Basic Information | |
---|---|
Family ID | F061134 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 44 residues |
Representative Sequence | PGNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM |
Number of Associated Samples | 116 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.48 % |
% of genes from short scaffolds (< 2000 bps) | 96.97 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.394 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.091 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.364 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.909 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 24.64% Coil/Unstructured: 71.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF14579 | HHH_6 | 11.36 |
PF01336 | tRNA_anti-codon | 10.61 |
PF02566 | OsmC | 2.27 |
PF02736 | Myosin_N | 0.76 |
PF12146 | Hydrolase_4 | 0.76 |
PF00528 | BPD_transp_1 | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 2.27 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 2.27 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.39 % |
Unclassified | root | N/A | 35.61 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908040|B4_c_ConsensusfromContig129954 | Not Available | 873 | Open in IMG/M |
2170459014|G1P06HT01ARGEX | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100797167 | Not Available | 964 | Open in IMG/M |
3300000443|F12B_10600611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
3300000787|JGI11643J11755_11659834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 542 | Open in IMG/M |
3300000891|JGI10214J12806_10675298 | Not Available | 762 | Open in IMG/M |
3300004479|Ga0062595_100386678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 995 | Open in IMG/M |
3300004479|Ga0062595_100770879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 786 | Open in IMG/M |
3300005205|Ga0068999_10140312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 507 | Open in IMG/M |
3300005332|Ga0066388_102767501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 896 | Open in IMG/M |
3300005334|Ga0068869_100261465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1385 | Open in IMG/M |
3300005337|Ga0070682_100407788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1030 | Open in IMG/M |
3300005339|Ga0070660_101896834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 508 | Open in IMG/M |
3300005364|Ga0070673_102288574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 514 | Open in IMG/M |
3300005434|Ga0070709_10244644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1289 | Open in IMG/M |
3300005434|Ga0070709_10930645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
3300005454|Ga0066687_10595766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 656 | Open in IMG/M |
3300005458|Ga0070681_11362519 | Not Available | 633 | Open in IMG/M |
3300005459|Ga0068867_101061536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
3300005544|Ga0070686_101299085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 608 | Open in IMG/M |
3300005563|Ga0068855_101649747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 655 | Open in IMG/M |
3300005563|Ga0068855_101692817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 645 | Open in IMG/M |
3300005564|Ga0070664_100366003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1314 | Open in IMG/M |
3300005564|Ga0070664_102255815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 516 | Open in IMG/M |
3300005614|Ga0068856_101799877 | Not Available | 624 | Open in IMG/M |
