| Basic Information | |
|---|---|
| Family ID | F060887 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAA |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 32.82 % |
| % of genes near scaffold ends (potentially truncated) | 99.24 % |
| % of genes from short scaffolds (< 2000 bps) | 96.97 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.212 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.091 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.303 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 56.76% β-sheet: 0.00% Coil/Unstructured: 43.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF00420 | Oxidored_q2 | 68.94 |
| PF00499 | Oxidored_q3 | 18.94 |
| PF00037 | Fer4 | 5.30 |
| PF00146 | NADHdh | 3.79 |
| PF04085 | MreC | 0.76 |
| PF10589 | NADH_4Fe-4S | 0.76 |
| PF00491 | Arginase | 0.76 |
| PF12838 | Fer4_7 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 18.94 |
| COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 3.79 |
| COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 3.79 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.76 |
| COG1792 | Cell shape-determining protein MreC | Cell cycle control, cell division, chromosome partitioning [D] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.18 % |
| Unclassified | root | N/A | 31.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig155196 | Not Available | 547 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1033429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 743 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1033528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
| 3300001686|C688J18823_10599492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 703 | Open in IMG/M |
| 3300002568|C688J35102_120188382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 918 | Open in IMG/M |
| 3300004157|Ga0062590_100918120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300004643|Ga0062591_102436801 | Not Available | 549 | Open in IMG/M |
| 3300005179|Ga0066684_10483543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 832 | Open in IMG/M |
| 3300005355|Ga0070671_100252642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1498 | Open in IMG/M |
| 3300005440|Ga0070705_100666956 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300005457|Ga0070662_100146304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1836 | Open in IMG/M |
| 3300005536|Ga0070697_100849197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 809 | Open in IMG/M |
| 3300005546|Ga0070696_101454505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 585 | Open in IMG/M |
| 3300005556|Ga0066707_10820949 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005561|Ga0066699_10353685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1050 | Open in IMG/M |
| 3300005578|Ga0068854_101744389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300005844|Ga0068862_100164634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1981 | Open in IMG/M |
| 3300005937|Ga0081455_10849035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300006046|Ga0066652_100551118 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300006573|Ga0074055_11764975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 765 | Open in IMG/M |
| 3300006605|Ga0074057_12093699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 683 | Open in IMG/M |
| 3300006847|Ga0075431_100491245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1219 | Open in IMG/M |
