NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061114

Metagenome / Metatranscriptome Family F061114

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061114
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 39 residues
Representative Sequence MSARLRWRKFVSGFMLTMTGVCAVVAVSVLFFILGYL
Number of Associated Samples 117
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 88.64 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.42 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.970 % of family members)
Environment Ontology (ENVO) Unclassified
(30.303 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.545 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 49.23%    β-sheet: 0.00%    Coil/Unstructured: 50.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF00528BPD_transp_1 90.91
PF12849PBP_like_2 8.33


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_105014521All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300001471|JGI12712J15308_10012268All Organisms → cellular organisms → Bacteria2304Open in IMG/M
3300001593|JGI12635J15846_10399234All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300001661|JGI12053J15887_10308384All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300002245|JGIcombinedJ26739_100310019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1462Open in IMG/M
3300002245|JGIcombinedJ26739_100694755All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300005179|Ga0066684_10966578All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae552Open in IMG/M
3300005458|Ga0070681_11627960All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae571Open in IMG/M
3300005553|Ga0066695_10450005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae794Open in IMG/M
3300005568|Ga0066703_10613481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae633Open in IMG/M
3300005598|Ga0066706_10258196All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1358Open in IMG/M
3300005994|Ga0066789_10284809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae692Open in IMG/M
3300006041|Ga0075023_100444600All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae571Open in IMG/M
3300006175|Ga0070712_101289211All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae636Open in IMG/M
3300006176|Ga0070765_100021256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4862Open in IMG/M
3300006854|Ga0075425_100175305All Organisms → cellular organisms → Bacteria2461Open in IMG/M
3300007255|Ga0099791_10664891All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300009143|Ga0099792_10432295All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300010043|Ga0126380_10816640All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300010043|Ga0126380_10856891All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300010048|Ga0126373_12907508All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300010343|Ga0074044_10640503All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300010359|Ga0126376_11370871All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300010360|Ga0126372_11165438All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300010376|Ga0126381_102330359All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300010398|Ga0126383_11235192All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300011269|Ga0137392_11448412All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300011271|Ga0137393_11183781All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300012096|Ga0137389_11844498All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012203|Ga0137399_10080258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium2475Open in IMG/M