3300005617|Ga0068859_100457319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1372 | Open in IMG/M |
3300005618|Ga0068864_102445582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 528 | Open in IMG/M |
3300006086|Ga0075019_10831160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 590 | Open in IMG/M |
3300006175|Ga0070712_100243072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1435 | Open in IMG/M |
3300006354|Ga0075021_11169285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 505 | Open in IMG/M |
3300006575|Ga0074053_10018351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1906 | Open in IMG/M |
3300006578|Ga0074059_11621755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 715 | Open in IMG/M |
3300006755|Ga0079222_12622677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
3300006797|Ga0066659_10480133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 993 | Open in IMG/M |
3300006852|Ga0075433_10594553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
3300006903|Ga0075426_10361580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1068 | Open in IMG/M |
3300006914|Ga0075436_100240405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1288 | Open in IMG/M |
3300009011|Ga0105251_10134615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1119 | Open in IMG/M |
3300009029|Ga0066793_10400104 | Not Available | 789 | Open in IMG/M |
3300009101|Ga0105247_10368024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1016 | Open in IMG/M |
3300009168|Ga0105104_10795614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
3300009545|Ga0105237_10311329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1578 | Open in IMG/M |
3300009649|Ga0105855_1221031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
3300009839|Ga0116223_10573066 | Not Available | 653 | Open in IMG/M |
3300010043|Ga0126380_11958772 | Not Available | 535 | Open in IMG/M |
3300010358|Ga0126370_10104155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1970 | Open in IMG/M |
3300010358|Ga0126370_11937565 | Not Available | 574 | Open in IMG/M |
3300010359|Ga0126376_10923235 | Not Available | 865 | Open in IMG/M |
3300010359|Ga0126376_12232925 | Not Available | 592 | Open in IMG/M |
3300010366|Ga0126379_10293570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1627 | Open in IMG/M |
3300010371|Ga0134125_11014608 | Not Available | 910 | Open in IMG/M |
3300010371|Ga0134125_11940951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47 | 640 | Open in IMG/M |
3300010375|Ga0105239_13291316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
3300010379|Ga0136449_103266753 | Not Available | 624 | Open in IMG/M |
3300011119|Ga0105246_11411158 | Not Available | 650 | Open in IMG/M |
3300011414|Ga0137442_1113971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
3300012362|Ga0137361_11769769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
3300012476|Ga0157344_1027316 | Not Available | 529 | Open in IMG/M |
3300012912|Ga0157306_10062445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 974 | Open in IMG/M |
3300012960|Ga0164301_11465923 | Not Available | 561 | Open in IMG/M |
3300012984|Ga0164309_10498914 | Not Available | 931 | Open in IMG/M |
3300012984|Ga0164309_10647344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
3300012984|Ga0164309_11896857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
3300012985|Ga0164308_11784913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
3300012987|Ga0164307_11309832 | Not Available | 606 | Open in IMG/M |