| 3300006871|Ga0075434_100862498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300006894|Ga0079215_10304512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300009012|Ga0066710_103421092 | Not Available | 602 | Open in IMG/M |
| 3300009101|Ga0105247_10562879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 840 | Open in IMG/M |
| 3300009137|Ga0066709_100913175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1280 | Open in IMG/M |
| 3300009148|Ga0105243_10946297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 860 | Open in IMG/M |
| 3300009148|Ga0105243_12592686 | Not Available | 547 | Open in IMG/M |
| 3300009156|Ga0111538_10740906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1245 | Open in IMG/M |
| 3300009162|Ga0075423_10490949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1291 | Open in IMG/M |
| 3300009162|Ga0075423_12639656 | Not Available | 549 | Open in IMG/M |
| 3300009792|Ga0126374_10131422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1483 | Open in IMG/M |
| 3300010301|Ga0134070_10406981 | Not Available | 537 | Open in IMG/M |
| 3300010321|Ga0134067_10188407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 753 | Open in IMG/M |
| 3300010335|Ga0134063_10226119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 886 | Open in IMG/M |
| 3300010337|Ga0134062_10766997 | Not Available | 513 | Open in IMG/M |
| 3300010359|Ga0126376_12686684 | Not Available | 547 | Open in IMG/M |
| 3300010360|Ga0126372_11516641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 707 | Open in IMG/M |
| 3300010397|Ga0134124_12024435 | Not Available | 613 | Open in IMG/M |
| 3300010397|Ga0134124_12552235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300010400|Ga0134122_10410831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1198 | Open in IMG/M |
| 3300010401|Ga0134121_12734413 | Not Available | 539 | Open in IMG/M |
| 3300011119|Ga0105246_11171979 | Not Available | 706 | Open in IMG/M |
| 3300012200|Ga0137382_10418068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 946 | Open in IMG/M |
| 3300012200|Ga0137382_10995956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 602 | Open in IMG/M |
| 3300012355|Ga0137369_10352929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1074 | Open in IMG/M |
| 3300012359|Ga0137385_11631273 | Not Available | 509 | Open in IMG/M |
| 3300012532|Ga0137373_10809417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 692 | Open in IMG/M |
| 3300012681|Ga0136613_10081367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1855 | Open in IMG/M |
| 3300012897|Ga0157285_10198764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 629 | Open in IMG/M |
| 3300012898|Ga0157293_10209811 | Not Available | 592 | Open in IMG/M |
| 3300012899|Ga0157299_10186614 | Not Available | 614 | Open in IMG/M |
| 3300012901|Ga0157288_10329834 | Not Available | 545 | Open in IMG/M |
| 3300012907|Ga0157283_10021239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1233 | Open in IMG/M |
| 3300012914|Ga0157297_10180269 | Not Available | 714 | Open in IMG/M |
| 3300012916|Ga0157310_10498214 | Not Available | 529 | Open in IMG/M |
| 3300012948|Ga0126375_11042262 | Not Available | 669 | Open in IMG/M |
| 3300012988|Ga0164306_11170712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 643 | Open in IMG/M |
| 3300013297|Ga0157378_10807765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 964 | Open in IMG/M |
| 3300013770|Ga0120123_1160285 | Not Available | 537 | Open in IMG/M |
