| Basic Information | |
|---|---|
| Family ID | F060413 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSQGMSPEFALGYRAMMLDGITREAEITKKVIAAVPDAASSYKP |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.90 % |
| % of genes near scaffold ends (potentially truncated) | 96.24 % |
| % of genes from short scaffolds (< 2000 bps) | 89.47 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.985 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.023 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.549 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.887 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF01063 | Aminotran_4 | 79.70 |
| PF00072 | Response_reg | 0.75 |
| PF02604 | PhdYeFM_antitox | 0.75 |
| PF13231 | PMT_2 | 0.75 |
| PF04552 | Sigma54_DBD | 0.75 |
| PF13200 | DUF4015 | 0.75 |
| PF05163 | DinB | 0.75 |
| PF01566 | Nramp | 0.75 |
| PF13407 | Peripla_BP_4 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 159.40 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.75 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.75 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.75 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.74 % |
| Unclassified | root | N/A | 5.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10188186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300001356|JGI12269J14319_10175514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300001471|JGI12712J15308_10086299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
| 3300001867|JGI12627J18819_10246746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100129100 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300004082|Ga0062384_100177527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1235 | Open in IMG/M |
| 3300004091|Ga0062387_101610344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 524 | Open in IMG/M |
| 3300004092|Ga0062389_102698631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300004092|Ga0062389_104363047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300004631|Ga0058899_12279336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300004635|Ga0062388_101901798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300005167|Ga0066672_10605629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300005184|Ga0066671_10155929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1336 | Open in IMG/M |
| 3300005345|Ga0070692_10078565 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300005437|Ga0070710_11167254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300005437|Ga0070710_11422862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 519 | Open in IMG/M |
| 3300005439|Ga0070711_100483943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
| 3300005439|Ga0070711_101565514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300005518|Ga0070699_101666655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300005529|Ga0070741_11042564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300005548|Ga0070665_100140435 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
| 3300005568|Ga0066703_10754528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300005569|Ga0066705_10727391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300005591|Ga0070761_10558636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300005607|Ga0070740_10276830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300005616|Ga0068852_100463894 | Not Available | 1256 | Open in IMG/M |
| 3300006028|Ga0070717_10003539 | All Organisms → cellular organisms → Bacteria | 11199 | Open in IMG/M |
| 3300006102|Ga0075015_100086719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
| 3300009521|Ga0116222_1418629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300009522|Ga0116218_1396919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300009616|Ga0116111_1023400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2110 | Open in IMG/M |
| 3300009683|Ga0116224_10242571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300010339|Ga0074046_10752850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300010358|Ga0126370_11646081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300010373|Ga0134128_11762372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300010379|Ga0136449_101462715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
| 3300010379|Ga0136449_103040185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300010398|Ga0126383_10966506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300011120|Ga0150983_12021668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1276 | Open in IMG/M |
| 3300011120|Ga0150983_12289027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300012210|Ga0137378_10022910 | All Organisms → cellular organisms → Bacteria | 5493 | Open in IMG/M |
| 3300012354|Ga0137366_11147719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300012929|Ga0137404_12123826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300012930|Ga0137407_12274837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300013100|Ga0157373_10214270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1358 | Open in IMG/M |