3300012987|Ga0164307_11472238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300013100|Ga0157373_10894798 | Not Available | 658 | Open in IMG/M |
3300013297|Ga0157378_10522215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1189 | Open in IMG/M |
3300013307|Ga0157372_10556066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1338 | Open in IMG/M |
3300013307|Ga0157372_13218571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
3300014325|Ga0163163_10475114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1311 | Open in IMG/M |
3300014326|Ga0157380_11551436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47 | 717 | Open in IMG/M |
3300014968|Ga0157379_11328269 | Not Available | 695 | Open in IMG/M |
3300014968|Ga0157379_12293579 | Not Available | 537 | Open in IMG/M |
3300015171|Ga0167648_1009596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2420 | Open in IMG/M |
3300015245|Ga0137409_11274320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
3300015372|Ga0132256_101116534 | Not Available | 903 | Open in IMG/M |
3300015372|Ga0132256_103455006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
3300016422|Ga0182039_11652206 | Not Available | 585 | Open in IMG/M |
3300016445|Ga0182038_10000924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15287 | Open in IMG/M |
3300017930|Ga0187825_10112554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
3300017947|Ga0187785_10528609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300018029|Ga0187787_10208051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 695 | Open in IMG/M |
3300018060|Ga0187765_11032932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
3300018083|Ga0184628_10356638 | Not Available | 767 | Open in IMG/M |
3300018089|Ga0187774_10455099 | Not Available | 794 | Open in IMG/M |
3300020069|Ga0197907_10849734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
3300021560|Ga0126371_10991098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 982 | Open in IMG/M |
3300025315|Ga0207697_10078047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1393 | Open in IMG/M |
3300025475|Ga0208478_1044849 | Not Available | 845 | Open in IMG/M |
3300025735|Ga0207713_1215159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
3300025852|Ga0209124_10231188 | Not Available | 719 | Open in IMG/M |
3300025891|Ga0209585_10463250 | Not Available | 524 | Open in IMG/M |
3300025906|Ga0207699_10272321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1174 | Open in IMG/M |
3300025912|Ga0207707_11048312 | Not Available | 667 | Open in IMG/M |
3300025912|Ga0207707_11216386 | Not Available | 609 | Open in IMG/M |
3300025919|Ga0207657_11500890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47 | 504 | Open in IMG/M |
3300025925|Ga0207650_10732354 | Not Available | 836 | Open in IMG/M |
3300025928|Ga0207700_11319856 | Not Available | 643 | Open in IMG/M |
3300025936|Ga0207670_10194202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1538 | Open in IMG/M |
3300025949|Ga0207667_10221892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1936 | Open in IMG/M |
3300025949|Ga0207667_10322098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1579 | Open in IMG/M |
3300026041|Ga0207639_10461861 | Not Available | 1154 | Open in IMG/M |
3300026067|Ga0207678_11159918 | Not Available | 684 | Open in IMG/M |
3300026116|Ga0207674_11311792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
3300026745|Ga0207576_100199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1646 | Open in IMG/M |
3300026809|Ga0207820_105192 | Not Available | 1117 | Open in IMG/M |