| 3300014166|Ga0134079_10119715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1029 | Open in IMG/M |
| 3300014166|Ga0134079_10192310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 851 | Open in IMG/M |
| 3300014745|Ga0157377_10285032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1084 | Open in IMG/M |
| 3300015372|Ga0132256_102785289 | Not Available | 587 | Open in IMG/M |
| 3300015373|Ga0132257_104015656 | Not Available | 535 | Open in IMG/M |
| 3300017947|Ga0187785_10645563 | Not Available | 549 | Open in IMG/M |
| 3300018431|Ga0066655_10213225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1204 | Open in IMG/M |
| 3300018431|Ga0066655_10989874 | Not Available | 580 | Open in IMG/M |
| 3300018468|Ga0066662_11830901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
| 3300018482|Ga0066669_10461370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1093 | Open in IMG/M |
| 3300021344|Ga0193719_10384390 | Not Available | 580 | Open in IMG/M |
| 3300021951|Ga0222624_1141932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 777 | Open in IMG/M |
| 3300023057|Ga0247797_1000657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2873 | Open in IMG/M |
| 3300023066|Ga0247793_1053106 | Not Available | 651 | Open in IMG/M |
| 3300023261|Ga0247796_1034302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 839 | Open in IMG/M |
| 3300025901|Ga0207688_10675257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 653 | Open in IMG/M |
| 3300025901|Ga0207688_11036317 | Not Available | 518 | Open in IMG/M |
| 3300025905|Ga0207685_10848387 | Not Available | 506 | Open in IMG/M |
| 3300025906|Ga0207699_10984627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 623 | Open in IMG/M |
| 3300025910|Ga0207684_10738799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
| 3300025917|Ga0207660_10660676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 852 | Open in IMG/M |
| 3300025920|Ga0207649_10696660 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300025922|Ga0207646_10166470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1990 | Open in IMG/M |
| 3300025926|Ga0207659_11582714 | Not Available | 560 | Open in IMG/M |
| 3300025928|Ga0207700_11634882 | Not Available | 569 | Open in IMG/M |
| 3300025929|Ga0207664_10251376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1543 | Open in IMG/M |
| 3300025933|Ga0207706_10649954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 903 | Open in IMG/M |
| 3300025934|Ga0207686_11614446 | Not Available | 536 | Open in IMG/M |
| 3300025937|Ga0207669_10133547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1710 | Open in IMG/M |
| 3300025942|Ga0207689_10492168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1027 | Open in IMG/M |
| 3300025960|Ga0207651_11870994 | Not Available | 540 | Open in IMG/M |
| 3300025961|Ga0207712_10666656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 905 | Open in IMG/M |
| 3300026023|Ga0207677_10269347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1392 | Open in IMG/M |
| 3300026342|Ga0209057_1111968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1055 | Open in IMG/M |
| 3300026538|Ga0209056_10280981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1163 | Open in IMG/M |
| 3300026542|Ga0209805_1279976 | Not Available | 637 | Open in IMG/M |
| 3300026547|Ga0209156_10391637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 584 | Open in IMG/M |
| 3300026552|Ga0209577_10325313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1140 | Open in IMG/M |