| 3300016404|Ga0182037_10752610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300017822|Ga0187802_10102282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300017822|Ga0187802_10173809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300017823|Ga0187818_10227332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300017924|Ga0187820_1316082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300017928|Ga0187806_1155229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300017936|Ga0187821_10268236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300017946|Ga0187879_10005985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8013 | Open in IMG/M |
| 3300017948|Ga0187847_10271684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
| 3300017948|Ga0187847_10519787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300017959|Ga0187779_10103894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1714 | Open in IMG/M |
| 3300017972|Ga0187781_11301347 | Not Available | 536 | Open in IMG/M |
| 3300017972|Ga0187781_11473121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300018006|Ga0187804_10083918 | Not Available | 1291 | Open in IMG/M |
| 3300018012|Ga0187810_10459634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300018043|Ga0187887_10910699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300018046|Ga0187851_10037130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3269 | Open in IMG/M |
| 3300018057|Ga0187858_10885484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300018085|Ga0187772_10108617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1795 | Open in IMG/M |
| 3300018086|Ga0187769_11103252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300018090|Ga0187770_10475824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
| 3300019278|Ga0187800_1712810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300019278|Ga0187800_1790193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1266 | Open in IMG/M |
| 3300021171|Ga0210405_11346844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300021402|Ga0210385_10663082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300021406|Ga0210386_10214947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1632 | Open in IMG/M |
| 3300021406|Ga0210386_10447569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
| 3300021406|Ga0210386_11208716 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 639 | Open in IMG/M |
| 3300021433|Ga0210391_10064224 | All Organisms → cellular organisms → Bacteria | 2910 | Open in IMG/M |
| 3300021474|Ga0210390_10307920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1342 | Open in IMG/M |
| 3300021477|Ga0210398_10668637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300021479|Ga0210410_10193085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1823 | Open in IMG/M |
| 3300022505|Ga0242647_1005721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
| 3300022528|Ga0242669_1066401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300022733|Ga0224562_1002166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1436 | Open in IMG/M |
| 3300024271|Ga0224564_1082676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300025320|Ga0209171_10187318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1178 | Open in IMG/M |
| 3300025463|Ga0208193_1085969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300025906|Ga0207699_10747834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300025916|Ga0207663_10849988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300026088|Ga0207641_11340161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300026142|Ga0207698_12571667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300026557|Ga0179587_10255551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1122 | Open in IMG/M |
| 3300026916|Ga0208066_100904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300027164|Ga0208994_1043044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300027842|Ga0209580_10335258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300027853|Ga0209274_10758685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300027884|Ga0209275_10559530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300027986|Ga0209168_10625986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300028047|Ga0209526_10281982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1129 | Open in IMG/M |
| 3300028747|Ga0302219_10203630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300028759|Ga0302224_10376991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300028866|Ga0302278_10379137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300028906|Ga0308309_11733977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300029915|Ga0311358_10540374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300029922|Ga0311363_11561043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300029943|Ga0311340_10721964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300030399|Ga0311353_11266268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300030659|Ga0316363_10441365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300030706|Ga0310039_10079138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1402 | Open in IMG/M |
| 3300030706|Ga0310039_10386271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300030730|Ga0307482_1029124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1218 | Open in IMG/M |
