NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F061012

Metagenome Family F061012

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061012
Family Type Metagenome
Number of Sequences 132
Average Sequence Length 42 residues
Representative Sequence MQAEYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLAAGE
Number of Associated Samples 116
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 61.83 %
% of genes near scaffold ends (potentially truncated) 99.24 %
% of genes from short scaffolds (< 2000 bps) 88.64 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.697 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(14.394 % of family members)
Environment Ontology (ENVO) Unclassified
(24.242 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(34.848 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 8.96%    β-sheet: 22.39%    Coil/Unstructured: 68.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF05598DUF772 76.52
PF13751DDE_Tnp_1_6 13.64
PF13683rve_3 1.52
PF09346SMI1_KNR4 0.76
PF13249SQHop_cyclase_N 0.76
PF13592HTH_33 0.76
PF08029HisG_C 0.76
PF13358DDE_3 0.76
PF00465Fe-ADH 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG0040ATP phosphoribosyltransferaseAmino acid transport and metabolism [E] 0.76
COG03373-dehydroquinate synthetaseAmino acid transport and metabolism [E] 0.76
COG0371Glycerol dehydrogenase or related enzyme, iron-containing ADH familyEnergy production and conversion [C] 0.76
COG1454Alcohol dehydrogenase, class IVEnergy production and conversion [C] 0.76
COG1979Alcohol dehydrogenase YqhD, Fe-dependent ADH familyEnergy production and conversion [C] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.70 %
UnclassifiedrootN/A5.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000310|WSSedA1Ba2DRAFT_1038240All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.565Open in IMG/M
3300001402|JGI20195J14853_1040545All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.632Open in IMG/M
3300001431|F14TB_107110320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.741Open in IMG/M
3300004019|Ga0055439_10326195All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300004775|Ga0007798_10029997All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300004779|Ga0062380_10105096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1053Open in IMG/M
3300005183|Ga0068993_10120668All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.859Open in IMG/M
3300005332|Ga0066388_104129596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.740Open in IMG/M
3300005434|Ga0070709_10946921All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.683Open in IMG/M
3300005602|Ga0070762_10416382All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300005830|Ga0074473_10360729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1046Open in IMG/M
3300006052|Ga0075029_100908730All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300006224|Ga0079037_102539703All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.511Open in IMG/M
3300006794|Ga0066658_10524614All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.644Open in IMG/M
3300006844|Ga0075428_101972728All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.605Open in IMG/M
3300007258|Ga0099793_10691824Not Available514Open in IMG/M
3300009082|Ga0105099_10835870All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.578Open in IMG/M
3300009087|Ga0105107_10574230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.785Open in IMG/M
3300009089|Ga0099828_11916640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.520Open in IMG/M
3300009525|Ga0116220_10282965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.728Open in IMG/M
3300010040|Ga0126308_11283004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.520Open in IMG/M
3300010379|Ga0136449_101501984All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1031Open in IMG/M
3300010379|Ga0136449_103028245All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.655Open in IMG/M
3300010403|Ga0134123_12429023All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia589Open in IMG/M
3300011397|Ga0137444_1017512All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.985Open in IMG/M
3300012199|Ga0137383_10084237All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2300Open in IMG/M
