in IMG/M
3300006354|Ga0075021_11169285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium505Open in IMG/M
3300006575|Ga0074053_10018351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1906Open in IMG/M
3300006578|Ga0074059_11621755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales715Open in IMG/M
3300006755|Ga0079222_12622677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300006797|Ga0066659_10480133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.993Open in IMG/M
3300006852|Ga0075433_10594553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria972Open in IMG/M
3300006903|Ga0075426_10361580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1068Open in IMG/M
3300006914|Ga0075436_100240405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1288Open in IMG/M
3300009011|Ga0105251_10134615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1119Open in IMG/M
3300009029|Ga0066793_10400104Not Available789Open in IMG/M
3300009101|Ga0105247_10368024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1016Open in IMG/M
3300009168|Ga0105104_10795614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria549Open in IMG/M
3300009545|Ga0105237_10311329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1578Open in IMG/M
3300009649|Ga0105855_1221031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300009839|Ga0116223_10573066Not Available653Open in IMG/M
3300010043|Ga0126380_11958772Not Available535Open in IMG/M
3300010358|Ga0126370_10104155All Organisms → cellular organisms → Bacteria → Proteobacteria1970Open in IMG/M
3300010358|Ga0126370_11937565Not Available574Open in IMG/M
3300010359|Ga0126376_10923235Not Available865Open in IMG/M
3300010359|Ga0126376_12232925Not Available592Open in IMG/M
3300010366|Ga0126379_10293570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1627Open in IMG/M
3300010371|Ga0134125_11014608Not Available910Open in IMG/M
3300010371|Ga0134125_11940951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47640Open in IMG/M
3300010375|Ga0105239_13291316All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300010379|Ga0136449_103266753Not Available624Open in IMG/M
3300011119|Ga0105246_11411158Not Available650Open in IMG/M
3300011414|Ga0137442_1113971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M
3300012362|Ga0137361_11769769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria536Open in IMG/M
3300012476|Ga0157344_1027316Not Available529Open in IMG/M
3300012912|Ga0157306_10062445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium974Open in IMG/M
3300012960|Ga0164301_11465923Not Available561Open in IMG/M
3300012984|Ga0164309_10498914Not Available931Open in IMG/M
3300012984|Ga0164309_10647344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria832Open in IMG/M
3300012984|Ga0164309_11896857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300012985|Ga0164308_11784913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria573Open in IMG/M
3300012987|Ga0164307_11309832Not Available606Open in IMG/M
3300012987|Ga0164307_11472238All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300013100|Ga0157373_10894798Not Available658Open in IMG/M
3300013297|Ga0157378_10522215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1189Open in IMG/M
3300013307|Ga0157372_10556066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1338Open in IMG/M
3300013307|Ga0157372_13218571All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300014325|Ga0163163_10475114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1311Open in IMG/M
3300014326|Ga0157380_11551436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47717Open in IMG/M
3300014968|Ga0157379_11328269Not Available695Open in IMG/M
3300014968|Ga0157379_12293579Not Available537Open in IMG/M
3300015171|Ga0167648_1009596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2420Open in IMG/M