| 3300026789|Ga0207513_100499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 736 | Open in IMG/M |
| 3300026812|Ga0207518_104221 | Not Available | 545 | Open in IMG/M |
| 3300027378|Ga0209981_1076611 | Not Available | 519 | Open in IMG/M |
| 3300027775|Ga0209177_10416863 | Not Available | 542 | Open in IMG/M |
| 3300028065|Ga0247685_1004535 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300028715|Ga0307313_10254563 | Not Available | 546 | Open in IMG/M |
| 3300028717|Ga0307298_10063047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1026 | Open in IMG/M |
| 3300028768|Ga0307280_10209575 | Not Available | 691 | Open in IMG/M |
| 3300028768|Ga0307280_10312144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 575 | Open in IMG/M |
| 3300028784|Ga0307282_10597284 | Not Available | 535 | Open in IMG/M |
| 3300028791|Ga0307290_10220214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 695 | Open in IMG/M |
| 3300028793|Ga0307299_10123891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 970 | Open in IMG/M |
| 3300028799|Ga0307284_10070422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1266 | Open in IMG/M |
| 3300028807|Ga0307305_10137712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1127 | Open in IMG/M |
| 3300028814|Ga0307302_10236486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 894 | Open in IMG/M |
| 3300028819|Ga0307296_10363833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 790 | Open in IMG/M |
| 3300028828|Ga0307312_10019746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3826 | Open in IMG/M |
| 3300028828|Ga0307312_10086819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1921 | Open in IMG/M |
| 3300028828|Ga0307312_10322873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1007 | Open in IMG/M |
| 3300028875|Ga0307289_10071127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1404 | Open in IMG/M |
| 3300028885|Ga0307304_10037881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1731 | Open in IMG/M |
| 3300028885|Ga0307304_10551261 | Not Available | 531 | Open in IMG/M |
| 3300031152|Ga0307501_10112060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 702 | Open in IMG/M |
| 3300031892|Ga0310893_10566101 | Not Available | 516 | Open in IMG/M |
| 3300031938|Ga0308175_100574828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1209 | Open in IMG/M |
| 3300031944|Ga0310884_10774270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 585 | Open in IMG/M |
| 3300032003|Ga0310897_10087752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1211 | Open in IMG/M |
| 3300032012|Ga0310902_10496477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 795 | Open in IMG/M |
| 3300032783|Ga0335079_11741284 | Not Available | 608 | Open in IMG/M |
| 3300032828|Ga0335080_10037081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 5353 | Open in IMG/M |
| 3300034819|Ga0373958_0017513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1289 | Open in IMG/M |
| 3300034819|Ga0373958_0096420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.76% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.76% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.76% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.76% | |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026789 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A2a-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026812 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_01120890 | 2124908016 | LIAAGWICLFAPLGAAIAITLAGQRLSRRGAGYVATTSVAFSFVAALVSFAG | |