3300012200|Ga0137382_11256545All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium524Open in IMG/M
3300012201|Ga0137365_11235935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.533Open in IMG/M
3300012205|Ga0137362_11666947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.524Open in IMG/M
3300012206|Ga0137380_10387218All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1243Open in IMG/M
3300012349|Ga0137387_11245690All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.523Open in IMG/M
3300012353|Ga0137367_10726878All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300012354|Ga0137366_11045537All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.565Open in IMG/M
3300012918|Ga0137396_11253353All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.518Open in IMG/M
3300012944|Ga0137410_11999601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.515Open in IMG/M
(restricted) 3300013125|Ga0172369_10045175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.3428Open in IMG/M
3300014166|Ga0134079_10093980All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1134Open in IMG/M
3300014306|Ga0075346_1157193All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.532Open in IMG/M
3300014491|Ga0182014_10561622All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.555Open in IMG/M
3300014498|Ga0182019_10517530All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.829Open in IMG/M
3300015245|Ga0137409_11529948All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.516Open in IMG/M
3300017925|Ga0187856_1257033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.614Open in IMG/M
3300017941|Ga0187850_10304983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.705Open in IMG/M
3300017974|Ga0187777_11108998All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.576Open in IMG/M
3300018015|Ga0187866_1350657Not Available509Open in IMG/M
3300018021|Ga0187882_1376449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium539Open in IMG/M
3300018038|Ga0187855_10067769All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2188Open in IMG/M
3300019082|Ga0187852_1027367All Organisms → cellular organisms → Bacteria2786Open in IMG/M
3300019082|Ga0187852_1305499All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300019785|Ga0182022_1096947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.500Open in IMG/M
3300020221|Ga0194127_10104779All Organisms → cellular organisms → Bacteria2094Open in IMG/M
3300021051|Ga0206224_1063526Not Available513Open in IMG/M
3300021344|Ga0193719_10250323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.749Open in IMG/M
3300021601|Ga0194061_1163483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.659Open in IMG/M
3300022555|Ga0212088_10227660All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1438Open in IMG/M
3300022555|Ga0212088_10426329All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.886Open in IMG/M
3300024182|Ga0247669_1040212All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.781Open in IMG/M
3300024283|Ga0247670_1040202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.842Open in IMG/M
3300024287|Ga0247690_1015390All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.865Open in IMG/M
3300025167|Ga0209642_10583332All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.610Open in IMG/M
3300025285|Ga0208046_1035034Not Available909Open in IMG/M
3300025479|Ga0208588_1040411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.953Open in IMG/M
3300025495|Ga0207932_1012950All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2438Open in IMG/M
3300025553|Ga0208080_1068149All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.831Open in IMG/M
3300025852|Ga0209124_10337415All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.559Open in IMG/M
3300026075|Ga0207708_11991790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.508Open in IMG/M
3300026328|Ga0209802_1081665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1498Open in IMG/M
3300026492|Ga0256802_1009820All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1050Open in IMG/M
3300027568|Ga0208042_1023525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1587Open in IMG/M