3300015245|Ga0137409_11274320All Organisms → cellular organisms → Bacteria → Proteobacteria577Open in IMG/M
3300015372|Ga0132256_101116534Not Available903Open in IMG/M
3300015372|Ga0132256_103455006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria531Open in IMG/M
3300016422|Ga0182039_11652206Not Available585Open in IMG/M
3300016445|Ga0182038_10000924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales15287Open in IMG/M
3300017930|Ga0187825_10112554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria947Open in IMG/M
3300017947|Ga0187785_10528609All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300018029|Ga0187787_10208051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales695Open in IMG/M
3300018060|Ga0187765_11032932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria566Open in IMG/M
3300018083|Ga0184628_10356638Not Available767Open in IMG/M
3300018089|Ga0187774_10455099Not Available794Open in IMG/M
3300020069|Ga0197907_10849734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300021560|Ga0126371_10991098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales982Open in IMG/M
3300025315|Ga0207697_10078047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1393Open in IMG/M
3300025475|Ga0208478_1044849Not Available845Open in IMG/M
3300025735|Ga0207713_1215159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300025852|Ga0209124_10231188Not Available719Open in IMG/M
3300025891|Ga0209585_10463250Not Available524Open in IMG/M
3300025906|Ga0207699_10272321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1174Open in IMG/M
3300025912|Ga0207707_11048312Not Available667Open in IMG/M
3300025912|Ga0207707_11216386Not Available609Open in IMG/M
3300025919|Ga0207657_11500890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47504Open in IMG/M
3300025925|Ga0207650_10732354Not Available836Open in IMG/M
3300025928|Ga0207700_11319856Not Available643Open in IMG/M
3300025936|Ga0207670_10194202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1538Open in IMG/M
3300025949|Ga0207667_10221892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1936Open in IMG/M
3300025949|Ga0207667_10322098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1579Open in IMG/M
3300026041|Ga0207639_10461861Not Available1154Open in IMG/M
3300026067|Ga0207678_11159918Not Available684Open in IMG/M
3300026116|Ga0207674_11311792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria693Open in IMG/M
3300026745|Ga0207576_100199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1646Open in IMG/M
3300026809|Ga0207820_105192Not Available1117Open in IMG/M
3300026849|Ga0207804_115086Not Available700Open in IMG/M
3300026942|Ga0207783_1013004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria829Open in IMG/M
3300027330|Ga0207777_1037895Not Available872Open in IMG/M
3300027765|Ga0209073_10335880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria606Open in IMG/M
3300027876|Ga0209974_10030607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1784Open in IMG/M
3300027902|Ga0209048_10561653Not Available764Open in IMG/M
3300028793|Ga0307299_10225417Not Available704Open in IMG/M
3300031226|Ga0307497_10014497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 812314Open in IMG/M
3300031232|Ga0302323_103333346Not Available511Open in IMG/M
3300031247|Ga0265340_10424928All Organisms → cellular organisms → Bacteria → Proteobacteria586Open in IMG/M
(restricted) 3300031248|Ga0255312_1135710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300031421|Ga0308194_10102505All Organisms → cellular organisms → Bacteria → Proteobacteria825Open in IMG/M
3300031446|Ga0170820_17369665Not Available830Open in IMG/M
3300031474|Ga0170818_111637522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1148Open in IMG/M
3300031668|Ga0318542_10409534Not Available701Open in IMG/M
3300031746|Ga0315293_10806858Not Available687Open in IMG/M
3300031938|Ga0308175_101132585Not Available868Open in IMG/M
