Basic Information | |
---|---|
Family ID | F061012 |
Family Type | Metagenome |
Number of Sequences | 132 |
Average Sequence Length | 42 residues |
Representative Sequence | MQAEYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLAAGE |
Number of Associated Samples | 116 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 61.83 % |
% of genes near scaffold ends (potentially truncated) | 99.24 % |
% of genes from short scaffolds (< 2000 bps) | 88.64 % |
Associated GOLD sequencing projects | 112 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.697 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (14.394 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.242 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (34.848 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.96% β-sheet: 22.39% Coil/Unstructured: 68.66% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF05598 | DUF772 | 76.52 |
PF13751 | DDE_Tnp_1_6 | 13.64 |
PF13683 | rve_3 | 1.52 |
PF09346 | SMI1_KNR4 | 0.76 |
PF13249 | SQHop_cyclase_N | 0.76 |
PF13592 | HTH_33 | 0.76 |
PF08029 | HisG_C | 0.76 |
PF13358 | DDE_3 | 0.76 |
PF00465 | Fe-ADH | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG0040 | ATP phosphoribosyltransferase | Amino acid transport and metabolism [E] | 0.76 |
COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.76 |
COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.76 |
COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.76 |
COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.70 % |
Unclassified | root | N/A | 5.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000310|WSSedA1Ba2DRAFT_1038240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 565 | Open in IMG/M |
3300001402|JGI20195J14853_1040545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 632 | Open in IMG/M |
3300001431|F14TB_107110320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 741 | Open in IMG/M |
3300004019|Ga0055439_10326195 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300004775|Ga0007798_10029997 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300004779|Ga0062380_10105096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1053 | Open in IMG/M |
3300005183|Ga0068993_10120668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 859 | Open in IMG/M |
3300005332|Ga0066388_104129596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 740 | Open in IMG/M |
3300005434|Ga0070709_10946921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 683 | Open in IMG/M |
3300005602|Ga0070762_10416382 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300005830|Ga0074473_10360729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1046 | Open in IMG/M |
3300006052|Ga0075029_100908730 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300006224|Ga0079037_102539703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 511 | Open in IMG/M |
3300006794|Ga0066658_10524614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 644 | Open in IMG/M |
3300006844|Ga0075428_101972728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 605 | Open in IMG/M |
3300007258|Ga0099793_10691824 | Not Available | 514 | Open in IMG/M |
3300009082|Ga0105099_10835870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 578 | Open in IMG/M |
3300009087|Ga0105107_10574230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 785 | Open in IMG/M |
3300009089|Ga0099828_11916640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 520 | Open in IMG/M |
3300009525|Ga0116220_10282965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 728 | Open in IMG/M |
3300010040|Ga0126308_11283004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 520 | Open in IMG/M |
3300010379|Ga0136449_101501984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1031 | Open in IMG/M |
3300010379|Ga0136449_103028245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 655 | Open in IMG/M |