3300026849|Ga0207804_115086 | Not Available | 700 | Open in IMG/M |
3300026942|Ga0207783_1013004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 829 | Open in IMG/M |
3300027330|Ga0207777_1037895 | Not Available | 872 | Open in IMG/M |
3300027765|Ga0209073_10335880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
3300027876|Ga0209974_10030607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1784 | Open in IMG/M |
3300027902|Ga0209048_10561653 | Not Available | 764 | Open in IMG/M |
3300028793|Ga0307299_10225417 | Not Available | 704 | Open in IMG/M |
3300031226|Ga0307497_10014497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81 | 2314 | Open in IMG/M |
3300031232|Ga0302323_103333346 | Not Available | 511 | Open in IMG/M |
3300031247|Ga0265340_10424928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1135710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
3300031421|Ga0308194_10102505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
3300031446|Ga0170820_17369665 | Not Available | 830 | Open in IMG/M |
3300031474|Ga0170818_111637522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1148 | Open in IMG/M |
3300031668|Ga0318542_10409534 | Not Available | 701 | Open in IMG/M |
3300031746|Ga0315293_10806858 | Not Available | 687 | Open in IMG/M |
3300031938|Ga0308175_101132585 | Not Available | 868 | Open in IMG/M |
3300032211|Ga0310896_10229241 | Not Available | 929 | Open in IMG/M |
3300032892|Ga0335081_10774244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47 | 1151 | Open in IMG/M |
3300033475|Ga0310811_10327404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1739 | Open in IMG/M |
3300033489|Ga0299912_10311977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1315 | Open in IMG/M |
3300033809|Ga0314871_007007 | Not Available | 767 | Open in IMG/M |
3300034125|Ga0370484_0086267 | Not Available | 810 | Open in IMG/M |
3300034125|Ga0370484_0238615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
3300034818|Ga0373950_0000978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3619 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.09% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.79% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.03% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.27% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.27% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.27% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.52% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.52% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.52% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.52% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.76% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.76% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.76% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.76% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.76% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.76% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.76% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.76% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.76% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908040 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026745 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08K1-12 (SPAdes) | Environmental | Open in IMG/M |
3300026809 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes) | Environmental | Open in IMG/M |