3300032211|Ga0310896_10229241Not Available929Open in IMG/M
3300032892|Ga0335081_10774244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471151Open in IMG/M
3300033475|Ga0310811_10327404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1739Open in IMG/M
3300033489|Ga0299912_10311977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1315Open in IMG/M
3300033809|Ga0314871_007007Not Available767Open in IMG/M
3300034125|Ga0370484_0086267Not Available810Open in IMG/M
3300034125|Ga0370484_0238615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300034818|Ga0373950_0000978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3619Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.09%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.30%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.79%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.03%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.27%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.27%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.52%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.52%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.52%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.52%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.76%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.76%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.76%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.76%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.76%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.76%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.76%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.76%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.76%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.76%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.76%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.76%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.76%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908040Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4EnvironmentalOpen in IMG/M
2170459014Litter degradation PV2EngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005205Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009649Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011414Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2EnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015171Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025475Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300025891Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026745Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08K1-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026809Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes)EnvironmentalOpen in IMG/M
3300026849Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes)EnvironmentalOpen in IMG/M
3300026942Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63 (SPAdes)EnvironmentalOpen in IMG/M
3300027330Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033809Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_DEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B4_c_052529302124908040SoilXXLXAGTPIIIMASEKQAXXSVLAXTXYXGRXXPPXM
2PV_029803102170459014Switchgrass, Maize And Mischanthus LitterMIAAAAPGKKDELKAGAQIIISVGQAAGWIDTGQAMYVGRSVAPAM
INPhiseqgaiiFebDRAFT_10079716713300000364SoilNKEELKPGAQIIIMASDKQPDGSVLAKTLYIGRNLTPAM*
F12B_1060061133300000443SoilGNKEELKPGAQIIIMASDKQSDGSVLAKTLYIGRSLTPAM*
JGI11643J11755_1165983423300000787SoilITAVAPGNKEELKPGAQIIIMASDKQSDGSVLAKTLYIGRSLTPAM*
JGI10214J12806_1067529823300000891SoilIKAGTPIIIFGWDKQPDGSVLAKSLYIGRSVTPAM*
Ga0062595_10038667833300004479SoilVTPQTIIAAAAPAKKEEIKAGTPMIIFGWDKQPDGSVLAKTLYIGRNVTPAM*
Ga0062595_10077087923300004479SoilTIAAAAPGNKDELKSGAQIIIFGWDKQPDGSILAKTLYVGRSVTPAM*
Ga0068999_1014031213300005205Natural And Restored WetlandsAPGNKSELKPGTPIIIFASEKQPDGSVLAKTMYIGRDVTPAM*