3300027604|Ga0208324_1198815All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.532Open in IMG/M
3300027854|Ga0209517_10110962All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1825Open in IMG/M
3300027887|Ga0208980_10678702All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.584Open in IMG/M
3300027890|Ga0209496_10079572All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1346Open in IMG/M
3300027911|Ga0209698_10303179All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1264Open in IMG/M
3300028145|Ga0247663_1050734All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.697Open in IMG/M
3300028268|Ga0255348_1045880All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.802Open in IMG/M
3300028813|Ga0302157_10402593All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.729Open in IMG/M
3300029907|Ga0311329_10987101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.523Open in IMG/M
3300029910|Ga0311369_10674883All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.852Open in IMG/M
3300029911|Ga0311361_10071317All Organisms → cellular organisms → Bacteria5261Open in IMG/M
3300029913|Ga0311362_10012141All Organisms → cellular organisms → Bacteria15854Open in IMG/M
3300029915|Ga0311358_10573108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.859Open in IMG/M
3300029986|Ga0302188_10045281All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2099Open in IMG/M
3300030659|Ga0316363_10035225All Organisms → cellular organisms → Bacteria2513Open in IMG/M
3300030659|Ga0316363_10161065All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.956Open in IMG/M
3300030838|Ga0311335_10741443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.693Open in IMG/M
3300031234|Ga0302325_12276021All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300031238|Ga0265332_10501792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.503Open in IMG/M
3300031239|Ga0265328_10462867All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.502Open in IMG/M
3300031240|Ga0265320_10099478All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1340Open in IMG/M
3300031261|Ga0302140_10904077Not Available618Open in IMG/M
3300031772|Ga0315288_10430745All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1325Open in IMG/M
3300031820|Ga0307473_10600556All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.760Open in IMG/M
3300031902|Ga0302322_103261238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.557Open in IMG/M
3300031951|Ga0315904_10462461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1130Open in IMG/M
3300031997|Ga0315278_10200640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2052Open in IMG/M
3300032118|Ga0315277_11031051Not Available748Open in IMG/M
3300032118|Ga0315277_11521759All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.571Open in IMG/M
3300032143|Ga0315292_11502325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.545Open in IMG/M
3300032160|Ga0311301_11019936All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1091Open in IMG/M
3300032160|Ga0311301_12013372All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300032163|Ga0315281_10186931All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2319Open in IMG/M
3300032163|Ga0315281_10256743All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1925Open in IMG/M
3300032177|Ga0315276_11448329All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.716Open in IMG/M
3300032177|Ga0315276_12243168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.552Open in IMG/M
3300032275|Ga0315270_10057067All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2206Open in IMG/M
3300032275|Ga0315270_10095604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1733Open in IMG/M
3300032401|Ga0315275_10579441All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1254Open in IMG/M
3300032401|Ga0315275_11530475All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.715Open in IMG/M
3300032516|Ga0315273_10523989All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1583Open in IMG/M
3300032516|Ga0315273_10772591All Organisms → cellular organisms → Bacteria1254Open in IMG/M
3300032516|Ga0315273_11944575All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.701Open in IMG/M
3300032516|Ga0315273_12252824All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.637Open in IMG/M