3300012203|Ga0137399_11465751All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300012205|Ga0137362_11038227All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300012354|Ga0137366_10193571All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1521Open in IMG/M
3300012363|Ga0137390_10421543All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1312Open in IMG/M
3300012363|Ga0137390_11204420All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300012917|Ga0137395_10423826All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300012918|Ga0137396_10966590All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300012922|Ga0137394_10600442All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300012924|Ga0137413_10173076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1430Open in IMG/M
3300012960|Ga0164301_10979550All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300012971|Ga0126369_10683213All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300014153|Ga0181527_1222899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae774Open in IMG/M
3300015054|Ga0137420_1095461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1636Open in IMG/M
3300015054|Ga0137420_1222612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3115Open in IMG/M
3300015242|Ga0137412_10817676All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300015356|Ga0134073_10193637All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300016445|Ga0182038_11290529All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300016750|Ga0181505_10370913All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300018006|Ga0187804_10098103All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300018058|Ga0187766_11013543All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300018062|Ga0187784_11631216All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae511Open in IMG/M
3300018086|Ga0187769_11421677All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300019788|Ga0182028_1007280All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300020062|Ga0193724_1053429All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300020150|Ga0187768_1016681All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1544Open in IMG/M
3300020170|Ga0179594_10357701All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300020580|Ga0210403_10480321All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300020581|Ga0210399_10478431All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300020583|Ga0210401_11003942All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300021088|Ga0210404_10554505All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae651Open in IMG/M
3300021168|Ga0210406_10725343All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300021168|Ga0210406_11249944All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300021171|Ga0210405_10070932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2747Open in IMG/M
3300021171|Ga0210405_10608739All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300021180|Ga0210396_11495137All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300021307|Ga0179585_1128679All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300021401|Ga0210393_10183511All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1688Open in IMG/M