3300010403|Ga0134123_12429023 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 589 | Open in IMG/M |
3300011397|Ga0137444_1017512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 985 | Open in IMG/M |
3300012199|Ga0137383_10084237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 2300 | Open in IMG/M |
3300012200|Ga0137382_11256545 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
3300012201|Ga0137365_11235935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 533 | Open in IMG/M |
3300012205|Ga0137362_11666947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 524 | Open in IMG/M |
3300012206|Ga0137380_10387218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1243 | Open in IMG/M |
3300012349|Ga0137387_11245690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 523 | Open in IMG/M |
3300012353|Ga0137367_10726878 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300012354|Ga0137366_11045537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 565 | Open in IMG/M |
3300012918|Ga0137396_11253353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 518 | Open in IMG/M |
3300012944|Ga0137410_11999601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 515 | Open in IMG/M |
(restricted) 3300013125|Ga0172369_10045175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 3428 | Open in IMG/M |
3300014166|Ga0134079_10093980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1134 | Open in IMG/M |
3300014306|Ga0075346_1157193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 532 | Open in IMG/M |
3300014491|Ga0182014_10561622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 555 | Open in IMG/M |
3300014498|Ga0182019_10517530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 829 | Open in IMG/M |
3300015245|Ga0137409_11529948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 516 | Open in IMG/M |
3300017925|Ga0187856_1257033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 614 | Open in IMG/M |
3300017941|Ga0187850_10304983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 705 | Open in IMG/M |
3300017974|Ga0187777_11108998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 576 | Open in IMG/M |
3300018015|Ga0187866_1350657 | Not Available | 509 | Open in IMG/M |
3300018021|Ga0187882_1376449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 539 | Open in IMG/M |
3300018038|Ga0187855_10067769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 2188 | Open in IMG/M |
3300019082|Ga0187852_1027367 | All Organisms → cellular organisms → Bacteria | 2786 | Open in IMG/M |
3300019082|Ga0187852_1305499 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300019785|Ga0182022_1096947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 500 | Open in IMG/M |
3300020221|Ga0194127_10104779 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
3300021051|Ga0206224_1063526 | Not Available | 513 | Open in IMG/M |
3300021344|Ga0193719_10250323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 749 | Open in IMG/M |
3300021601|Ga0194061_1163483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 659 | Open in IMG/M |
3300022555|Ga0212088_10227660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1438 | Open in IMG/M |
3300022555|Ga0212088_10426329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 886 | Open in IMG/M |
3300024182|Ga0247669_1040212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 781 | Open in IMG/M |
3300024283|Ga0247670_1040202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 842 | Open in IMG/M |
3300024287|Ga0247690_1015390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 865 | Open in IMG/M |
3300025167|Ga0209642_10583332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 610 | Open in IMG/M |
3300025285|Ga0208046_1035034 | Not Available | 909 | Open in IMG/M |
3300025479|Ga0208588_1040411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 953 | Open in IMG/M |