3300032516|Ga0315273_12456329All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.602Open in IMG/M
3300032770|Ga0335085_11838661All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.619Open in IMG/M
3300032893|Ga0335069_11254721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.809Open in IMG/M
3300032897|Ga0335071_11617884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.592Open in IMG/M
3300033402|Ga0326728_10995679All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.581Open in IMG/M
3300033416|Ga0316622_100755063All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1128Open in IMG/M
3300033513|Ga0316628_102634407All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.663Open in IMG/M
3300033521|Ga0316616_100927598All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1077Open in IMG/M
3300033521|Ga0316616_101005579All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1041Open in IMG/M
3300033780|Ga0334878_002636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.791Open in IMG/M
3300033780|Ga0334878_008642All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.555Open in IMG/M
3300033798|Ga0334821_068838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.703Open in IMG/M
3300033820|Ga0334817_028843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1125Open in IMG/M
3300033824|Ga0334840_020807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2149Open in IMG/M
3300033890|Ga0334810_104652All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300033996|Ga0334979_0097701All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1833Open in IMG/M
3300034070|Ga0334822_053882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.870Open in IMG/M
3300034123|Ga0370479_0011350All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1991Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment14.39%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.58%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil6.06%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.30%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.30%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.30%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.03%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.27%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.52%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion1.52%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.52%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.52%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.52%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.52%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.52%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.52%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.76%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.76%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.76%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.76%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.76%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.76%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.76%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.76%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.76%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.76%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.76%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.76%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.76%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.76%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000310Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300001402Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012EnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004775Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17MEnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011397Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013125 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25mEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014306Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300021051Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021601Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-21mEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024287Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025285Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300m (SPAdes)EnvironmentalOpen in IMG/M