3300021405|Ga0210387_11155895All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300021432|Ga0210384_11540809All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300021474|Ga0210390_10808207All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300021560|Ga0126371_11191127All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300024186|Ga0247688_1005017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1876Open in IMG/M
3300024219|Ga0247665_1048145All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300025474|Ga0208479_1079340All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300025527|Ga0208714_1044206All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300025939|Ga0207665_11555282All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300026308|Ga0209265_1140204All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300026328|Ga0209802_1182015All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300026330|Ga0209473_1080295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1377Open in IMG/M
3300026529|Ga0209806_1147210All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300026530|Ga0209807_1280304All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300026551|Ga0209648_10058091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3289Open in IMG/M
3300026552|Ga0209577_10840525All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300026692|Ga0207725_107760All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300026879|Ga0207763_1011049All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300026959|Ga0207852_1001636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2696Open in IMG/M
3300027024|Ga0207819_1049170All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300027473|Ga0207508_102713All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300027562|Ga0209735_1031775All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300027565|Ga0209219_1094667All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300027667|Ga0209009_1018421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1686Open in IMG/M
3300027737|Ga0209038_10076603All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300027855|Ga0209693_10124923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1272Open in IMG/M
3300027869|Ga0209579_10653158All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300028047|Ga0209526_10558469All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300028138|Ga0247684_1080124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae540Open in IMG/M
3300028138|Ga0247684_1080275All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300028381|Ga0268264_12266554All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300028800|Ga0265338_10485658All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300029636|Ga0222749_10235682All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300030490|Ga0302184_10386403All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300031446|Ga0170820_12281221All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300031546|Ga0318538_10762655All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031715|Ga0307476_10423654All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300031720|Ga0307469_11110761All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300031720|Ga0307469_11728941All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300031724|Ga0318500_10620704All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031726|Ga0302321_101448541All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300031753|Ga0307477_10090723All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2122Open in IMG/M
3300031754|Ga0307475_10131195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1980Open in IMG/M