3300026849 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes) | Environmental | Open in IMG/M |
3300026942 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63 (SPAdes) | Environmental | Open in IMG/M |
3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
3300033809 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_D | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B4_c_05252930 | 2124908040 | Soil | XXLXAGTPIIIMASEKQAXXSVLAXTXYXGRXXPPXM |
2PV_02980310 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MIAAAAPGKKDELKAGAQIIISVGQAAGWIDTGQAMYVGRSVAPAM |
INPhiseqgaiiFebDRAFT_1007971671 | 3300000364 | Soil | NKEELKPGAQIIIMASDKQPDGSVLAKTLYIGRNLTPAM* |
F12B_106006113 | 3300000443 | Soil | GNKEELKPGAQIIIMASDKQSDGSVLAKTLYIGRSLTPAM* |
JGI11643J11755_116598342 | 3300000787 | Soil | ITAVAPGNKEELKPGAQIIIMASDKQSDGSVLAKTLYIGRSLTPAM* |
JGI10214J12806_106752982 | 3300000891 | Soil | IKAGTPIIIFGWDKQPDGSVLAKSLYIGRSVTPAM* |
Ga0062595_1003866783 | 3300004479 | Soil | VTPQTIIAAAAPAKKEEIKAGTPMIIFGWDKQPDGSVLAKTLYIGRNVTPAM* |
Ga0062595_1007708792 | 3300004479 | Soil | TIAAAAPGNKDELKSGAQIIIFGWDKQPDGSILAKTLYVGRSVTPAM* |
Ga0068999_101403121 | 3300005205 | Natural And Restored Wetlands | APGNKSELKPGTPIIIFASEKQPDGSVLAKTMYIGRDVTPAM* |
Ga0066388_1027675011 | 3300005332 | Tropical Forest Soil | AITAVAPGNKDELMPGAQIIIMASDKQADGSVLAKTLYIGRSLTPAM* |
Ga0068869_1002614652 | 3300005334 | Miscanthus Rhizosphere | PGNKDELKTGAQIIIFGWDKQADGSILAKSLYIGRSVTPAM* |
Ga0070682_1004077881 | 3300005337 | Corn Rhizosphere | AKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM* |
Ga0070660_1018968341 | 3300005339 | Corn Rhizosphere | RAAPGSKDELKAGAQIIIFASAKEGDTTVAKVLYVGRGVTPAM* |
Ga0070673_1022885742 | 3300005364 | Switchgrass Rhizosphere | AKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYIGRNVTPAM* |
Ga0070709_102446441 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AITAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM* |
Ga0070709_109306452 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GNKDELKAGTQIIIMASEKQPDGSALAKVLYVGRGLTPAM* |
Ga0066687_105957662 | 3300005454 | Soil | AVAPVNKDELKAGAQIIIFASDKQPDGSVLVKSMYVGRGVTPAM* |
Ga0070681_113625192 | 3300005458 | Corn Rhizosphere | AKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYIGRSVTPAM* |
Ga0068867_1010615361 | 3300005459 | Miscanthus Rhizosphere | KVIVTPQTIIAAAAPAKKEEIKAGTPMIIFGWDKQPDGSVLAKSLYVGRSVTPAM* |
Ga0070686_1012990852 | 3300005544 | Switchgrass Rhizosphere | NKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM* |
Ga0068855_1016497472 | 3300005563 | Corn Rhizosphere | DASELKPGAQVIIFGWDKQADGSILAKTMYVGRGLTPAM* |
Ga0068855_1016928171 | 3300005563 | Corn Rhizosphere | VIAAVAKGDKKELKKGAHILIFQSEKQAGGSLLAKVLYVGRDVVPAM* |
Ga0070664_1003660031 | 3300005564 | Corn Rhizosphere | GKKDELKAGAQIIIFGWDKQPDGSILAKTMYVGRSVAPAM* |
Ga0070664_1022558151 | 3300005564 | Corn Rhizosphere | TAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM* |
Ga0068856_1017998771 | 3300005614 | Corn Rhizosphere | KAGAQIIIFGWDKQPDGSILAKTLYVGRGLTPAM* |
Ga0068859_1004573192 | 3300005617 | Switchgrass Rhizosphere | AAPGKKDELKAGLQIIIFGWDKQPDGSILAKTMYVGRSVAPAM* |
Ga0068864_1024455821 | 3300005618 | Switchgrass Rhizosphere | AVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM* |
Ga0075019_108311601 | 3300006086 | Watersheds | VVTKDTVIAAAAAGNKDELKAGAQIIIFGWDKQADGSVLAKVMYVGRGLTPAM* |
Ga0070712_1002430721 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | APGKKEELKPGAQIIIFGWDKQADGTVLAKTLYVGRAGPPAM* |
Ga0075021_111692852 | 3300006354 | Watersheds | AAAAPAKKEELKPGAQIIIFVWDKQPDGSVLAKVLYVGRNVTPAM* |