3300025495|Ga0207932_1012950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 2438 | Open in IMG/M |
3300025553|Ga0208080_1068149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 831 | Open in IMG/M |
3300025852|Ga0209124_10337415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 559 | Open in IMG/M |
3300026075|Ga0207708_11991790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 508 | Open in IMG/M |
3300026328|Ga0209802_1081665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1498 | Open in IMG/M |
3300026492|Ga0256802_1009820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1050 | Open in IMG/M |
3300027568|Ga0208042_1023525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1587 | Open in IMG/M |
3300027604|Ga0208324_1198815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 532 | Open in IMG/M |
3300027854|Ga0209517_10110962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1825 | Open in IMG/M |
3300027887|Ga0208980_10678702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 584 | Open in IMG/M |
3300027890|Ga0209496_10079572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1346 | Open in IMG/M |
3300027911|Ga0209698_10303179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1264 | Open in IMG/M |
3300028145|Ga0247663_1050734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 697 | Open in IMG/M |
3300028268|Ga0255348_1045880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 802 | Open in IMG/M |
3300028813|Ga0302157_10402593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 729 | Open in IMG/M |
3300029907|Ga0311329_10987101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 523 | Open in IMG/M |
3300029910|Ga0311369_10674883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 852 | Open in IMG/M |
3300029911|Ga0311361_10071317 | All Organisms → cellular organisms → Bacteria | 5261 | Open in IMG/M |
3300029913|Ga0311362_10012141 | All Organisms → cellular organisms → Bacteria | 15854 | Open in IMG/M |
3300029915|Ga0311358_10573108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 859 | Open in IMG/M |
3300029986|Ga0302188_10045281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 2099 | Open in IMG/M |
3300030659|Ga0316363_10035225 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
3300030659|Ga0316363_10161065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 956 | Open in IMG/M |
3300030838|Ga0311335_10741443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 693 | Open in IMG/M |
3300031234|Ga0302325_12276021 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300031238|Ga0265332_10501792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 503 | Open in IMG/M |
3300031239|Ga0265328_10462867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 502 | Open in IMG/M |
3300031240|Ga0265320_10099478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1340 | Open in IMG/M |
3300031261|Ga0302140_10904077 | Not Available | 618 | Open in IMG/M |
3300031772|Ga0315288_10430745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1325 | Open in IMG/M |
3300031820|Ga0307473_10600556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 760 | Open in IMG/M |
3300031902|Ga0302322_103261238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 557 | Open in IMG/M |
3300031951|Ga0315904_10462461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1130 | Open in IMG/M |
3300031997|Ga0315278_10200640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 2052 | Open in IMG/M |
3300032118|Ga0315277_11031051 | Not Available | 748 | Open in IMG/M |
3300032118|Ga0315277_11521759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 571 | Open in IMG/M |
3300032143|Ga0315292_11502325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 545 | Open in IMG/M |
3300032160|Ga0311301_11019936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1091 | Open in IMG/M |