3300025479Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025495Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025553Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026492Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS5EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033780Peat soil microbial communities from Stordalen Mire, Sweden - 715 E3 1-5EnvironmentalOpen in IMG/M
3300033798Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-SEnvironmentalOpen in IMG/M
3300033820Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-DEnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300033890Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-MEnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034070Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-MEnvironmentalOpen in IMG/M
3300034123Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
WSSedA1Ba2DRAFT_103824023300000310WetlandMQAEYEMKVQVIRSQGRAARLFVNIPMPLAAALDLQA
JGI20195J14853_104054513300001402Arctic Peat SoilMQAKYPMKVQVIRSKGVGPRFYINIPLPLAAAIDLAAGEQMQWQLRGRSEL
F14TB_10711032013300001431SoilMQAEYVMKVQVIKAKNVPPRFYVNIPLPLAAALDLAGGEAVQW
Ga0055439_1032619513300004019Natural And Restored WetlandsMQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLQASEPVQWQLLGRSDLR
Ga0007798_1002999733300004775FreshwaterMQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRGREPVQW
Ga0062380_1010509613300004779Wetland SedimentMQAEYVMKVQVIKAKNVAPRFYVNIPLPLAASLDLQAGEAVQ
Ga0068993_1012066823300005183Natural And Restored WetlandsMQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLQASEPV
Ga0066388_10412959623300005332Tropical Forest SoilVLFEMKLQVIRSKGRAQRLFVNVPLALAGALDMKPGERLRW
Ga0070709_1094692123300005434Corn, Switchgrass And Miscanthus RhizosphereMQAQYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLSAGEEV
Ga0070762_1041638223300005602SoilMPAEYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLTAGERVQWQLLD
Ga0074473_1036072913300005830Sediment (Intertidal)MQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQ
Ga0075029_10090873013300006052WatershedsMQAQYEVKMQVIRSKGRATRLFVNIPMPLAAALDIQA
Ga0079037_10253970323300006224Freshwater WetlandsMQAKDPMKVQVIRAKGVAPRFYINIPLPLAAALDLSAGELM
Ga0066658_1052461423300006794SoilMQAQFEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGERVRWQLLARSDL
Ga0075428_10197272823300006844Populus RhizosphereMQAEYVMKVQVIKAKNVPPRFYVNIPLPLAAALDLEGG
Ga0099793_1069182423300007258Vadose Zone SoilMQAEYVMKVQVIRSKRRQPRFFVNVPLPLAAALDLA
Ga0105099_1083587013300009082Freshwater SedimentMQAEYVMKVQVIRSQKQPPRFYVNIPLPLAAALDLEAGEQ
Ga0105107_1057423023300009087Freshwater SedimentMQAKYPMKVQVIRSKGVAPRFYINIPLPLAAAIDLSAGEQMQ
Ga0099828_1191664013300009089Vadose Zone SoilMQAEYVMKVQVIRSKRRPPRFFVNMPLPLAAALDLEAGE
Ga0116220_1028296523300009525Peatlands SoilMQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRAR
Ga0126308_1128300423300010040Serpentine SoilMQAEYVMRVQVIKSKKQPPCFYVNIPLPLAAALDLQASEE
Ga0136449_10150198413300010379Peatlands SoilMQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRAREL
Ga0136449_10302824523300010379Peatlands SoilMQAQYVMKIQAIRSKKQPPRFYVNIPLPLAAALDLGAG
Ga0134123_1242902313300010403Terrestrial SoilMKGVGKGSEYEIKVQAIRSKKQAPRFYVNIPLPLAAALDLEAG
Ga0137444_101751223300011397SoilMQAEYVMRVQVIKSKKQPPRFYVNIPLPLAAALDLQASEE
Ga0137383_1008423713300012199Vadose Zone SoilMQAEFEMKVQVIRSKGRATRLFVNIPLPLAAALDLQAGERVR
Ga0137382_1125654513300012200Vadose Zone SoilMQAQYPMKVQVIRSKNQPPRYFVNIPLPVAAALEIRG
Ga0137365_1123593513300012201Vadose Zone SoilMQAEYLMKVQVIRSKGRPPRFFVNVPLPLAAALDLSAGECVQWQLLDRSD
Ga0137362_1166694723300012205Vadose Zone SoilMQAEYVMKVQVIRSNRRPPRFFVNVPLPLAAALDLSAGEQ
Ga0137380_1038721823300012206Vadose Zone SoilMRAEYSVKVQAIRSRKQAPRFYVNIPLPLAAALDLEA
Ga0137387_1124569013300012349Vadose Zone SoilMQAKYVMKVQVIRSQRRPPRFFVNVPLPLAAALDL
Ga0137367_1072687813300012353Vadose Zone SoilMQAKYPMKVQVIRTKGQAPRFYVNLPLPLSAALDLQAGETVQWQLLGRSDLR
Ga0137366_1104553723300012354Vadose Zone SoilVQAEYLMKVQVIRSKKRPPRFFVNIPLPLAAALDVE
Ga0137396_1125335323300012918Vadose Zone SoilMQAQYVMKVQVIRSKHRLPRFFVNVPLPLAAALDLTA