Ga0066388_10276750113300005332Tropical Forest SoilAITAVAPGNKDELMPGAQIIIMASDKQADGSVLAKTLYIGRSLTPAM*
Ga0068869_10026146523300005334Miscanthus RhizospherePGNKDELKTGAQIIIFGWDKQADGSILAKSLYIGRSVTPAM*
Ga0070682_10040778813300005337Corn RhizosphereAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM*
Ga0070660_10189683413300005339Corn RhizosphereRAAPGSKDELKAGAQIIIFASAKEGDTTVAKVLYVGRGVTPAM*
Ga0070673_10228857423300005364Switchgrass RhizosphereAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYIGRNVTPAM*
Ga0070709_1024464413300005434Corn, Switchgrass And Miscanthus RhizosphereAITAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM*
Ga0070709_1093064523300005434Corn, Switchgrass And Miscanthus RhizosphereGNKDELKAGTQIIIMASEKQPDGSALAKVLYVGRGLTPAM*
Ga0066687_1059576623300005454SoilAVAPVNKDELKAGAQIIIFASDKQPDGSVLVKSMYVGRGVTPAM*
Ga0070681_1136251923300005458Corn RhizosphereAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYIGRSVTPAM*
Ga0068867_10106153613300005459Miscanthus RhizosphereKVIVTPQTIIAAAAPAKKEEIKAGTPMIIFGWDKQPDGSVLAKSLYVGRSVTPAM*
Ga0070686_10129908523300005544Switchgrass RhizosphereNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM*
Ga0068855_10164974723300005563Corn RhizosphereDASELKPGAQVIIFGWDKQADGSILAKTMYVGRGLTPAM*
Ga0068855_10169281713300005563Corn RhizosphereVIAAVAKGDKKELKKGAHILIFQSEKQAGGSLLAKVLYVGRDVVPAM*
Ga0070664_10036600313300005564Corn RhizosphereGKKDELKAGAQIIIFGWDKQPDGSILAKTMYVGRSVAPAM*
Ga0070664_10225581513300005564Corn RhizosphereTAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM*
Ga0068856_10179987713300005614Corn RhizosphereKAGAQIIIFGWDKQPDGSILAKTLYVGRGLTPAM*
Ga0068859_10045731923300005617Switchgrass RhizosphereAAPGKKDELKAGLQIIIFGWDKQPDGSILAKTMYVGRSVAPAM*
Ga0068864_10244558213300005618Switchgrass RhizosphereAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM*
Ga0075019_1083116013300006086WatershedsVVTKDTVIAAAAAGNKDELKAGAQIIIFGWDKQADGSVLAKVMYVGRGLTPAM*
Ga0070712_10024307213300006175Corn, Switchgrass And Miscanthus RhizosphereAPGKKEELKPGAQIIIFGWDKQADGTVLAKTLYVGRAGPPAM*
Ga0075021_1116928523300006354WatershedsAAAAPAKKEELKPGAQIIIFVWDKQPDGSVLAKVLYVGRNVTPAM*
Ga0074053_1001835123300006575SoilIAAAAPGKKDELKAGAQIIIFGWDKQPDGSILAKTMYVGRSVAPAM*
Ga0074059_1162175513300006578SoilKVIVTPQTIIAAAAPGKKEEIKAGTPIIIFGWDKQPDGSILAKTMYVGRSVAPAM*
Ga0079222_1262267713300006755Agricultural SoilDAVIQAVAPGNKDELKAGAQIIIMQSEKQADGSYLAKNVYVGRGLTPAM*
Ga0066659_1048013313300006797SoilKPGAQIIIMASEKQADGSILAKNMYVGRGVTPAM*
Ga0075433_1059455313300006852Populus RhizosphereVTPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM*
Ga0075426_1036158033300006903Populus RhizosphereELKAGAQIIIMASEKQADGSVLAKTLYVGRGLTPAM*
Ga0075436_10024040513300006914Populus RhizosphereAAKGDKSELKPGVQIIIFGWEKLPDGAVLAKTLYVGRGLTPAM*
Ga0105251_1013461523300009011Switchgrass RhizosphereDELKAGAQIIIFGWDKQPDGSILAKTMYVGRSVAPAM*
Ga0066793_1040010413300009029Prmafrost SoilSKDELKPGAQIIIFGWDKQSDGSVLAKVMYVGRNVTPAM*
Ga0105247_1036802413300009101Switchgrass RhizosphereQTVIAAAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM*
Ga0105104_1079561423300009168Freshwater SedimentGNKDELKPGEQIIIMASDKQADGSVLAKTLYIGRSLTPAM*
Ga0105237_1031132913300009545Corn RhizosphereKPGTQIIIMAADKQPDGSVLVKTLYVGRSLTPAM*
Ga0105855_122103123300009649Permafrost SoilVIAAVAPGNKDDLKPGTQIIIMASDKQPDGSVLAKTLYVGRSLTPAM*
Ga0116223_1057306613300009839Peatlands SoilAAAPGSKDELKAGTQIIIFGWDKQPDGSVLAKVMYIGRNVTPAM*
Ga0126380_1195877223300010043Tropical Forest SoilDKAELKVGAQIIIMQSEKQPDGSVLGKNLYIGRGVTPAM*
Ga0126370_1010415513300010358Tropical Forest SoilQAVAPGNKDELKAGAQIIIMQSEKQADGSFLAKNVYVGRGLTPAM*
Ga0126370_1193756513300010358Tropical Forest SoilELKAGAQIIIFGWDKQADGSVLAKTLYVGRAGPPAM*
Ga0126376_1092323513300010359Tropical Forest SoilKKEEIKAGTPIILFGWDKQPDGSVLAKTLYIGRSVAPAM*
Ga0126376_1223292513300010359Tropical Forest SoilELKPGTQVIIMASDKQPDGSVLAKTLYIGRGLTPAM*