| AP72_2010_repI_A01DRAFT_10334291 | 3300000579 | Forest Soil | VIVAAWICLVAPLAAAVAITLLGQSLSRRGAGYLATSS |
| AP72_2010_repI_A100DRAFT_10335281 | 3300000837 | Forest Soil | VIVAAWICLVTPLAAALLITLLGNSISRRVSGYVATA |
| C688J18823_105994921 | 3300001686 | Soil | LIAAAWICLFAPLGAALAITLAGRRLTRRGAGYLATASVGVSFAAA |
| C688J35102_1201883821 | 3300002568 | Soil | VNAAAWICLLTPLAAAIAITLGGTRLSRRGAGYVSTLSTMVSFAA |
| Ga0062590_1009181203 | 3300004157 | Soil | VIVAAWTCLFAPLGAALAITLAGNRITRRGAGYLATSSVGVSFVAAVIAFFELLG |
| Ga0062591_1024368011 | 3300004643 | Soil | VIVAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTAVGASFVA |
| Ga0066684_104835433 | 3300005179 | Soil | MSPGEPPVIVAAWICLVAPLAATLAITLLGQSLSRRAAAYVASAS |
| Ga0070671_1002526424 | 3300005355 | Switchgrass Rhizosphere | MIAAAWTCLISPLVATGLITVGGNRLSRRGAGFLATFSVLVSLIAAVV |
| Ga0070705_1006669561 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LIAAGWICLFAPLGAAIAITLAGQRLSRRGAGYVATTSVAISFVAALVSFAGLLGDQPS |
| Ga0070662_1001463045 | 3300005457 | Corn Rhizosphere | VITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVSFIG |
| Ga0070697_1008491973 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYVATTSVAFSFIAALVSFAGLLGDSP |
| Ga0070696_1014545053 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAAAWICLISPLVATALITASGNRLSRRGAGFLATFSVFVSFVA |
| Ga0066707_108209493 | 3300005556 | Soil | MIIGAWLCLVSPLAAAALITLGGNRLSRRGAGYLATL |
| Ga0066699_103536851 | 3300005561 | Soil | LIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYLATTSVGMSFVAALVSFAGLLGDS |
| Ga0068854_1017443892 | 3300005578 | Corn Rhizosphere | VITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVSFIGLLGDSPDDRSHPSTLWRWLTAGPYHFDLRI |
| Ga0068862_1001646341 | 3300005844 | Switchgrass Rhizosphere | MIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVA |
| Ga0081455_108490352 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIAAAWICLLTPLGAALLITLCGTRLSRRGAGYLATLSVAVSFVAAVVTFVALLGDSPAKRYHPSTLWQWL |
| Ga0066652_1005511181 | 3300006046 | Soil | LIPAAWICLFSPLAAALVITLWGTRLSRRGAGYIATLSVGVSFVAALVTFALLLGDK |
| Ga0074055_117649753 | 3300006573 | Soil | LTIAAWICLFAPLGATLLITLAGERLSRRGAGYLATASVG |
| Ga0074057_120936991 | 3300006605 | Soil | LTVAAWICLFAPLGATLLITLAGERLSRRGAGYLATASVGVSFVAALVTFVLLLGDS |
| Ga0075431_1004912451 | 3300006847 | Populus Rhizosphere | MIVAAWICLLTPLGAALLITLCGSRLSRRGAGYLATLSVAVSFVAAVVSFVAL |
| Ga0075434_1008624981 | 3300006871 | Populus Rhizosphere | VIVAAWICLFAPLGAALAITLAGNRITRRGAGYLATFSVGVSFVSAVVAFFELLGDSPEHRYHPS |
| Ga0079215_103045121 | 3300006894 | Agricultural Soil | LTAAAWICLFAPLAAATLITLLGNVQSRRTAGYIATASTVISFAAAVVAFLQ |
| Ga0066710_1034210921 | 3300009012 | Grasslands Soil | MTVAIYGAWICLLSPLAAAGLITLAGGRISRRGAGYLA |
| Ga0105247_105628791 | 3300009101 | Switchgrass Rhizosphere | MIVAAWICLISPLAAAFLITLAANRLSRRGAGYLATLSVAVSFVAAIVSFAGLLGDSPNHRYHPSTLWNWLT |
| Ga0066709_1009131754 | 3300009137 | Grasslands Soil | LIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYLATTSVGMSFVAALVSFAG |
| Ga0105243_109462973 | 3300009148 | Miscanthus Rhizosphere | VIVAAWICLVAPLVAALLITLLGNSISRRVAGYVATP |
| Ga0105243_125926861 | 3300009148 | Miscanthus Rhizosphere | MIAAAWICLISPLAATALIALAGNRLTRRGAGYLSTLSVAVSFVAA |
| Ga0111538_107409064 | 3300009156 | Populus Rhizosphere | VITAAWICLVAPLAATLAITLLGQSLSRRAAGYLATASVLGSFAAAV |
| Ga0075423_104909494 | 3300009162 | Populus Rhizosphere | VIVGAWICLLAPLVGALLVTLGGNALPRRGAAYLV |
| Ga0075423_126396561 | 3300009162 | Populus Rhizosphere | LIAAAWTCLFAPLGAALAITVAGQRITRRGAGYLATFSVGVSFVGAVVAFFALLGDSP |