Ga0137410_1199960113300012944Vadose Zone SoilMMQAGYEMKVQVIRSKGRAARVFVNIPMPLAAAMDIQ
(restricted) Ga0172369_1004517533300013125FreshwaterMQAEYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLT
Ga0134079_1009398023300014166Grasslands SoilMQAEYPIKVQVIRARKQAARFYVNIPLPLAAALDLEPG
Ga0075346_115719323300014306Natural And Restored WetlandsMQAQYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERI
Ga0182014_1056162223300014491BogMQAEFEMKVQMIRSQGRATRLFVNVPLPLAAALDLQAGE
Ga0182019_1051753013300014498FenMQAQFEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGERVRWQL
Ga0137409_1152994813300015245Vadose Zone SoilMMQAGYEMKVQVIRSKGRAARVFVNIPMPLAAAMSSA
Ga0187856_125703323300017925PeatlandMQAQFEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGERVRWQLL
Ga0187850_1030498313300017941PeatlandMQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRARELVQWQLLGRSDLR
Ga0187777_1110899813300017974Tropical PeatlandMQAEYVMKVQVIRSRQRPPRFFVNIPLPLAAALDLEAGE
Ga0187866_135065713300018015PeatlandMQAEYEMKVQVIRSRGRAARLFVNIPMPLAAALDLQAGE
Ga0187882_137644913300018021PeatlandMQAEYEMKVQVIRSRGRAARLFVNIPMPLAAALDLQ
Ga0187855_1006776913300018038PeatlandMQAQFEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGERVRWQLLARSE
Ga0187852_102736723300019082PeatlandMQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRA
Ga0187852_130549923300019082PeatlandMQAEFQMKVQVIRSKGQATRLFVNVPLLAAALDLQA
Ga0182022_109694713300019785FenMQAEYVMKVQVIRSQRRPPRFFVNVPLPLTAALDLAAGEQ
Ga0194127_1010477913300020221Freshwater LakeMRVQVIRTKGQAPRFYVNLPIPLAAALDIQGGEQVQWQLPGRSDL
Ga0206224_106352623300021051Deep Subsurface SedimentMQAEYEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGE
Ga0193719_1025032323300021344SoilMPAEYAVKVQAIRSKKQAPRFYVNIPLPLAAALDLEAGGRS
Ga0194061_116348323300021601Anoxic Zone FreshwaterMQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRGR
Ga0212088_1022766013300022555Freshwater Lake HypolimnionMQAEYVMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGER
Ga0212088_1042632923300022555Freshwater Lake HypolimnionMQAEYEMKVPVIRSKDRAARLFVNIPMLLTAAMAIQAGERVRWQRLGR
Ga0247669_104021223300024182SoilMQAEYVMKVQVIRSKRQPPRFYVNIPLPLAAALDLEAGEAV
Ga0247670_104020213300024283SoilMQAEYVMKVQVIQSKNQPPRFYVNIPLPLAAALDLQAHEEV
Ga0247690_101539023300024287SoilMQAQYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLSAGE
Ga0209642_1058333213300025167SoilMKVQVIRSKGVSPRFYINIPLPLAAAIDLAPGEEMQWQLL
Ga0208046_103503413300025285FreshwaterLYSTAAERSQQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSD
Ga0208588_104041113300025479Arctic Peat SoilMQAKYPMKVQVIRSKGVSPRFYINIPLPLAAAIDLAPGEEMQWQLL
Ga0207932_101295033300025495Arctic Peat SoilMQAKYPMKVQVIRSKGVSPRFYINIPLPLAAAIDLAPGEEMH
Ga0208080_106814923300025553Arctic Peat SoilMQAEYEMKVQVIRSKGRATRLFVNIPLPLAAALDLQA
Ga0209124_1033741523300025852Arctic Peat SoilMQAKYPMKVQVIRSKGVGPRFYINIPLPLAAAIDLAAGEQMQWQLLGPSDLRLH
Ga0207708_1199179023300026075Corn, Switchgrass And Miscanthus RhizosphereMQAEYVLKIQVIKSKKQPPRFYVNIPLPRAAALDLQGQEHVQWQLLG
Ga0209802_108166533300026328SoilMQAEYVMKVQAIRSKKQPPRFYVNIPLPLAAALDL
Ga0256802_100982023300026492SedimentMQAEYVMKVQVIRSKRRPPRFFVNMPLPLAAALDLAAGEEV
Ga0208042_102352513300027568Peatlands SoilMQAEFEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGER
Ga0208324_119881513300027604Peatlands SoilMQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRARELVQWQLL
Ga0209517_1011096213300027854Peatlands SoilMQAEFEMKVQMIRSKGRATRLFVNVPLPLAAALDLQA
Ga0208980_1067870213300027887WetlandMQAKYPMKVQVIRSKGVGPRFYINIPLPLAAAIDLAPG
Ga0209496_1007957223300027890WetlandMQAKYPMKVQVIRAKGVAPRFYINIPLPLAAALDLSAGELM
Ga0209698_1030317923300027911WatershedsMQAEYVMKVQVIRSQQRPPRFFVNVPLPLAAALDLTAGEAVQWQLLDRAD
Ga0247663_105073423300028145SoilMQAQYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLSAGEE
Ga0255348_104588023300028268SoilMQAQYEMKLQVIRSKGRATRLFVNIPLPLAAALDLQAGERVRWQLLG
Ga0302157_1040259323300028813BogMQAEFEMKVQMIRSTGRATRLFVNIPLPLAAALDLEAGE
Ga0311329_1098710113300029907BogMQAEFEMKVQMIRSTGRATRLFVNIPLPLAAALDLEAGERVRWQLLDRSDLRL
Ga0311369_1067488323300029910PalsaMQAQYEMKMQVIRSKGRAARLFVNLPMPLAAALDIQAGERVRWQLLGRS
Ga0311361_1007131753300029911BogMQAEFEMKVQMIRSKGRATRLFVNIPLPLAAALDLEAGERV
Ga0311362_10012141193300029913BogMQAQYEMKMQAIRSKGRASRLFVNIPLPLAAALDI
Ga0311358_1057310823300029915BogMQAQYEMKMQAIRSKGRASRLFVNIPMPLAAALDI