3300031754|Ga0307475_10899984All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300031765|Ga0318554_10238428All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300031781|Ga0318547_10920029All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031820|Ga0307473_10844081All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300031823|Ga0307478_11148548All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300031823|Ga0307478_11598388All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300031890|Ga0306925_12274533All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031897|Ga0318520_10608065All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300031910|Ga0306923_10644036All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300031910|Ga0306923_11690131All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300031946|Ga0310910_10525501All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300031981|Ga0318531_10357197All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300032001|Ga0306922_11347877All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300032035|Ga0310911_10106781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1541Open in IMG/M
3300032035|Ga0310911_10141809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1347Open in IMG/M
3300032035|Ga0310911_10158919All Organisms → cellular organisms → Bacteria1274Open in IMG/M
3300032205|Ga0307472_100951031All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300032205|Ga0307472_101052278All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300032805|Ga0335078_12520106All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300033289|Ga0310914_10311032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1421Open in IMG/M
3300033402|Ga0326728_10149671All Organisms → cellular organisms → Bacteria2538Open in IMG/M
3300033983|Ga0371488_0521290All Organisms → cellular organisms → Bacteria535Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.15%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil8.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.79%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.52%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.52%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.76%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.76%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.76%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.76%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.76%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.76%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.76%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.76%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.76%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.76%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021307Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300024219Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06EnvironmentalOpen in IMG/M
3300025474Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026692Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 38 (SPAdes)EnvironmentalOpen in IMG/M
3300026879Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes)EnvironmentalOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027024Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes)EnvironmentalOpen in IMG/M
3300027473Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK08-D (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10501452113300001213WetlandMNRRHYWRKTVNAFMFLMAGLCALITVSVLFFILGFLV