| Ga0126374_101314224 | 3300009792 | Tropical Forest Soil | MIAAAWTCLISPLVATALITVSGNRLSRRGAGFLSTFSVFVSFVGAVVAFV |
| Ga0134070_104069811 | 3300010301 | Grasslands Soil | LIPAAWICLFSPLAAALVITLWGTRLSRRGAGYIATLSVGVS |
| Ga0134067_101884071 | 3300010321 | Grasslands Soil | VIVAAWICLVAPLAAALLITLLGTGISRRGAAYIATT |
| Ga0134063_102261191 | 3300010335 | Grasslands Soil | MSPGEPPVIVAAWICLVAPLAAALAITLLGQSLSRRAAA |
| Ga0134062_107669972 | 3300010337 | Grasslands Soil | VIVAAWICLLAPLGAVLAITVAGGRLTRRGAGYLA |
| Ga0126376_126866841 | 3300010359 | Tropical Forest Soil | MIAAAWTCLISPLVAAALVTAGGNRLSRCGAGFLSTFSVLV |
| Ga0126372_115166411 | 3300010360 | Tropical Forest Soil | MIAAAWTCLISPLVATALITIGGNRLSRRGAGFLST |
| Ga0134124_120244353 | 3300010397 | Terrestrial Soil | MIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVAVSFVAAIVS |
| Ga0134124_125522353 | 3300010397 | Terrestrial Soil | VIVAAWICLAAPLAAALLITLVGTSISRRAAAYAATTS |
| Ga0134122_104108311 | 3300010400 | Terrestrial Soil | MIVAAWICLISPLAATALIALAGNRLTRRGAGYLSTLSVAVSFVAAIVAFAGLLGDSPDDRYHPSTL |
| Ga0134121_127344131 | 3300010401 | Terrestrial Soil | MIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVAFVF |
| Ga0105246_111719791 | 3300011119 | Miscanthus Rhizosphere | MIAAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVS |
| Ga0137382_104180683 | 3300012200 | Vadose Zone Soil | VIIAAWICLLTPLGATLAITLAGQRLSRRGAGYLATGSVGISFVAA |
| Ga0137382_109959563 | 3300012200 | Vadose Zone Soil | VIVAAWICLAAPLAAALLITLLGTSLSRRAAGYIAT |
| Ga0137369_103529291 | 3300012355 | Vadose Zone Soil | VIAASWICLLSPLAAALAITLLGHSLTRRGAGYLAS |
| Ga0137385_116312731 | 3300012359 | Vadose Zone Soil | LIAAAWICLFLPLLSALLITVRGNTITRRGAGFLATLAVFGS |
| Ga0137373_108094171 | 3300012532 | Vadose Zone Soil | VIAAGWICLFAPLGAALAITLAGQRLTRRGAGYRATASVGVSFVAALVS |
| Ga0136613_100813671 | 3300012681 | Polar Desert Sand | LVAPAWICLLAPLAGALAITLLGRRISRRLAGLLSTGS |
| Ga0157285_101987641 | 3300012897 | Soil | MTTVAVSGWVCLLSPLTAALLITLAGGKLSRRGAGYLATT |
| Ga0157293_102098113 | 3300012898 | Soil | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAAVVTFV |
| Ga0157299_101866141 | 3300012899 | Soil | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAAVVTFVALLGDSPKDRYHPSTLWQ |
| Ga0157288_103298343 | 3300012901 | Soil | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATLSVAVSFVAAVVS |
| Ga0157283_100212391 | 3300012907 | Soil | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVS |
| Ga0157297_101802691 | 3300012914 | Soil | MIVAAWICLLTPLGAALLITVCGTRLSRRGAGYLATVSVAVSFVAA |
| Ga0157310_104982142 | 3300012916 | Soil | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAAVVTFVALLG |
| Ga0126375_110422623 | 3300012948 | Tropical Forest Soil | VIDAAWICLVAPLAAALAITLLGQGLSRRGAGYLATASVLGSF |
| Ga0164306_111707121 | 3300012988 | Soil | MVVASWICLISPLAAAFLITLAGNRISRRGAGYLATLSVAVSFVAAIVAFAGLLGDSP |
| Ga0157378_108077651 | 3300013297 | Miscanthus Rhizosphere | MIAAAWICLISPLVAAFLITLGLNRLSRRGAGYLATLSVAVSFVAAIVSFADLLGHSPEDRYHPSTL |
| Ga0120123_11602851 | 3300013770 | Permafrost | LIAAAWFCLLAPLGAALAITLAGDRITRRGAGYLATASVAASFVAAVVVF |
| Ga0134079_101197154 | 3300014166 | Grasslands Soil | VIAAAWICLFAPLGAALAITLAGGRLTRRGAGYLAT |
| Ga0134079_101923103 | 3300014166 | Grasslands Soil | VIVAAWICLVAPLAAALLITLLGTGISRRGAAYIAT |
| Ga0157377_102850323 | 3300014745 | Miscanthus Rhizosphere | VITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVSFIGLLGDSPDDRSHPSTLWRWLTAGPYHFDLRILV |
| Ga0132256_1027852891 | 3300015372 | Arabidopsis Rhizosphere | MIVAAWICLVAPLAATLVITLFDQTLSRRAAGYLATASVLGS |