3300032160|Ga0311301_12013372 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300032163|Ga0315281_10186931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 2319 | Open in IMG/M |
3300032163|Ga0315281_10256743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1925 | Open in IMG/M |
3300032177|Ga0315276_11448329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 716 | Open in IMG/M |
3300032177|Ga0315276_12243168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 552 | Open in IMG/M |
3300032275|Ga0315270_10057067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 2206 | Open in IMG/M |
3300032275|Ga0315270_10095604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1733 | Open in IMG/M |
3300032401|Ga0315275_10579441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1254 | Open in IMG/M |
3300032401|Ga0315275_11530475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 715 | Open in IMG/M |
3300032516|Ga0315273_10523989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1583 | Open in IMG/M |
3300032516|Ga0315273_10772591 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
3300032516|Ga0315273_11944575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 701 | Open in IMG/M |
3300032516|Ga0315273_12252824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 637 | Open in IMG/M |
3300032516|Ga0315273_12456329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 602 | Open in IMG/M |
3300032770|Ga0335085_11838661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 619 | Open in IMG/M |
3300032893|Ga0335069_11254721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 809 | Open in IMG/M |
3300032897|Ga0335071_11617884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 592 | Open in IMG/M |
3300033402|Ga0326728_10995679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 581 | Open in IMG/M |
3300033416|Ga0316622_100755063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1128 | Open in IMG/M |
3300033513|Ga0316628_102634407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 663 | Open in IMG/M |
3300033521|Ga0316616_100927598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1077 | Open in IMG/M |
3300033521|Ga0316616_101005579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1041 | Open in IMG/M |
3300033780|Ga0334878_002636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 791 | Open in IMG/M |
3300033780|Ga0334878_008642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 555 | Open in IMG/M |
3300033798|Ga0334821_068838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 703 | Open in IMG/M |
3300033820|Ga0334817_028843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1125 | Open in IMG/M |
3300033824|Ga0334840_020807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 2149 | Open in IMG/M |
3300033890|Ga0334810_104652 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300033996|Ga0334979_0097701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1833 | Open in IMG/M |
3300034070|Ga0334822_053882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 870 | Open in IMG/M |
3300034123|Ga0370479_0011350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1991 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 14.39% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.85% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.58% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 