JGI12712J15308_1001226833300001471Forest SoilMSAGNARLRWRKLVSGFMLAMTGVCALVAVAALFFI
JGI12635J15846_1039923413300001593Forest SoilMNSGLRWRKFMSNFMLTMTGVCALVAVSALFFILGYLVYNG
JGI12053J15887_1030838423300001661Forest SoilMNSRLRWRKFVSGFMLSMTGVCALISVSVLFFILGYLV
JGIcombinedJ26739_10031001913300002245Forest SoilMSPRLRWRKLVSGFMLTMTCVCALVTVSVLFFILGYLVYHGG
JGIcombinedJ26739_10069475523300002245Forest SoilMSPRLRWRKFVSGFMLTMTGVCALVAVSVLFFILGYLVY
Ga0066684_1096657813300005179SoilMTARLRWRKLVSGFMLTMTGVCALIAVSVLFLILGHLVYNGGTS
Ga0070681_1162796023300005458Corn RhizosphereMSPRLRWRKFVSGFMLTMTAVCALVAVSALFFILGYLVYHGGT
Ga0066695_1045000523300005553SoilMTARLRFRKLVSAVMLSLTGVCAFVAVSVLFFILGYLA
Ga0066703_1061348123300005568SoilMNPRLQWRKLVSGFMLTMTGVCALVAVSVLFFILGYFVYNGG
Ga0066706_1025819633300005598SoilMSPRLRWRKFVSGFMLTMTGVCAMVAVSVLFLILGYLAIHGGASV
Ga0066789_1028480923300005994SoilLNNARLKWRKFVSNFMLTMTGVCAFVSVSVLFLILGYL
Ga0075023_10044460013300006041WatershedsMSETPMNPRLRWRKFVSNFMLTMTGVCAFVAVSVLFFILGYLVIHGGAS
Ga0070712_10128921123300006175Corn, Switchgrass And Miscanthus RhizosphereMNNRLRWRKFVSGLMLTMTGVCAFIAVSVLFLILGYLVYN
Ga0070765_10002125613300006176SoilMSNGRLRWRKFISNFMLAMTGVCAFVSVLVLFFILGYLLF
Ga0075425_10017530543300006854Populus RhizosphereMSLRLRWRKCVSAFMLSMTGVCAVVAVSALFLILS
Ga0099791_1066489123300007255Vadose Zone SoilMSNGRLRWRKFVSNFMLAMTGVCAFVSVLVLFFILGYLL
Ga0099792_1043229513300009143Vadose Zone SoilMNSRLRWRKFVSNFMRTMTGVCAVVSVSVLFFILGY
Ga0126380_1081664023300010043Tropical Forest SoilMNARLRWRKAVSGFMLTLTGVCAVVAVSTLFLILGYLVYHGGT
Ga0126380_1085689123300010043Tropical Forest SoilMNVRLRWRKLVSGFMLTLTGVCAAISVSALFLILG
Ga0126373_1290750823300010048Tropical Forest SoilMDARLRWRKFVSNFMLAMTGVCAFVSVLVLFLILGYLVF
Ga0074044_1064050313300010343Bog Forest SoilMNARLRWRKFVSNFMLTMTGVCALVSVAVLFFILGCLV
Ga0126376_1137087113300010359Tropical Forest SoilMNARLRWRKLVSAFMLTMTGVCAVVAVAVLFFILGYLVFH
Ga0126372_1116543813300010360Tropical Forest SoilMSARLRWRKFLSAFMLGMTGVCTVVSVSVLFFILGYLLYHG
Ga0126381_10233035913300010376Tropical Forest SoilMNARLRWRKFVSGFMLTMTGVCAAVSVSALFLILGYLV
Ga0126383_1123519213300010398Tropical Forest SoilMTARLRWRKLVSNFMLTLTGICAAVAVSALFFILGY
Ga0137392_1144841213300011269Vadose Zone SoilMSARLRWRKFVSGFMLTMTGVCAVVAVSVLFFILGYL
Ga0137393_1118378123300011271Vadose Zone SoilMSLRLRWRKFVSGFMLTMTGVCALVAVSVLFFILGYLVY
Ga0137389_1184449813300012096Vadose Zone SoilMSPRLRWRKFVSGFMLTMTGVCALVAVSVLFFILGYLVYH
Ga0137399_1008025833300012203Vadose Zone SoilMTARLRWRKFLSGLMLTMTGVCALVAVSVLFFILGYLVY
Ga0137399_1146575113300012203Vadose Zone SoilMSPRLRWRKFVSGFMLTLTGVCATVAVSVLFFILGYL
Ga0137362_1103822723300012205Vadose Zone SoilMSLRLRWRKFVSGFMLTMTGVCALVAVSVLFFILG
Ga0137366_1019357133300012354Vadose Zone SoilSARLRWRKFVSGFMLTMTGVCAVVAVSVLFFILG*
Ga0137390_1042154313300012363Vadose Zone SoilMNSRLRWRKFVSNFMLTMTGVCALVSVSVLFFILGYL
Ga0137390_1120442013300012363Vadose Zone SoilMSPRLRWRKFVSGFMLTMTGVCALIAVSVLFLILGYLA
Ga0137395_1042382623300012917Vadose Zone SoilMSPRLRWRKFVSGFMLTLTGVCATVAVSVLFFILGY
Ga0137396_1096659023300012918Vadose Zone SoilMTPRLRWRKFVSGFMLTMTGVCALVSVSVLFFILGHLVY
Ga0137394_1060044223300012922Vadose Zone SoilMNARLRWRKLVSGFMLTMTGICAAVAVSVLFFILGYFV
Ga0137413_1017307613300012924Vadose Zone SoilMSPRLRWRKFVSGFMLTMTGVCALVAVSVLFLILGYLA
Ga0164301_1097955023300012960SoilMNPRLRWRKFVSNFMLTMTCCCALIAVSVLFFILGNLVY
Ga0126369_1068321313300012971Tropical Forest SoilMNGRLRWRKLVSAFMLTMTGVCALVAVSVLFFILG
Ga0181527_122289923300014153BogMTARVKWRRFVSNFMLTLTGVCALVSVSVLFFILGYLVFNGG
Ga0137420_109546113300015054Vadose Zone SoilMNSRLRWRKFVSGFMLTMTGVCALVSVSVLFFILGHLVYH
Ga0137420_122261243300015054Vadose Zone SoilVSARLRWRKFVSGFMLAMTGVCALVSVSVLFLILG