| Ga0132257_1040156561 | 3300015373 | Arabidopsis Rhizosphere | MNAAAWTCLLLPLAAATAITLAGGRLTRRQAGYVST |
| Ga0187785_106455632 | 3300017947 | Tropical Peatland | VIVAAWICLLTPLGATLAITLAGQRLTRRGAGYLATASVGVSFIGALVTFGFLLSKSPSDRQ |
| Ga0066655_102132251 | 3300018431 | Grasslands Soil | MIVAAWICLVAPLAAALLITLLGTGISRRAAAYVATTSVL |
| Ga0066655_109898743 | 3300018431 | Grasslands Soil | MIFGAWLCLVSPLAAAVLITLGGNRLSRRGAGYLATLATFVAFVGAAI |
| Ga0190268_122807821 | 3300018466 | Soil | MTTAAWICLFSPLAGALAITLLGTSIPRRVAGYIATASTTVSFVCAVIAFFAL |
| Ga0066662_118309013 | 3300018468 | Grasslands Soil | MIFGAWLCLVSPLAAAVLITLGGNRLSRRGAGYLATLATFVAFVGAAISFFSL |
| Ga0066669_104613701 | 3300018482 | Grasslands Soil | VIVAAWICLLAPLGAALAITLAGGRLTRRGAGYLATAS |
| Ga0193719_103843902 | 3300021344 | Soil | LIAAAWICLLTPLGAALAITLAGNRFTRRGAGYLASASVAASFVSAVVAFALLLGDPPEHRSHPST |
| Ga0222624_11419323 | 3300021951 | Groundwater Sediment | MVYGSWICLLSPLAAAGLITLAGERITRRGAGYLA |
| Ga0247797_10006576 | 3300023057 | Soil | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAV |
| Ga0247793_10531061 | 3300023066 | Soil | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLA |
| Ga0247796_10343023 | 3300023261 | Soil | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAAVVTFVALLGDSPKDRYH |
| Ga0207688_106752573 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVHA |
| Ga0207688_110363171 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLS |
| Ga0207685_108483871 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VIVAAWICLVAPLAAALLITLLGNSISRRVAGYVATASVL |
| Ga0207699_109846273 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VIVAAWICLLSPLGAALLITLFGNGLSRRGAGYLATFAT |
| Ga0207684_107387993 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYVATTSVAFSFIAALVS |
| Ga0207660_106606761 | 3300025917 | Corn Rhizosphere | VITAAWICLFAPLGAALAITLAGQRLSRRGAGFVATTG |
| Ga0207649_106966601 | 3300025920 | Corn Rhizosphere | MIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVAVSFVAAIV |
| Ga0207646_101664701 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VIVAAWICLVAPLAAALLITLLGTSISRRVAAYVATTSV |
| Ga0207659_115827141 | 3300025926 | Miscanthus Rhizosphere | MIVAAWICLISPLAAAFLITLAANRLSRRGAGYLATLSV |
| Ga0207700_116348823 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VIVAAWICLVAPLAAALLITLLGNSISRRVAGYVATASVLGS |
| Ga0207664_102513764 | 3300025929 | Agricultural Soil | MIVAAWICLISPLAATALITAGGNRLSRRGAGFLATSSVFVSFVATLVAFAGLLGD |
| Ga0207706_106499543 | 3300025933 | Corn Rhizosphere | VITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVSFIGLLGDSP |
| Ga0207686_116144461 | 3300025934 | Miscanthus Rhizosphere | MIVAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVA |
| Ga0207669_101335471 | 3300025937 | Miscanthus Rhizosphere | MIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVAVS |
| Ga0207689_104921683 | 3300025942 | Miscanthus Rhizosphere | MIAAAWICLISPLAAAFLITLGWNRLSRRGAGYLATLSV |
| Ga0207651_118709941 | 3300025960 | Switchgrass Rhizosphere | VIVAAWICLVAPLAAALLITLLGNSISRRVAGYVATASVLGSFAA |
| Ga0207712_106666561 | 3300025961 | Switchgrass Rhizosphere | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATLSVAVSFVAAVVSFVALLGDSP |
| Ga0207677_102693474 | 3300026023 | Miscanthus Rhizosphere | VITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVSFIGLLGDSPDDRSHPSTLWRWLTAGPY |
| Ga0209057_11119681 | 3300026342 | Soil | VIVAAWICLVAPLAAALLITLLGTGISRRGAAYIATTSVLGAFAA |
| Ga0209056_102809811 | 3300026538 | Soil | MIVGAWLCLVSPLAAAALITLGGTGLSRRGAGYLATLATFVAFVGAA |