6.06% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.30% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.30% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.30% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.03% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.27% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.27% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.52% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.52% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.52% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.52% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.52% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.52% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.52% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.52% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.76% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.76% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.76% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.76% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.76% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.76% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.76% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.76% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.76% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.76% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.76% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000310 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300001402 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004775 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17M | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021601 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-21m | Environmental | Open in IMG/M |
3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
3300025285 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300m (SPAdes) | Environmental | Open in IMG/M |
3300025479 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026492 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS5 | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300028268 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5 | Environmental | Open in IMG/M |
3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033780 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 E3 1-5 | Environmental | Open in IMG/M |
3300033798 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-S | Environmental | Open in IMG/M |
3300033820 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-D | Environmental | Open in IMG/M |
3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
3300033890 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-M | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034070 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-M | Environmental | Open in IMG/M |
3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
WSSedA1Ba2DRAFT_10382402 | 3300000310 | Wetland | MQAEYEMKVQVIRSQGRAARLFVNIPMPLAAALDLQA |
JGI20195J14853_10405451 | 3300001402 | Arctic Peat Soil | MQAKYPMKVQVIRSKGVGPRFYINIPLPLAAAIDLAAGEQMQWQLRGRSEL |
F14TB_1071103201 | 3300001431 | Soil | MQAEYVMKVQVIKAKNVPPRFYVNIPLPLAAALDLAGGEAVQW |
Ga0055439_103261951 | 3300004019 | Natural And Restored Wetlands | MQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLQASEPVQWQLLGRSDLR |
Ga0007798_100299973 | 3300004775 | Freshwater | MQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRGREPVQW |
Ga0062380_101050961 | 3300004779 | Wetland Sediment | MQAEYVMKVQVIKAKNVAPRFYVNIPLPLAASLDLQAGEAVQ |
Ga0068993_101206682 | 3300005183 | Natural And Restored Wetlands | MQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLQASEPV |
Ga0066388_1041295962 | 3300005332 | Tropical Forest Soil | VLFEMKLQVIRSKGRAQRLFVNVPLALAGALDMKPGERLRW |
Ga0070709_109469212 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAQYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLSAGEEV |
Ga0070762_104163822 | 3300005602 | Soil | MPAEYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLTAGERVQWQLLD |
Ga0074473_103607291 | 3300005830 | Sediment (Intertidal) | MQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQ |
Ga0075029_1009087301 | 3300006052 | Watersheds | MQAQYEVKMQVIRSKGRATRLFVNIPMPLAAALDIQA |
Ga0079037_1025397032 | 3300006224 | Freshwater Wetlands | MQAKDPMKVQVIRAKGVAPRFYINIPLPLAAALDLSAGELM |