Ga0137412_1081767613300015242Vadose Zone SoilMSPRLRWRKFVSGFMLTMTGVCALVAVSVLFLILG
Ga0134073_1019363713300015356Grasslands SoilMNTRLRWRKFVSAFMLSMTGVCAVVAVSALFLILSYLVYHGGTA
Ga0182038_1129052923300016445SoilMAARLRWRKFVSNLMLTMTGVCAFVSVAVLFFILGYLLFN
Ga0181505_1037091323300016750PeatlandMSARVKWRRFVSNFMLTLTGVCALVSVSVLFFILGYLIF
Ga0187804_1009810323300018006Freshwater SedimentMSGRLRWRKFVSNFMLTLTGVCAFVSVAVLFFILGYLLFNG
Ga0187766_1101354313300018058Tropical PeatlandMTMNAQLRWRKFVSNFMLTMTGVCALISVSVLFFILGYLVY
Ga0187784_1163121613300018062Tropical PeatlandMSARVKWRRFVSDFMLTLTGICALVSVSVLFFILGYLVFNG
Ga0187769_1142167713300018086Tropical PeatlandMSARLRWRKFVSNFMLTMTGVCAVVSVSVLFLILGYLVYHGGTSID
Ga0182028_100728023300019788FenMSARVKWRRFVSNFMLTLTGLCALVCVSVLFLILGYLVFNG
Ga0193724_105342923300020062SoilMTARLRWRKLVSAFMLTMTGICALVAVSVLFFILGYFVYN
Ga0187768_101668133300020150Tropical PeatlandMGARLRWRKFVSNFMLTMTGVCAVVSVIALFLILGYLVFNGGTSVN
Ga0179594_1035770123300020170Vadose Zone SoilMSPRLRWRKFVSGFMLTMTGVCALVAVSVLFFILGYL
Ga0210403_1048032113300020580SoilMSSRLRWRKFVSGFMLTMTGVCAFVSVAVLFFILGY
Ga0210399_1047843113300020581SoilMSPRLRWRKFVSGFMLTMTGVCALVAVSVLFFILG
Ga0210401_1100394223300020583SoilMSSRLRWRKFVSGFMLTMTGVCAFVSVAVLFFILGYLIYHGGTSI
Ga0210404_1055450513300021088SoilMNSRLRWRKFVSGFMLTMTGLCALVSVSVLFLILGYLVYHGGTS
Ga0210406_1072534313300021168SoilVTTGRVRWRKFVSNFMLTLTGVCAVISVSVLFLILG
Ga0210406_1124994413300021168SoilLTTGKVRWRKFVSNFMLTLTGVCAVISVSVLFLILGY
Ga0210405_1007093243300021171SoilMSETPMNPRLRWRKFVSNFMLTMTGVCALVAVSVLF
Ga0210405_1060873913300021171SoilMSNGRLRWRKFVSNFMLAMTGVCAFVSVLVLFFILGYLLFNG
Ga0210396_1149513713300021180SoilMSSRLRWRKFVSGFMLTMTGVCAVVAVAVLFFILGYLVY
Ga0179585_112867923300021307Vadose Zone SoilMNSRLRWRKFVSRFMLTMTGVCALVSVSVLFFILGHLVYHGG
Ga0210393_1018351133300021401SoilMNRRLRWRKFVSNFMLSMTGVCAFVAVSVLFFILGSLVYHGGTSI
Ga0210387_1115589513300021405SoilMNARLRWRKFVSNFMLAMTGVCAVVSVGVLFLILGYLLYNG
Ga0210384_1154080923300021432SoilMSARLRWRKFVSNFMLGLTGVCALVSVGVLFLILGYLLYNGGT
Ga0210390_1080820723300021474SoilMNSRLRWRKFASNFMLTMTGLCAVVAVSVLFFILGYLVYYGG
Ga0126371_1119112713300021560Tropical Forest SoilMQARLQWRKFVSNFMLTMTAVCAFVSVAVLFFILGYLLFN
Ga0247688_100501713300024186SoilMTGRLKWRKFVSGFMLTMTGVCAVVAVSVLFLILG
Ga0247665_104814523300024219SoilMNPRLRWRKFVSNFMLTMTCCCALIAVSVLFFILGNLVYH
Ga0208479_107934013300025474Arctic Peat SoilMNRARLHWRKFVSNFMLTMTGLCALISVSALFFIL
Ga0208714_104420613300025527Arctic Peat SoilMNNARLHWRKFVSNFMLTMTGLCAFTSVSALFFILGYLLFNGGIGT
Ga0207665_1155528223300025939Corn, Switchgrass And Miscanthus RhizosphereMSTALPVAPMSARLRWRKFVSGFMLTLTGVCAVVAVSVLFLILGY
Ga0209265_114020423300026308SoilMNTRLRWRKFVSAFMLSMTGVCAVVAVSALFLILSYLVYHGGTAVSWS
Ga0209802_118201513300026328SoilMSARLRWRKFVSGFMLTMTGVCALVAVSVLCFILGYLVF
Ga0209473_108029513300026330SoilMNTRLRWRKFVSAFMLSMTGVCAVVAVSALFLILSYLVYHGGT
Ga0209806_114721023300026529SoilMSPRLRWRKFVSGFMLTMTGVCAMVAVSVLFLILGYLAV
Ga0209807_128030423300026530SoilMSPRLRWRKFVSGFMLTMTGVCAMVAVSVLFLILGYLAIHGGA
Ga0209648_1005809113300026551Grasslands SoilMSPRLRWRKFVSGFMLTMTGLCALVAVSVLFFILRY
Ga0209577_1084052523300026552SoilMSPRLRWRKFVSGFMLTMTGVCAMVAVSVLFLILG
Ga0207725_10776023300026692Tropical Forest SoilMGGRLRWRKFVSNFMLTLTGVCAGVSVAVLFFILG
Ga0207763_101104913300026879Tropical Forest SoilMGGRLRWRKFVSNFMLTLTGVCAGVSVAVLFFILGYLLF
Ga0207852_100163613300026959Tropical Forest SoilMAARLRWRKFVSNFMLTLTGVCAFVSVAVLFFILGYLLFN
Ga0207819_104917023300027024Tropical Forest SoilMKGARLQWRKFVSNFMLTMTGICAFISVSALFFIL
Ga0207508_10271313300027473SoilMNPRLRWRKFVSNFMLTMTCCCALIAVSVLFFILGNL