Ga0126379_1029357033300010366Tropical Forest SoilPGNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM*
Ga0134125_1101460833300010371Terrestrial SoilIKAGTPIIIFGWDKQPDGSVLAKSLYIGRSVPPAM*
Ga0134125_1194095113300010371Terrestrial SoilKTGAQIIIFGWDKQADGSILAKSLYIGRSVTPAM*
Ga0105239_1329131623300010375Corn RhizosphereVTPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQADGWVLAKTLYIGRNVAPAM*
Ga0136449_10326675323300010379Peatlands SoilLVAGTPIIIMASEKQTDGSVLAKVLYVGRAGPPAM*
Ga0105246_1141115813300011119Miscanthus RhizosphereLKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM*
Ga0137442_111397113300011414SoilLKAGTQIIIFGWDKQSDGSVLAKVMYVGRNVTPAM*
Ga0137361_1176976913300012362Vadose Zone SoilSKDELKPGAQIIIMASEKQADGSILAKNMYVGRGVTPAM*
Ga0157344_102731613300012476Arabidopsis RhizosphereAPANKDELKPGTQIIIMAADKQPDGSVLAKTLYVGRSLTPAM*
Ga0157306_1006244523300012912SoilKVIVTPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM*
Ga0164301_1146592313300012960SoilVVAVSIKDELKPGTQIIIMAADKQPDGSVLAKTLYVGRSLTPAM*
Ga0164309_1049891423300012984SoilQTVIAAAAPGKKEELKPGAQIIIFGWDKQADGTVLAKTLYVGRAGPPAM*
Ga0164309_1064734413300012984SoilDKSELKPGVQIIIFGWEKLPDGVVLAKTLYVGRGLTPAM*
Ga0164309_1189685723300012984SoilVTPQTAIARAAPGSKDELKAGAQIIIFASAKEGDTTVAKVLYVGRGVTPAM*
Ga0164308_1178491313300012985SoilAIAAAAKGDKSELKPGVQIIIFGWEKLPDGAVLAKTLYVGRGLTPAM*
Ga0164307_1130983213300012987SoilAPGNKDELKSGAQIIIFGWDKQPDGSILAKTLYVGRSVTPAM*
Ga0164307_1147223823300012987SoilPQTAIARAAPGSKDELKAGAQIIIFASAKEGDTTVAKVLYVGRGVTPAM*
Ga0157373_1089479823300013100Corn RhizosphereAAKGDASELKAGAQIIIFGWDKQADGSVLAKTMYVGRGVTPAM*
Ga0157378_1052221513300013297Miscanthus RhizosphereTAITAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYVGRSLTPAM*
Ga0157372_1055606613300013307Corn RhizosphereQGRREEGCGHAQTMIAAAAPGKKDELKAGAQIIIFGWDKQPDGSILAKTMYVGRSVAPAM
Ga0157372_1321857123300013307Corn RhizosphereAITAVAPANKDELKPGTQIIIMAADKQSDGSVLAKTLYVGRSLTPAM*
Ga0163163_1047511433300014325Switchgrass RhizosphereATAITAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM*
Ga0157380_1155143613300014326Switchgrass RhizosphereAAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM*
Ga0157379_1132826913300014968Switchgrass RhizosphereAPAKKEEIKAGTPIIIFGWDKQADGSVLAKTLYIGRNVAPAM*
Ga0157379_1229357913300014968Switchgrass RhizosphereTAITAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM*
Ga0167648_100959633300015171Glacier Forefield SoilLVPGAQIIIMGSEKAPDGSVLAKSMYVGRALTPAM*
Ga0137409_1127432013300015245Vadose Zone SoilNKDELKAGTPIIIMQSDKQADGSVLAKNVYVGRGAAPAM*
Ga0132256_10111653423300015372Arabidopsis RhizosphereVAPGNRDELKPGTQVIIMASDKQPDGSVLAKTLYVGRNLTPAM*
Ga0132256_10345500613300015372Arabidopsis RhizosphereEIKAGTPMIIFGWDKQPDGSVLAKTLYIGRNVTPAM*
Ga0182039_1165220613300016422SoilIAVTPQTVIAAAAPSEKEDLKAGTQVIIFAWDKQSDGSVLAKSIYVGRDVAPAM
Ga0182038_1000092413300016445SoilPGNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM
Ga0187825_1011255413300017930Freshwater SedimentELKTGVQIIIFGWDKQPDGSVLAKTMYVGRNLTPAM
Ga0187785_1052860923300017947Tropical PeatlandIAAVAPASKDEIKAGSQIIIFASEKQPDGSILAKTMYVGRDVTPAM
Ga0187787_1020805113300018029Tropical PeatlandKKILVTPQTVIAAAAPATKDEIKAGTQLIIFGWDKDGDGSVLAKVMYLGRNVTPAM
Ga0187765_1103293223300018060Tropical PeatlandIVTPQTMIAAAAPAKKEELKPGVQIIIFGWDKQPDGSVLAKTLYVGRNLTPAM
Ga0184628_1035663813300018083Groundwater SedimentLKPGTQIIIFGWDKQPDGSVLAKTMYVGRNITPAM
Ga0187774_1045509913300018089Tropical PeatlandAPGSKDEIKPGAQVIIFGWDKQPDGSVLAKVMYVGRGITPAM
Ga0197907_1084973423300020069Corn, Switchgrass And Miscanthus RhizosphereGVGLAIAAAAKGDASELKAGAQIIIFGWDKQADGSVLAKTMYVGRGVTPAM
Ga0126371_1099109833300021560Tropical Forest SoilAITAVAPGNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM
Ga0207697_1007804723300025315Corn, Switchgrass And Miscanthus RhizosphereAKKEEIKAGAPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM
Ga0208478_104484913300025475Arctic Peat SoilTVIAAAAPGSKDELKPGAHIIIFASEKQADGVILIKTMYVGRNVAPAM