Ga0066658_105246142 | 3300006794 | Soil | MQAQFEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGERVRWQLLARSDL |
Ga0075428_1019727282 | 3300006844 | Populus Rhizosphere | MQAEYVMKVQVIKAKNVPPRFYVNIPLPLAAALDLEGG |
Ga0099793_106918242 | 3300007258 | Vadose Zone Soil | MQAEYVMKVQVIRSKRRQPRFFVNVPLPLAAALDLA |
Ga0105099_108358701 | 3300009082 | Freshwater Sediment | MQAEYVMKVQVIRSQKQPPRFYVNIPLPLAAALDLEAGEQ |
Ga0105107_105742302 | 3300009087 | Freshwater Sediment | MQAKYPMKVQVIRSKGVAPRFYINIPLPLAAAIDLSAGEQMQ |
Ga0099828_119166401 | 3300009089 | Vadose Zone Soil | MQAEYVMKVQVIRSKRRPPRFFVNMPLPLAAALDLEAGE |
Ga0116220_102829652 | 3300009525 | Peatlands Soil | MQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRAR |
Ga0126308_112830042 | 3300010040 | Serpentine Soil | MQAEYVMRVQVIKSKKQPPCFYVNIPLPLAAALDLQASEE |
Ga0136449_1015019841 | 3300010379 | Peatlands Soil | MQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRAREL |
Ga0136449_1030282452 | 3300010379 | Peatlands Soil | MQAQYVMKIQAIRSKKQPPRFYVNIPLPLAAALDLGAG |
Ga0134123_124290231 | 3300010403 | Terrestrial Soil | MKGVGKGSEYEIKVQAIRSKKQAPRFYVNIPLPLAAALDLEAG |
Ga0137444_10175122 | 3300011397 | Soil | MQAEYVMRVQVIKSKKQPPRFYVNIPLPLAAALDLQASEE |
Ga0137383_100842371 | 3300012199 | Vadose Zone Soil | MQAEFEMKVQVIRSKGRATRLFVNIPLPLAAALDLQAGERVR |
Ga0137382_112565451 | 3300012200 | Vadose Zone Soil | MQAQYPMKVQVIRSKNQPPRYFVNIPLPVAAALEIRG |
Ga0137365_112359351 | 3300012201 | Vadose Zone Soil | MQAEYLMKVQVIRSKGRPPRFFVNVPLPLAAALDLSAGECVQWQLLDRSD |
Ga0137362_116669472 | 3300012205 | Vadose Zone Soil | MQAEYVMKVQVIRSNRRPPRFFVNVPLPLAAALDLSAGEQ |
Ga0137380_103872182 | 3300012206 | Vadose Zone Soil | MRAEYSVKVQAIRSRKQAPRFYVNIPLPLAAALDLEA |
Ga0137387_112456901 | 3300012349 | Vadose Zone Soil | MQAKYVMKVQVIRSQRRPPRFFVNVPLPLAAALDL |
Ga0137367_107268781 | 3300012353 | Vadose Zone Soil | MQAKYPMKVQVIRTKGQAPRFYVNLPLPLSAALDLQAGETVQWQLLGRSDLR |
Ga0137366_110455372 | 3300012354 | Vadose Zone Soil | VQAEYLMKVQVIRSKKRPPRFFVNIPLPLAAALDVE |
Ga0137396_112533532 | 3300012918 | Vadose Zone Soil | MQAQYVMKVQVIRSKHRLPRFFVNVPLPLAAALDLTA |
Ga0137410_119996011 | 3300012944 | Vadose Zone Soil | MMQAGYEMKVQVIRSKGRAARVFVNIPMPLAAAMDIQ |
(restricted) Ga0172369_100451753 | 3300013125 | Freshwater | MQAEYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLT |
Ga0134079_100939802 | 3300014166 | Grasslands Soil | MQAEYPIKVQVIRARKQAARFYVNIPLPLAAALDLEPG |
Ga0075346_11571932 | 3300014306 | Natural And Restored Wetlands | MQAQYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERI |
Ga0182014_105616222 | 3300014491 | Bog | MQAEFEMKVQMIRSQGRATRLFVNVPLPLAAALDLQAGE |
Ga0182019_105175301 | 3300014498 | Fen | MQAQFEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGERVRWQL |
Ga0137409_115299481 | 3300015245 | Vadose Zone Soil | MMQAGYEMKVQVIRSKGRAARVFVNIPMPLAAAMSSA |
Ga0187856_12570332 | 3300017925 | Peatland | MQAQFEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGERVRWQLL |
Ga0187850_103049831 | 3300017941 | Peatland | MQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRARELVQWQLLGRSDLR |
Ga0187777_111089981 | 3300017974 | Tropical Peatland | MQAEYVMKVQVIRSRQRPPRFFVNIPLPLAAALDLEAGE |
Ga0187866_13506571 | 3300018015 | Peatland | MQAEYEMKVQVIRSRGRAARLFVNIPMPLAAALDLQAGE |
Ga0187882_13764491 | 3300018021 | Peatland | MQAEYEMKVQVIRSRGRAARLFVNIPMPLAAALDLQ |
Ga0187855_100677691 | 3300018038 | Peatland | MQAQFEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGERVRWQLLARSE |
Ga0187852_10273672 | 3300019082 | Peatland | MQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRA |
Ga0187852_13054992 | 3300019082 | Peatland | MQAEFQMKVQVIRSKGQATRLFVNVPLLAAALDLQA |
Ga0182022_10969471 | 3300019785 | Fen | MQAEYVMKVQVIRSQRRPPRFFVNVPLPLTAALDLAAGEQ |
Ga0194127_101047791 | 3300020221 | Freshwater Lake | MRVQVIRTKGQAPRFYVNLPIPLAAALDIQGGEQVQWQLPGRSDL |
Ga0206224_10635262 | 3300021051 | Deep Subsurface Sediment | MQAEYEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGE |
Ga0193719_102503232 | 3300021344 | Soil | MPAEYAVKVQAIRSKKQAPRFYVNIPLPLAAALDLEAGGRS |
Ga0194061_11634832 | 3300021601 | Anoxic Zone Freshwater | MQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRGR |
Ga0212088_102276601 | 3300022555 | Freshwater Lake Hypolimnion | MQAEYVMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGER |
Ga0212088_104263292 | 3300022555 | Freshwater Lake Hypolimnion | MQAEYEMKVPVIRSKDRAARLFVNIPMLLTAAMAIQAGERVRWQRLGR |
Ga0247669_10402122 | 3300024182 | Soil | MQAEYVMKVQVIRSKRQPPRFYVNIPLPLAAALDLEAGEAV |
Ga0247670_10402021 | 3300024283 | Soil | MQAEYVMKVQVIQSKNQPPRFYVNIPLPLAAALDLQAHEEV |
Ga0247690_10153902 | 3300024287 | Soil | MQAQYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLSAGE |
Ga0209642_105833321 | 3300025167 | Soil | MKVQVIRSKGVSPRFYINIPLPLAAAIDLAPGEEMQWQLL |
Ga0208046_10350341 | 3300025285 | Freshwater | LYSTAAERSQQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSD |
Ga0208588_10404111 | 3300025479 | Arctic Peat Soil | MQAKYPMKVQVIRSKGVSPRFYINIPLPLAAAIDLAPGEEMQWQLL |
Ga0207932_10129503 | 3300025495 | Arctic Peat Soil | MQAKYPMKVQVIRSKGVSPRFYINIPLPLAAAIDLAPGEEMH |
Ga0208080_10681492 | 3300025553 | Arctic Peat Soil | MQAEYEMKVQVIRSKGRATRLFVNIPLPLAAALDLQA |
Ga0209124_103374152 | 3300025852 | Arctic Peat Soil | MQAKYPMKVQVIRSKGVGPRFYINIPLPLAAAIDLAAGEQMQWQLLGPSDLRLH |
Ga0207708_119917902 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAEYVLKIQVIKSKKQPPRFYVNIPLPRAAALDLQGQEHVQWQLLG |
Ga0209802_10816653 | 3300026328 | Soil | MQAEYVMKVQAIRSKKQPPRFYVNIPLPLAAALDL |
Ga0256802_10098202 | 3300026492 | Sediment | MQAEYVMKVQVIRSKRRPPRFFVNMPLPLAAALDLAAGEEV |
Ga0208042_10235251 | 3300027568 | Peatlands Soil | MQAEFEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGER |
Ga0208324_11988151 | 3300027604 | Peatlands Soil | MQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRARELVQWQLL |
Ga0209517_101109621 | 3300027854 | Peatlands Soil | MQAEFEMKVQMIRSKGRATRLFVNVPLPLAAALDLQA |
Ga0208980_106787021 | 3300027887 | Wetland | MQAKYPMKVQVIRSKGVGPRFYINIPLPLAAAIDLAPG |
Ga0209496_100795722 | 3300027890 | Wetland | MQAKYPMKVQVIRAKGVAPRFYINIPLPLAAALDLSAGELM |
Ga0209698_103031792 | 3300027911 | Watersheds | MQAEYVMKVQVIRSQQRPPRFFVNVPLPLAAALDLTAGEAVQWQLLDRAD |
Ga0247663_10507342 | 3300028145 | Soil | MQAQYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLSAGEE |
Ga0255348_10458802 | 3300028268 | Soil | MQAQYEMKLQVIRSKGRATRLFVNIPLPLAAALDLQAGERVRWQLLG |
Ga0302157_104025932 | 3300028813 | Bog | MQAEFEMKVQMIRSTGRATRLFVNIPLPLAAALDLEAGE |
Ga0311329_109871011 | 3300029907 | Bog | MQAEFEMKVQMIRSTGRATRLFVNIPLPLAAALDLEAGERVRWQLLDRSDLRL |
Ga0311369_106748832 | 3300029910 | Palsa | MQAQYEMKMQVIRSKGRAARLFVNLPMPLAAALDIQAGERVRWQLLGRS |
Ga0311361_100713175 | 3300029911 | Bog | MQAEFEMKVQMIRSKGRATRLFVNIPLPLAAALDLEAGERV |
Ga0311362_1001214119 | 3300029913 | Bog | MQAQYEMKMQAIRSKGRASRLFVNIPLPLAAALDI |
Ga0311358_105731082 | 3300029915 | Bog | MQAQYEMKMQAIRSKGRASRLFVNIPMPLAAALDI |
Ga0302188_100452811 | 3300029986 | Bog | MQAQYEMKMQAIRSKGRASRLFVNIPLPLAAALDIQAG |
Ga0316363_100352251 | 3300030659 | Peatlands Soil | MQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRARELAQWQLLG |
Ga0316363_101610651 | 3300030659 | Peatlands Soil | MRYPYGMQAEYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLTAGEQVQWQLLDR |
Ga0311335_107414432 | 3300030838 | Fen | MQAEYEMKMQVIRSQGRASRLFVNIPMPLAAALDIQAGE |
Ga0302325_122760211 | 3300031234 | Palsa | MQAQYEMKVQMIRSKGRATRLFVNVPLPLAAALDLQAG |
Ga0265332_105017922 | 3300031238 | Rhizosphere | MQAEYEMKVQVIRSEGRAARLFVNIPMPLAAALDLQAGERIRWQLL |
Ga0265328_104628672 | 3300031239 | Rhizosphere | MQAEYEMKVQVIRSQGRAARLFVNIPMPLAAALDLQAGER |
Ga0265320_100994782 | 3300031240 | Rhizosphere | MQAEYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLAAGE |
Ga0302140_109040772 | 3300031261 | Bog | MKIQVIRSKQRQPRFLVNVPLPLAAALDLAAGEEVQ |