Ga0302188_1004528113300029986BogMQAQYEMKMQAIRSKGRASRLFVNIPLPLAAALDIQAG
Ga0316363_1003522513300030659Peatlands SoilMQAEYVMKVQVIKSRKQPPRFYVNIPLPLAAALDLRARELAQWQLLG
Ga0316363_1016106513300030659Peatlands SoilMRYPYGMQAEYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLTAGEQVQWQLLDR
Ga0311335_1074144323300030838FenMQAEYEMKMQVIRSQGRASRLFVNIPMPLAAALDIQAGE
Ga0302325_1227602113300031234PalsaMQAQYEMKVQMIRSKGRATRLFVNVPLPLAAALDLQAG
Ga0265332_1050179223300031238RhizosphereMQAEYEMKVQVIRSEGRAARLFVNIPMPLAAALDLQAGERIRWQLL
Ga0265328_1046286723300031239RhizosphereMQAEYEMKVQVIRSQGRAARLFVNIPMPLAAALDLQAGER
Ga0265320_1009947823300031240RhizosphereMQAEYVMKVQVIRSKRRPPRFFVNVPLPLAAALDLAAGE
Ga0302140_1090407723300031261BogMKIQVIRSKQRQPRFLVNVPLPLAAALDLAAGEEVQ
Ga0315288_1043074513300031772SedimentMQAEYVMKAQVIRSRQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSD
Ga0307473_1060055613300031820Hardwood Forest SoilMQAQYEMKVQVIRSKGRATRLFVNVPLPLAAALDLQ
Ga0302322_10326123813300031902FenMQAQYVMKVQVIKSQKQPPRFYVNIPLPLAAALDLQAGEAVQ
Ga0315904_1046246113300031951FreshwaterMIMQANYPMKVQVIRSKKQPPRFYVNIPLPLAAALGIEGGEEVHWQLLNRTD
Ga0315278_1020064023300031997SedimentMQAEYVMRVQVIRSKGQAPRFFVNLPIPLAAALDIQAG
Ga0315284_1042806643300032053SedimentMQAEYVMKAQVIRSRQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSDLRLKR
Ga0315277_1103105113300032118SedimentMTLRIAEYVMKVQVINSKRRQPRFFVNIPLPLAAALDLAAGEQVQWQLLGRSD
Ga0315277_1152175913300032118SedimentMKVQVIRSQQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSDLR
Ga0315292_1150232523300032143SedimentMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGEC
Ga0311301_1101993623300032160Peatlands SoilMQAQYVMKVQAIRSKKQPPRFYVNIPLPLAAALDL
Ga0311301_1201337223300032160Peatlands SoilMQAEYLMKVQVIRSRRRPPRFFVNVPLPLAAALDLAAGEQVQWQ
Ga0315281_1018693113300032163SedimentMPAEYVMKVQVINSKRRQPRFFVNIPLPLAAALDLTAGEQVQWQLL
Ga0315281_1025674313300032163SedimentMQAEYVMRVQVIRSKGQAPRFFVNLPIPLAAALDIQA
Ga0315276_1144832923300032177SedimentMPPEYAQYVMKVQVIRSQRRPPRFFVNVPLPLAAALDLA
Ga0315276_1224316823300032177SedimentMQAEYVMKVQVIRSQRRPPRFFVNLPLPLAAALDVQAG
Ga0315270_1005706723300032275SedimentMQAKYSMKVQVIRSKGVAPRFYINIPLPLAAAIDLAAGEQMQWQLLHRSDLR
Ga0315270_1009560433300032275SedimentMKVQVINSKRRQPRFFVNIPLPLAAALDWAAGEQVQWQLLGRSDLR
Ga0315275_1057944113300032401SedimentMKVQVIRSQQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSDLRLK
Ga0315275_1153047533300032401SedimentMQAEYVMKVQVIRSRQRQPRFFVNVPLPLAAALDLTAGEA
Ga0315273_1052398913300032516SedimentMKVQVIRSRQRQPRFFVNVPLPLAAALDLTAGEAVQWQLLDRSDLRLKR
Ga0315273_1077259113300032516SedimentMTLRIAEYVMKVQVINSKRRQPRFFVNIPLPLAAALD
Ga0315273_1194457513300032516SedimentMQAEYEMKVQVIRSQGRASRLFVNIPLPLAAALDI
Ga0315273_1225282423300032516SedimentMQAKYSMKVQVIRSKGVAPRFYINIPLPLAAAIDLAAGEEMQW
Ga0315273_1245632923300032516SedimentMPAEYVMKVQVINSKRRQPRFFVNIPLPLAAALDLAAGEQV
Ga0335085_1183866113300032770SoilMQAEYVMKVQVIRSRGRPGRFFVNVPLPLAAALDLTAGERVQWQLLDRTD
Ga0335069_1125472113300032893SoilMQANYAIKVQVIRSQKQAPRFYVNIPLPLAAAVDLVAGE
Ga0335071_1161788423300032897SoilMQAKYSMKVQVIRSKGVAPRFYINIPLPLAAAIDL
Ga0326728_1099567913300033402Peat SoilMKVQVIRSRKQSPRFYLNIPLPLAAALELEAGEAVRWQLVNRRELR
Ga0316622_10075506323300033416SoilMQAKYVMRVQVIRSKGQAARFFVNLPIPLAAALDIQAGEEV
Ga0316628_10263440723300033513SoilMQAKYPMKVQVIRAKGVAPRFYINIPLPLAAALDLSAGELMQWQ
Ga0316616_10092759823300033521SoilMQAKYPMKVQVIRSKGVAPRYYINIPLPLAAAIDLAPGEQM
Ga0316616_10100557913300033521SoilMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQL
Ga0334878_002636_687_7913300033780SoilMQAQYEMKVQVIRSKGRATRLFVNVPLPLAAALDL
Ga0334878_008642_438_5543300033780SoilMQAEYEMKVQVIRSEGRAARLFVNIPMPLAAALDLQAGE
Ga0334821_068838_593_7033300033798SoilMQAEYEMKMQVIRSQGRASRLFVNIPMPLAAALDIQA
Ga0334817_028843_993_11243300033820SoilMQAEYVMKVQVIRSQRRPPRFFVNVPLPLAAALDLAAGEQVQWQ
Ga0334840_020807_3_1613300033824SoilMQAQYEMKLQVIRSKGRATRLFVNIPLPLAAALDLQAGERVRWQLLGRSELRL
Ga0334810_104652_1_1563300033890SoilMLMQAEYVMKVQVIRSQRRPPRFFVNVPLPLAAALDLTAGEQVQWQLLARSD
Ga0334979_0097701_1672_18333300033996FreshwaterMKASYPMKVQVIRSKKQPPRFYVNLPLPLAAALGIEGGEEVHWQLLHRTELRLR
Ga0334822_053882_752_8683300034070SoilMQAEYEMKVQVIRSQGRAARLFVNIPMPLAAALDLQAGE
Ga0370479_0011350_1887_19913300034123Untreated Peat SoilMQAQYVMKVQAIRSKQQPPRFYVNIPLPLAAALDL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.