Ga0074053_100183512 | 3300006575 | Soil | IAAAAPGKKDELKAGAQIIIFGWDKQPDGSILAKTMYVGRSVAPAM* |
Ga0074059_116217551 | 3300006578 | Soil | KVIVTPQTIIAAAAPGKKEEIKAGTPIIIFGWDKQPDGSILAKTMYVGRSVAPAM* |
Ga0079222_126226771 | 3300006755 | Agricultural Soil | DAVIQAVAPGNKDELKAGAQIIIMQSEKQADGSYLAKNVYVGRGLTPAM* |
Ga0066659_104801331 | 3300006797 | Soil | KPGAQIIIMASEKQADGSILAKNMYVGRGVTPAM* |
Ga0075433_105945531 | 3300006852 | Populus Rhizosphere | VTPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM* |
Ga0075426_103615803 | 3300006903 | Populus Rhizosphere | ELKAGAQIIIMASEKQADGSVLAKTLYVGRGLTPAM* |
Ga0075436_1002404051 | 3300006914 | Populus Rhizosphere | AAKGDKSELKPGVQIIIFGWEKLPDGAVLAKTLYVGRGLTPAM* |
Ga0105251_101346152 | 3300009011 | Switchgrass Rhizosphere | DELKAGAQIIIFGWDKQPDGSILAKTMYVGRSVAPAM* |
Ga0066793_104001041 | 3300009029 | Prmafrost Soil | SKDELKPGAQIIIFGWDKQSDGSVLAKVMYVGRNVTPAM* |
Ga0105247_103680241 | 3300009101 | Switchgrass Rhizosphere | QTVIAAAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM* |
Ga0105104_107956142 | 3300009168 | Freshwater Sediment | GNKDELKPGEQIIIMASDKQADGSVLAKTLYIGRSLTPAM* |
Ga0105237_103113291 | 3300009545 | Corn Rhizosphere | KPGTQIIIMAADKQPDGSVLVKTLYVGRSLTPAM* |
Ga0105855_12210312 | 3300009649 | Permafrost Soil | VIAAVAPGNKDDLKPGTQIIIMASDKQPDGSVLAKTLYVGRSLTPAM* |
Ga0116223_105730661 | 3300009839 | Peatlands Soil | AAAPGSKDELKAGTQIIIFGWDKQPDGSVLAKVMYIGRNVTPAM* |
Ga0126380_119587722 | 3300010043 | Tropical Forest Soil | DKAELKVGAQIIIMQSEKQPDGSVLGKNLYIGRGVTPAM* |
Ga0126370_101041551 | 3300010358 | Tropical Forest Soil | QAVAPGNKDELKAGAQIIIMQSEKQADGSFLAKNVYVGRGLTPAM* |
Ga0126370_119375651 | 3300010358 | Tropical Forest Soil | ELKAGAQIIIFGWDKQADGSVLAKTLYVGRAGPPAM* |
Ga0126376_109232351 | 3300010359 | Tropical Forest Soil | KKEEIKAGTPIILFGWDKQPDGSVLAKTLYIGRSVAPAM* |
Ga0126376_122329251 | 3300010359 | Tropical Forest Soil | ELKPGTQVIIMASDKQPDGSVLAKTLYIGRGLTPAM* |
Ga0126379_102935703 | 3300010366 | Tropical Forest Soil | PGNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM* |
Ga0134125_110146083 | 3300010371 | Terrestrial Soil | IKAGTPIIIFGWDKQPDGSVLAKSLYIGRSVPPAM* |
Ga0134125_119409511 | 3300010371 | Terrestrial Soil | KTGAQIIIFGWDKQADGSILAKSLYIGRSVTPAM* |
Ga0105239_132913162 | 3300010375 | Corn Rhizosphere | VTPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQADGWVLAKTLYIGRNVAPAM* |
Ga0136449_1032667532 | 3300010379 | Peatlands Soil | LVAGTPIIIMASEKQTDGSVLAKVLYVGRAGPPAM* |
Ga0105246_114111581 | 3300011119 | Miscanthus Rhizosphere | LKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM* |
Ga0137442_11139711 | 3300011414 | Soil | LKAGTQIIIFGWDKQSDGSVLAKVMYVGRNVTPAM* |
Ga0137361_117697691 | 3300012362 | Vadose Zone Soil | SKDELKPGAQIIIMASEKQADGSILAKNMYVGRGVTPAM* |
Ga0157344_10273161 | 3300012476 | Arabidopsis Rhizosphere | APANKDELKPGTQIIIMAADKQPDGSVLAKTLYVGRSLTPAM* |
Ga0157306_100624452 | 3300012912 | Soil | KVIVTPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM* |
Ga0164301_114659231 | 3300012960 | Soil | VVAVSIKDELKPGTQIIIMAADKQPDGSVLAKTLYVGRSLTPAM* |
Ga0164309_104989142 | 3300012984 | Soil | QTVIAAAAPGKKEELKPGAQIIIFGWDKQADGTVLAKTLYVGRAGPPAM* |
Ga0164309_106473441 | 3300012984 | Soil | DKSELKPGVQIIIFGWEKLPDGVVLAKTLYVGRGLTPAM* |
Ga0164309_118968572 | 3300012984 | Soil | VTPQTAIARAAPGSKDELKAGAQIIIFASAKEGDTTVAKVLYVGRGVTPAM* |
Ga0164308_117849131 | 3300012985 | Soil | AIAAAAKGDKSELKPGVQIIIFGWEKLPDGAVLAKTLYVGRGLTPAM* |
Ga0164307_113098321 | 3300012987 | Soil | APGNKDELKSGAQIIIFGWDKQPDGSILAKTLYVGRSVTPAM* |