Ga0207713_121515923300025735Switchgrass RhizosphereKIVVTPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQADGSVLAKTLYIGRNVAPAM
Ga0209124_1023118813300025852Arctic Peat SoilDTVIAAVAPGNKSELKAGTPIIIMGSDKQADGSVLAKVLDVGRNITPAM
Ga0209585_1046325023300025891Arctic Peat SoilPGNKSELKAGTPIIIMGSDKQADGSVLAKVLYVGRNVTPAM
Ga0207699_1027232133300025906Corn, Switchgrass And Miscanthus RhizosphereELKPGAQIIIMQSEKQADGSIVAKNLYVGRGLTPAM
Ga0207707_1104831223300025912Corn RhizosphereEEIKAGTPIIIFGWDKQPDGSVLAKSLYIGRSVPPAM
Ga0207707_1121638613300025912Corn RhizosphereAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYIGRSVTPAM
Ga0207657_1150089013300025919Corn RhizosphereAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM
Ga0207650_1073235413300025925Switchgrass RhizosphereGNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM
Ga0207700_1131985613300025928Corn, Switchgrass And Miscanthus RhizosphereAITAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYVGRSLTPAM
Ga0207670_1019420213300025936Switchgrass RhizosphereIAAAAPAKKEEIKAGTPIIIFGWDKQADGSVLAKTLYIGRNVAPAM
Ga0207667_1022189243300025949Corn RhizosphereDKSELKPGVQIIIFGWEKLPDGAVLAKTLYVGRGLTPAM
Ga0207667_1032209813300025949Corn RhizosphereTPQTVIAAVAKGDKKELKKGAHILIFQSEKQAGGSLLAKVLYVGRDVVPAM
Ga0207639_1046186133300026041Corn RhizosphereTAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYVGRSLTPAM
Ga0207678_1115991823300026067Corn RhizosphereVHVTPQTVIAAAAPGKKEEIKAGTPIIIFGWDKQPDGSVLAKTLYIGRNVTPAM
Ga0207674_1131179213300026116Corn RhizosphereELKPGVQIIIFGWEKLPDGAVLAKTLYVGRGLTPAM
Ga0207576_10019913300026745SoilVVVTPQTIIAAAAPAKKEEIKAGTPMIIFGWDKQPDGSVLAKTLYIGRSVAPAM
Ga0207820_10519213300026809Tropical Forest SoilSKGELRPGVEIIIFGWDKQADGSVLVKTMYVGRGLTPAM
Ga0207804_11508623300026849Tropical Forest SoilIAAAAPAKKEELKPGVQIIIFGWDKQPDGSVLAKTLYVGRNLTPAM
Ga0207783_101300413300026942Tropical Forest SoilLRPGAEIIIFGWDKQADGSVLVKTMYVGRGLTPAM
Ga0207777_103789513300027330Tropical Forest SoilKVIVTPQTMIAAAAPAKKEELKPGVQIIIFGWDKQPDGSVLAKTLYVGRNLTPAM
Ga0209073_1033588013300027765Agricultural SoilAAPANKEELKPGAQIIIFGWDKQPDGSILAKTLYVGRSLTPAM
Ga0209974_1003060713300027876Arabidopsis Thaliana RhizospherePGKKEEIRAGTPIIIFGWDKQPDGSVLAKTLYIGRSVTPAM
Ga0209048_1056165313300027902Freshwater Lake SedimentTVIAAAAPGNKDELKAGAQIIIFGWDKQPDGSVLAKVMYVGRNVVPAM
Ga0307299_1022541713300028793SoilNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM
Ga0307497_1001449723300031226SoilAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM
Ga0302323_10333334613300031232FenGNKDELKAGTPIIIMASEKQADGSVLAKTVYVGRAGPPAM
Ga0265340_1042492813300031247RhizosphereVIAAVAPGNKDELKAGTPIIIMASEKQADGSVLAKTLYVGRAGPPAM
(restricted) Ga0255312_113571013300031248Sandy SoilTPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKTLYIGRSVTPAM
Ga0308194_1010250513300031421SoilGNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM
Ga0170820_1736966513300031446Forest SoilVIAAAAPGKKEELKPGAQIIIFGWDKQADGSVLAKTLYVGRAGPPAM
Ga0170818_11163752213300031474Forest SoilTVIAAAAPGKKEELKPGAQIIIFGWDKQADGSVLAKTLYVGRAGPPAM
Ga0318542_1040953413300031668SoilITAVAPGNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM
Ga0315293_1080685823300031746SedimentKDTVIAAAAPGSKDEIKAGVQVIIFGWDKQPDGSVLAKTMYVGRDVKPAM
Ga0308175_10113258523300031938SoilAAKGDASELKAGAQIIVFGWEKQADGSVLAKTMYVGRGLTPAM
Ga0310896_1022924113300032211SoilGNKDELKPGTQIIIMAADKQSDGSVLAKTLYVGRSLTPAM
Ga0335081_1077424423300032892SoilIAAAAPGSKDELKPGAQIVIFGWDKQADGSVLAKVMYVGRDVVPAM
Ga0310811_1032740413300033475SoilGDKSELKAGTPVIIMGSEKAADGTVVAKTLYIGRNVRPAM
Ga0299912_1031197723300033489SoilLKAGTPVIIMASDKQPDGSVLGKTFYVGRGVAPAM
Ga0314871_007007_635_7663300033809PeatlandAAPGKKEELKPGAQIIIFGWDKQTDGSVLAKTLYIGRAGPPAM
Ga0370484_0086267_702_8093300034125Untreated Peat SoilLKAGAQLIIFGWDKQADGSVLAKVMYVGRGVTPAM
Ga0370484_0238615_378_5033300034125Untreated Peat SoilPSSKDELKAGTQIIIFGWDKQSDGSVLAKVMYVGRNVTPAM
Ga0373950_0000978_3462_36173300034818Rhizosphere SoilTPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.