Ga0209735_103177523300027562Forest SoilMSGRLRWRKFVSGFMLTMTGVCAVVAVAVLFFILG
Ga0209219_109466713300027565Forest SoilMSPRLRWRKFVSGFMLTMTGVCALVAVSALFFILGYLVY
Ga0209009_101842113300027667Forest SoilMSNRLRWRKFVSHFMLTMTGLCALVAVAVLFFILGYL
Ga0209038_1007660313300027737Bog Forest SoilMTARLRYRKFVSGFMLGMTGLAAFITVSVLFFILGYLVYHGGTSI
Ga0209693_1012492333300027855SoilMSPRLRWRKFVSGFMLTLTGICAVVAVAVLFFILG
Ga0209579_1065315823300027869Surface SoilMPARNARLRWRKFVSGFMLTMTGVCAIVAVAVLFFILGYLVYH
Ga0209526_1055846913300028047Forest SoilMSNRLRWRKFVSHFMLTMTGLCALVAVAVLFFILGYLV
Ga0247684_108012423300028138SoilMTGRLKWRKFVSGFMLTMTGVCAVVAVSVLFLILGYLIYNGGTSINWN
Ga0247684_108027513300028138SoilMSSGRLRWRKFVSNFMLAMTGVCAFLSVLVLFFILGYLVFNGGT
Ga0268264_1226655413300028381Switchgrass RhizosphereMNARLRWRKLVSAFMLTMTGVCALVAVSVLFFILGYL
Ga0265338_1048565813300028800RhizosphereMPAMSARLRWRKFVSGFMLTMTGLCALVAVAVLFF
Ga0222749_1023568213300029636SoilMTMNAQLRWRKFVSNFMLTMTGVCALISVSVLFFIL
Ga0302184_1038640323300030490PalsaMTARLRYRKFVSGFMLGMTGLAALITVSVLFFILGYLVYHGGTS
Ga0170820_1228122123300031446Forest SoilMSRRLRWRQFVSYFMLTMTGLCALVAKAVLFFILGYLVY
Ga0318538_1076265523300031546SoilMQARLQWRKFVSNFMLTMTAVCAFVSVAVLFFILGYL
Ga0307476_1042365423300031715Hardwood Forest SoilMTARLRYRKFVSGFMLGMTGLAALITVSVLFFILGYLVYHGGTSI
Ga0307469_1111076113300031720Hardwood Forest SoilMSPRLRWRKFVSGFMLTMTGVCAIVAVAVLFFILGY
Ga0307469_1172894123300031720Hardwood Forest SoilMSARLRWRKFVSNFMLTMTGICAVVSVAILFLILGYL
Ga0318500_1062070423300031724SoilMNARLKWRKLVSAFMLTMTGVCAVVAVAVLFFILG
Ga0302321_10144854123300031726FenMTARNRGRNAINNIMLSLTGVCAFLAVSTLFFTLGYLLYNGGKSL
Ga0307477_1009072313300031753Hardwood Forest SoilMSPQLRWRKFVSGFMLTMTGVCALVAVSVLFFILGYLVY
Ga0307475_1013119533300031754Hardwood Forest SoilMSPRLRWRKFVSGFMLTMTGVCALIAVSVLFFILGYL
Ga0307475_1089998423300031754Hardwood Forest SoilMNARLRWRKFVSNFMLTMTGVCAVVSVCVLFFILGCLIYQGGTSIN
Ga0318554_1023842823300031765SoilMQARLQWRKFVSNFMLTMTGVCAFVSVAVLFFILGYLLFNGGTSIN
Ga0318547_1092002923300031781SoilMAARLRWRKFVSNFMLTLTGVCAFVSVAVLFFILGY
Ga0307473_1084408113300031820Hardwood Forest SoilMNARLKWRKFVSAFMLTMTGVCALVAVSVLFFILGYL
Ga0307478_1114854813300031823Hardwood Forest SoilMNARLRWRKFVSNFMLTMTGVCAVVSVAVLFLILGCLIYQGGTSINWNFF
Ga0307478_1159838823300031823Hardwood Forest SoilMSSRLRWRKFVSSFMLTMTGVCALVAVSVLFLILGYLDYHGGT
Ga0306925_1227453313300031890SoilMNARLRWRKLLSGFMLTMTGVCAIVTVSVLFFILGY
Ga0318520_1060806523300031897SoilMSTRLRWRKFLSNLMLTMTGLCALISVSALFFILGYLLFN
Ga0306923_1064403613300031910SoilMAARLRWRKFVSNLMLTMTGVCAFVSVAALFFILGYLLFN
Ga0306923_1169013113300031910SoilMQARLQWRKFVSNFMLTMTAVCAFVSVAVLFFILGYLLFNGGT
Ga0310910_1052550113300031946SoilMEGRLRWRKLLSDFMLTLTGVCAFISVAALFCILGYLLFNGGTSIN
Ga0318531_1035719713300031981SoilMQARLQWRKFVSNFMLTMTAVCAFVSVAVLFFILG
Ga0306922_1134787723300032001SoilMAARLRWRKFVSNLMLTMTGVCAFVSVAVLFFILGYLLFNGGTS
Ga0310911_1010678133300032035SoilMNARLRWRKLVSNFMLTMTGVCAFVSVAVLFFILGYLLFNGGT
Ga0310911_1014180933300032035SoilMNARLRWRKFVSGFMLTMTGVCAAVSVSALFLILGYLVVRGGASIN
Ga0310911_1015891913300032035SoilMSTRLRWRKFLSNLMLTMTGLCALISVSALFFILGYLLFNGGTS
Ga0307472_10095103123300032205Hardwood Forest SoilMSSRLRWRKFVSGFMLTMTGVCALVSVSALFFILGYLVYN
Ga0307472_10105227823300032205Hardwood Forest SoilMSARLRWRKFVSNFMLTMTGICAVVSVAILFLILGYLL
Ga0335078_1252010623300032805SoilMNARLRWRKFVSNFMLTMTGVCAFVSVAVLFFILGYL
Ga0310914_1031103233300033289SoilMAARLRWRKFVSNLMLTMTGVCAFVSVAALFFILGYLLFNGGT
Ga0326728_1014967113300033402Peat SoilMSARIKWRRFVSNFMLTLTGVCAIVSVSVLFFILG
Ga0371488_0521290_415_5343300033983Peat SoilMSAGVKWRRFVSNFMLTLTGLCALVSVSVLFFILGYLVFN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.