| Ga0209805_12799763 | 3300026542 | Soil | LIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYLATTSVGMSFVAALVSFAGLLGDSP |
| Ga0209156_103916373 | 3300026547 | Soil | LIPAAWICLFSPLAAALVITLWGTRLSRRGAGYIATLSVGV |
| Ga0209577_103253134 | 3300026552 | Soil | LIAGAWICLVAPLAGALAITIGGTRLSRRGAAYLSTLSCFVAF |
| Ga0207513_1004993 | 3300026789 | Soil | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAA |
| Ga0207518_1042211 | 3300026812 | Soil | MNAAAWICLALPLGATVAIALAGTLISRRLAGYLATASVL |
| Ga0209981_10766111 | 3300027378 | Arabidopsis Thaliana Rhizosphere | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAAVV |
| Ga0209177_104168631 | 3300027775 | Agricultural Soil | MIAAAWICLISPLVATALITASGNRLSRRGAGFLATFSVFVSFVAS |
| Ga0247685_10045355 | 3300028065 | Soil | MIAAAWICLISPLVATALITASGNRLSRRGAGFLA |
| Ga0307313_102545631 | 3300028715 | Soil | LIPAAWICLFAPLGAAIAITLLGHRLTRRGAGYLATTSVGMSFVAALVSFAALLGDSPHNREHPSTLWHWLTAG |
| Ga0307298_100630471 | 3300028717 | Soil | VIVAAWICLFAPLGAALAITLAGQRLGRRGAGFLATTGVGVSFVAA |
| Ga0307280_102095753 | 3300028768 | Soil | LIAAAWICLFAPLGAAIAITLLGQRLTRRGAGYLATTSVGMSFVAALVSFAALLGDSPHNREHPSTLWHW |
| Ga0307280_103121443 | 3300028768 | Soil | MIAAAWICLLSPLAATLLITLGWNRLSRRGAGYLATLS |
| Ga0307282_105972843 | 3300028784 | Soil | LIAAAWTCLLTPLGAALGITLAGNRITRRGAGYLAT |
| Ga0307290_102202141 | 3300028791 | Soil | LIAAAWICLLTPLGAALAITLAGNRITRRGAGYLATAS |
| Ga0307299_101238913 | 3300028793 | Soil | LIAAAWICLFAPLGAAIAITLLGHRLTRRGAGYLATTSVGMS |
| Ga0307284_100704221 | 3300028799 | Soil | LIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYLATTSVGMSFVAALVSFAALLGDSPHNREHPSTLWHW |
| Ga0307305_101377124 | 3300028807 | Soil | LIAAAWICLLAPLGAAMAITLAGQRLSRRGAGYLATTSVGISFVAALV |
| Ga0307302_102364861 | 3300028814 | Soil | VTAAAWACLVSPLAAALLITLGGTAWSRRAAGYLATLSTAVSFGAAVVCFFELT |
| Ga0307296_103638331 | 3300028819 | Soil | LIAAAWICLLAPLGAAMAITLAGQRLSRRGAGYLATTSVGISF |
| Ga0307312_100197466 | 3300028828 | Soil | LIAAAWICLFAPLGAAIAITLLGQRLTRRGAGYLATTSVGMSFVAALVSFAALLGDSPHNRE |
| Ga0307312_100868191 | 3300028828 | Soil | LIAAAWICLLTPLGAALAITLAGNRITRRGAGYLATGSVAASFVSAVVAFALLL |
| Ga0307312_103228733 | 3300028828 | Soil | LIAAAWICLFAPLGAAIAITLLGHRLTRRGAGYLATTSVGM |
| Ga0307289_100711271 | 3300028875 | Soil | MIAAAWICLISPLAAAFLITLAGNRLSRRGAGYLATLSVAVSFVAAIVSFA |
| Ga0307304_100378811 | 3300028885 | Soil | LIAAAWICLLAPLGAALAIAIAGNRITRRGAGYLA |
| Ga0307304_105512613 | 3300028885 | Soil | LIAAAWICLLTPLGAALAITLAGNRITRRGAGYLATGSVAASFVSA |
| Ga0307501_101120601 | 3300031152 | Soil | VIVSAWICLVAPLAAALLITLLGTSLSRRAAGYIATASVLGSF |
| Ga0310893_105661012 | 3300031892 | Soil | MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATLSVAVSFVAAVVSFVAL |
| Ga0308175_1005748281 | 3300031938 | Soil | MIAAAWFCLISPLAAAALITVAGNRITRRGAGYLSTLSVAVSFVAAVVA |
| Ga0310884_107742701 | 3300031944 | Soil | MIAAAWICLISPLVATALITASGNRLSRRGAGFLATFSVF |
| Ga0310897_100877524 | 3300032003 | Soil | MIAAAWICLISPLVATALITASGNRLSRRGAGFLATVSVF |
| Ga0310902_104964773 | 3300032012 | Soil | MIAAAWICLISPLVATALITASGNRLSRRGAGFLATFSVFVS |
| Ga0335079_117412841 | 3300032783 | Soil | VIVAAWICLLTPLGATLAITLAGQRLTRRGAGYLATAS |
| Ga0335080_100370811 | 3300032828 | Soil | VIVAAWICLLTPLGATLAITLAGQRLTRRGAGYLATASVGVSFVAAVVTFGF |
| Ga0373958_0017513_2_178 | 3300034819 | Rhizosphere Soil | MIVAAWICLISPLAATALITAGGNRLSRRGAGFLATSSVFVSFVATLVAFAGLLGDSPS |
| Ga0373958_0096420_545_688 | 3300034819 | Rhizosphere Soil | VIVAAWICLVAPLAAALLITLLGNSISRRVAGYVATASVLGSFAAAVV |
| ⦗Top⦘ |