Ga0164307_114722382 | 3300012987 | Soil | PQTAIARAAPGSKDELKAGAQIIIFASAKEGDTTVAKVLYVGRGVTPAM* |
Ga0157373_108947982 | 3300013100 | Corn Rhizosphere | AAKGDASELKAGAQIIIFGWDKQADGSVLAKTMYVGRGVTPAM* |
Ga0157378_105222151 | 3300013297 | Miscanthus Rhizosphere | TAITAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYVGRSLTPAM* |
Ga0157372_105560661 | 3300013307 | Corn Rhizosphere | QGRREEGCGHAQTMIAAAAPGKKDELKAGAQIIIFGWDKQPDGSILAKTMYVGRSVAPAM |
Ga0157372_132185712 | 3300013307 | Corn Rhizosphere | AITAVAPANKDELKPGTQIIIMAADKQSDGSVLAKTLYVGRSLTPAM* |
Ga0163163_104751143 | 3300014325 | Switchgrass Rhizosphere | ATAITAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM* |
Ga0157380_115514361 | 3300014326 | Switchgrass Rhizosphere | AAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM* |
Ga0157379_113282691 | 3300014968 | Switchgrass Rhizosphere | APAKKEEIKAGTPIIIFGWDKQADGSVLAKTLYIGRNVAPAM* |
Ga0157379_122935791 | 3300014968 | Switchgrass Rhizosphere | TAITAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM* |
Ga0167648_10095963 | 3300015171 | Glacier Forefield Soil | LVPGAQIIIMGSEKAPDGSVLAKSMYVGRALTPAM* |
Ga0137409_112743201 | 3300015245 | Vadose Zone Soil | NKDELKAGTPIIIMQSDKQADGSVLAKNVYVGRGAAPAM* |
Ga0132256_1011165342 | 3300015372 | Arabidopsis Rhizosphere | VAPGNRDELKPGTQVIIMASDKQPDGSVLAKTLYVGRNLTPAM* |
Ga0132256_1034550061 | 3300015372 | Arabidopsis Rhizosphere | EIKAGTPMIIFGWDKQPDGSVLAKTLYIGRNVTPAM* |
Ga0182039_116522061 | 3300016422 | Soil | IAVTPQTVIAAAAPSEKEDLKAGTQVIIFAWDKQSDGSVLAKSIYVGRDVAPAM |
Ga0182038_100009241 | 3300016445 | Soil | PGNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM |
Ga0187825_101125541 | 3300017930 | Freshwater Sediment | ELKTGVQIIIFGWDKQPDGSVLAKTMYVGRNLTPAM |
Ga0187785_105286092 | 3300017947 | Tropical Peatland | IAAVAPASKDEIKAGSQIIIFASEKQPDGSILAKTMYVGRDVTPAM |
Ga0187787_102080511 | 3300018029 | Tropical Peatland | KKILVTPQTVIAAAAPATKDEIKAGTQLIIFGWDKDGDGSVLAKVMYLGRNVTPAM |
Ga0187765_110329322 | 3300018060 | Tropical Peatland | IVTPQTMIAAAAPAKKEELKPGVQIIIFGWDKQPDGSVLAKTLYVGRNLTPAM |
Ga0184628_103566381 | 3300018083 | Groundwater Sediment | LKPGTQIIIFGWDKQPDGSVLAKTMYVGRNITPAM |
Ga0187774_104550991 | 3300018089 | Tropical Peatland | APGSKDEIKPGAQVIIFGWDKQPDGSVLAKVMYVGRGITPAM |
Ga0197907_108497342 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | GVGLAIAAAAKGDASELKAGAQIIIFGWDKQADGSVLAKTMYVGRGVTPAM |
Ga0126371_109910983 | 3300021560 | Tropical Forest Soil | AITAVAPGNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM |
Ga0207697_100780472 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | AKKEEIKAGAPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM |
Ga0208478_10448491 | 3300025475 | Arctic Peat Soil | TVIAAAAPGSKDELKPGAHIIIFASEKQADGVILIKTMYVGRNVAPAM |
Ga0207713_12151592 | 3300025735 | Switchgrass Rhizosphere | KIVVTPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQADGSVLAKTLYIGRNVAPAM |
Ga0209124_102311881 | 3300025852 | Arctic Peat Soil | DTVIAAVAPGNKSELKAGTPIIIMGSDKQADGSVLAKVLDVGRNITPAM |
Ga0209585_104632502 | 3300025891 | Arctic Peat Soil | PGNKSELKAGTPIIIMGSDKQADGSVLAKVLYVGRNVTPAM |
Ga0207699_102723213 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ELKPGAQIIIMQSEKQADGSIVAKNLYVGRGLTPAM |
Ga0207707_110483122 | 3300025912 | Corn Rhizosphere | EEIKAGTPIIIFGWDKQPDGSVLAKSLYIGRSVPPAM |
Ga0207707_112163861 | 3300025912 | Corn Rhizosphere | AAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYIGRSVTPAM |
Ga0207657_115008901 | 3300025919 | Corn Rhizosphere | APAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM |
Ga0207650_107323541 | 3300025925 | Switchgrass Rhizosphere | GNKDELKPGAQIIIMAADKQPDGSVLAKTLYIGRSLTPAM |
Ga0207700_113198561 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AITAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYVGRSLTPAM |
Ga0207670_101942021 | 3300025936 | Switchgrass Rhizosphere | IAAAAPAKKEEIKAGTPIIIFGWDKQADGSVLAKTLYIGRNVAPAM |
Ga0207667_102218924 | 3300025949 | Corn Rhizosphere | DKSELKPGVQIIIFGWEKLPDGAVLAKTLYVGRGLTPAM |
Ga0207667_103220981 | 3300025949 | Corn Rhizosphere | TPQTVIAAVAKGDKKELKKGAHILIFQSEKQAGGSLLAKVLYVGRDVVPAM |
Ga0207639_104618613 | 3300026041 | Corn Rhizosphere | TAVAPGNKDELKPGAQIIIMAADKQPDGSVLAKTLYVGRSLTPAM |
Ga0207678_111599182 | 3300026067 | Corn Rhizosphere | VHVTPQTVIAAAAPGKKEEIKAGTPIIIFGWDKQPDGSVLAKTLYIGRNVTPAM |
Ga0207674_113117921 | 3300026116 | Corn Rhizosphere | ELKPGVQIIIFGWEKLPDGAVLAKTLYVGRGLTPAM |
Ga0207576_1001991 | 3300026745 | Soil | VVVTPQTIIAAAAPAKKEEIKAGTPMIIFGWDKQPDGSVLAKTLYIGRSVAPAM |
Ga0207820_1051921 | 3300026809 | Tropical Forest Soil | SKGELRPGVEIIIFGWDKQADGSVLVKTMYVGRGLTPAM |
Ga0207804_1150862 | 3300026849 | Tropical Forest Soil | IAAAAPAKKEELKPGVQIIIFGWDKQPDGSVLAKTLYVGRNLTPAM |
Ga0207783_10130041 | 3300026942 | Tropical Forest Soil | LRPGAEIIIFGWDKQADGSVLVKTMYVGRGLTPAM |
Ga0207777_10378951 | 3300027330 | Tropical Forest Soil | KVIVTPQTMIAAAAPAKKEELKPGVQIIIFGWDKQPDGSVLAKTLYVGRNLTPAM |
Ga0209073_103358801 | 3300027765 | Agricultural Soil | AAPANKEELKPGAQIIIFGWDKQPDGSILAKTLYVGRSLTPAM |
Ga0209974_100306071 | 3300027876 | Arabidopsis Thaliana Rhizosphere | PGKKEEIRAGTPIIIFGWDKQPDGSVLAKTLYIGRSVTPAM |
Ga0209048_105616531 | 3300027902 | Freshwater Lake Sediment | TVIAAAAPGNKDELKAGAQIIIFGWDKQPDGSVLAKVMYVGRNVVPAM |
Ga0307299_102254171 | 3300028793 | Soil | NKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM |
Ga0307497_100144972 | 3300031226 | Soil | AAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM |
Ga0302323_1033333461 | 3300031232 | Fen | GNKDELKAGTPIIIMASEKQADGSVLAKTVYVGRAGPPAM |
Ga0265340_104249281 | 3300031247 | Rhizosphere | VIAAVAPGNKDELKAGTPIIIMASEKQADGSVLAKTLYVGRAGPPAM |
(restricted) Ga0255312_11357101 | 3300031248 | Sandy Soil | TPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKTLYIGRSVTPAM |
Ga0308194_101025051 | 3300031421 | Soil | GNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM |
Ga0170820_173696651 | 3300031446 | Forest Soil | VIAAAAPGKKEELKPGAQIIIFGWDKQADGSVLAKTLYVGRAGPPAM |
Ga0170818_1116375221 | 3300031474 | Forest Soil | TVIAAAAPGKKEELKPGAQIIIFGWDKQADGSVLAKTLYVGRAGPPAM |
Ga0318542_104095341 | 3300031668 | Soil | ITAVAPGNKDELKPGAQIIIMASDKQPDGSVLAKTLYVGRSLTPAM |
Ga0315293_108068582 | 3300031746 | Sediment | KDTVIAAAAPGSKDEIKAGVQVIIFGWDKQPDGSVLAKTMYVGRDVKPAM |
Ga0308175_1011325852 | 3300031938 | Soil | AAKGDASELKAGAQIIVFGWEKQADGSVLAKTMYVGRGLTPAM |
Ga0310896_102292411 | 3300032211 | Soil | GNKDELKPGTQIIIMAADKQSDGSVLAKTLYVGRSLTPAM |
Ga0335081_107742442 | 3300032892 | Soil | IAAAAPGSKDELKPGAQIVIFGWDKQADGSVLAKVMYVGRDVVPAM |
Ga0310811_103274041 | 3300033475 | Soil | GDKSELKAGTPVIIMGSEKAADGTVVAKTLYIGRNVRPAM |
Ga0299912_103119772 | 3300033489 | Soil | LKAGTPVIIMASDKQPDGSVLGKTFYVGRGVAPAM |
Ga0314871_007007_635_766 | 3300033809 | Peatland | AAPGKKEELKPGAQIIIFGWDKQTDGSVLAKTLYIGRAGPPAM |
Ga0370484_0086267_702_809 | 3300034125 | Untreated Peat Soil | LKAGAQLIIFGWDKQADGSVLAKVMYVGRGVTPAM |
Ga0370484_0238615_378_503 | 3300034125 | Untreated Peat Soil | PSSKDELKAGTQIIIFGWDKQSDGSVLAKVMYVGRNVTPAM |
Ga0373950_0000978_3462_3617 | 3300034818 | Rhizosphere Soil | TPQTVIAAAAPAKKEEIKAGTPIIIFGWDKQPDGSVLAKSLYVGRSVTPAM |
⦗Top⦘ |