Ga0315288_104307451 | 3300031772 | Sediment | MQAEYVMKAQVIRSRQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSD |
Ga0307473_106005561 | 3300031820 | Hardwood Forest Soil | MQAQYEMKVQVIRSKGRATRLFVNVPLPLAAALDLQ |
Ga0302322_1032612381 | 3300031902 | Fen | MQAQYVMKVQVIKSQKQPPRFYVNIPLPLAAALDLQAGEAVQ |
Ga0315904_104624611 | 3300031951 | Freshwater | MIMQANYPMKVQVIRSKKQPPRFYVNIPLPLAAALGIEGGEEVHWQLLNRTD |
Ga0315278_102006402 | 3300031997 | Sediment | MQAEYVMRVQVIRSKGQAPRFFVNLPIPLAAALDIQAG |
Ga0315284_104280664 | 3300032053 | Sediment | MQAEYVMKAQVIRSRQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSDLRLKR |
Ga0315277_110310511 | 3300032118 | Sediment | MTLRIAEYVMKVQVINSKRRQPRFFVNIPLPLAAALDLAAGEQVQWQLLGRSD |
Ga0315277_115217591 | 3300032118 | Sediment | MKVQVIRSQQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSDLR |
Ga0315292_115023252 | 3300032143 | Sediment | MQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGEC |
Ga0311301_110199362 | 3300032160 | Peatlands Soil | MQAQYVMKVQAIRSKKQPPRFYVNIPLPLAAALDL |
Ga0311301_120133722 | 3300032160 | Peatlands Soil | MQAEYLMKVQVIRSRRRPPRFFVNVPLPLAAALDLAAGEQVQWQ |
Ga0315281_101869311 | 3300032163 | Sediment | MPAEYVMKVQVINSKRRQPRFFVNIPLPLAAALDLTAGEQVQWQLL |
Ga0315281_102567431 | 3300032163 | Sediment | MQAEYVMRVQVIRSKGQAPRFFVNLPIPLAAALDIQA |
Ga0315276_114483292 | 3300032177 | Sediment | MPPEYAQYVMKVQVIRSQRRPPRFFVNVPLPLAAALDLA |
Ga0315276_122431682 | 3300032177 | Sediment | MQAEYVMKVQVIRSQRRPPRFFVNLPLPLAAALDVQAG |
Ga0315270_100570672 | 3300032275 | Sediment | MQAKYSMKVQVIRSKGVAPRFYINIPLPLAAAIDLAAGEQMQWQLLHRSDLR |
Ga0315270_100956043 | 3300032275 | Sediment | MKVQVINSKRRQPRFFVNIPLPLAAALDWAAGEQVQWQLLGRSDLR |
Ga0315275_105794411 | 3300032401 | Sediment | MKVQVIRSQQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSDLRLK |
Ga0315275_115304753 | 3300032401 | Sediment | MQAEYVMKVQVIRSRQRQPRFFVNVPLPLAAALDLTAGEA |
Ga0315273_105239891 | 3300032516 | Sediment | MKVQVIRSRQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSDLRLKR |
Ga0315273_107725911 | 3300032516 | Sediment | MTLRIAEYVMKVQVINSKRRQPRFFVNIPLPLAAALD |
Ga0315273_119445751 | 3300032516 | Sediment | MQAEYEMKVQVIRSQGRASRLFVNIPLPLAAALDI |
Ga0315273_122528242 | 3300032516 | Sediment | MQAKYSMKVQVIRSKGVAPRFYINIPLPLAAAIDLAAGEEMQW |
Ga0315273_124563292 | 3300032516 | Sediment | MPAEYVMKVQVINSKRRQPRFFVNIPLPLAAALDLAAGEQV |
Ga0335085_118386611 | 3300032770 | Soil | MQAEYVMKVQVIRSRGRPGRFFVNVPLPLAAALDLTAGERVQWQLLDRTD |
Ga0335069_112547211 | 3300032893 | Soil | MQANYAIKVQVIRSQKQAPRFYVNIPLPLAAAVDLVAGE |
Ga0335071_116178842 | 3300032897 | Soil | MQAKYSMKVQVIRSKGVAPRFYINIPLPLAAAIDL |
Ga0326728_109956791 | 3300033402 | Peat Soil | MKVQVIRSRKQSPRFYLNIPLPLAAALELEAGEAVRWQLVNRRELR |
Ga0316622_1007550632 | 3300033416 | Soil | MQAKYVMRVQVIRSKGQAARFFVNLPIPLAAALDIQAGEEV |
Ga0316628_1026344072 | 3300033513 | Soil | MQAKYPMKVQVIRAKGVAPRFYINIPLPLAAALDLSAGELMQWQ |
Ga0316616_1009275982 | 3300033521 | Soil | MQAKYPMKVQVIRSKGVAPRYYINIPLPLAAAIDLAPGEQM |
Ga0316616_1010055791 | 3300033521 | Soil | MQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQL |
Ga0334878_002636_687_791 | 3300033780 | Soil | MQAQYEMKVQVIRSKGRATRLFVNVPLPLAAALDL |
Ga0334878_008642_438_554 | 3300033780 | Soil | MQAEYEMKVQVIRSEGRAARLFVNIPMPLAAALDLQAGE |
Ga0334821_068838_593_703 | 3300033798 | Soil | MQAEYEMKMQVIRSQGRASRLFVNIPMPLAAALDIQA |
Ga0334817_028843_993_1124 | 3300033820 | Soil | MQAEYVMKVQVIRSQRRPPRFFVNVPLPLAAALDLAAGEQVQWQ |
Ga0334840_020807_3_161 | 3300033824 | Soil | MQAQYEMKLQVIRSKGRATRLFVNIPLPLAAALDLQAGERVRWQLLGRSELRL |
Ga0334810_104652_1_156 | 3300033890 | Soil | MLMQAEYVMKVQVIRSQRRPPRFFVNVPLPLAAALDLTAGEQVQWQLLARSD |
Ga0334979_0097701_1672_1833 | 3300033996 | Freshwater | MKASYPMKVQVIRSKKQPPRFYVNLPLPLAAALGIEGGEEVHWQLLHRTELRLR |
Ga0334822_053882_752_868 | 3300034070 | Soil | MQAEYEMKVQVIRSQGRAARLFVNIPMPLAAALDLQAGE |
Ga0370479_0011350_1887_1991 | 3300034123 | Untreated Peat Soil | MQAQYVMKVQAIRSKQQPPRFYVNIPLPLAAALDL |
⦗Top⦘ |