| 3300031040|Ga0265754_1032314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300031057|Ga0170834_108371293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300031231|Ga0170824_104287304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1991 | Open in IMG/M |
| 3300031474|Ga0170818_115258415 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300031715|Ga0307476_10301240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1176 | Open in IMG/M |
| 3300031753|Ga0307477_10340084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
| 3300031754|Ga0307475_11116560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300031820|Ga0307473_10566465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300031823|Ga0307478_11674629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300031823|Ga0307478_11775066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300031910|Ga0306923_12243904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300031962|Ga0307479_10549808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300032160|Ga0311301_11010505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1098 | Open in IMG/M |
| 3300032261|Ga0306920_103208990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300032783|Ga0335079_10737374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
| 3300032805|Ga0335078_11520313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300032895|Ga0335074_11613270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300032954|Ga0335083_10115342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2610 | Open in IMG/M |
| 3300032955|Ga0335076_10460198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
| 3300033004|Ga0335084_11658585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300033134|Ga0335073_11561248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300033824|Ga0334840_049840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1248 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.02% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.02% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.26% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.51% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.01% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.26% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.26% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.50% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.75% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026916 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101881862 | 3300000567 | Peatlands Soil | MSEQCMTPEFAQGYCAMTLDGIMREAEITKKVIAAVPDAAS |
| JGI12269J14319_101755142 | 3300001356 | Peatlands Soil | MSHGLTPEFVLGYRAMMLDGLNREAEITEKVIAAVPDAKSDYK |
| JGI12712J15308_100862991 | 3300001471 | Forest Soil | MSQGLTPEFALGYRAMMVDGITREVETTKKVISAVPDAASSFKPDPVARSAKDL |
| JGI12627J18819_102467462 | 3300001867 | Forest Soil | MSQMTPEFALGFRAAMLDSFKNEAEITKRVIAAIPDAKSDYRPDPNA |
| JGIcombinedJ26739_1001291005 | 3300002245 | Forest Soil | MSQGMSPEFALGYRAMMLDGITREAEITKKVIAAVPDAASSYKPDPKARTAKE |
| Ga0062384_1001775272 | 3300004082 | Bog Forest Soil | MSQQGLTPEFAQGYCAMTLDGILREAEITKKVIAAVPDAA |
| Ga0062387_1016103441 | 3300004091 | Bog Forest Soil | MSQQPTPEFVLGFRAVMLDGFKREAETTKKVIAAVPDAKSDYRPDP |
| Ga0062389_1026986311 | 3300004092 | Bog Forest Soil | MSEQGLTPEFARSYCAMTLGGILREVELTKKVIGAVPDAASSYKPDPK |
| Ga0062389_1043630472 | 3300004092 | Bog Forest Soil | MSAPQGFTPEFAAGYCAMMLDGIAREAEVTKKVIAAVPDAASSYK |
| Ga0058899_122793362 | 3300004631 | Forest Soil | MSQGMSPEFALGYCAMMLDGITREAEITKKVIAAVPDAASSYKPDPKARTAKEL |
| Ga0062388_1019017982 | 3300004635 | Bog Forest Soil | MSEQGLTPEFAKGYCVVTLDGIMREAETTKRVIAAVPDTAS |
| Ga0066672_106056291 | 3300005167 | Soil | MSEQQGLTAEFAQGYRAMTLDGITREAEITKKVIAAVPDAASSYRPD |
| Ga0066671_101559291 | 3300005184 | Soil | MSQGLTPEFAEGYRWMMLDGIKREAEITKKVLAAIPDAKSDYKPDPH |
| Ga0070692_100785651 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAQQGPTPEFALGMREMMLDGIAREVEITKKVLAAVPDDKADYRPDPH |
| Ga0070710_111672541 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQGLTPEFALGYRAMMLDSITREAECTKKVIAAVPDAKS |
| Ga0070710_114228622 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQGMTPEFAAGLRALMLDGIEREAECTKRVIAAVPDTKSDYR |
| Ga0070711_1004839431 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQGLTPDFILGYRAMMLDGIAREAECTKKVIAAVPDAKSDY |
| Ga0070711_1015655142 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQGLTPEFAAGLRAMMLDGIAREAEITKRVIGAVPDAKSEYRPD |
| Ga0070699_1016666552 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQGLTPEFVLCYRAMMLDGIAREAEVTKKVIGAIPDAKSDYRPDPNART |
| Ga0070741_110425642 | 3300005529 | Surface Soil | MSQGMTPEFAAGLCAMMLDGIQREAECTKRVLAAVPDDK |
| Ga0070665_1001404351 | 3300005548 | Switchgrass Rhizosphere | MSQGLTPEFAMGYRAMMLDSIKREAEITKKVFAAIPDAKSD |
| Ga0066703_107545281 | 3300005568 | Soil | MSQGLTPDFILGYRAMMLDGIAREAECTKKVIAAVPD |
| Ga0066705_107273911 | 3300005569 | Soil | MSQGLTPEFVLGYRAMMLDGITREAEITKKIIAAVPDAASSYKPDP |
| Ga0070761_105586361 | 3300005591 | Soil | MSHQGLTPEFAQGYCAMSLDGILREAETTKKVIAAVPDAASS |
| Ga0070740_102768301 | 3300005607 | Surface Soil | MSQGMTPEFVLGYRAMMLDGITREAETTKKVLAAVPDDKADYR |
| Ga0068852_1004638941 | 3300005616 | Corn Rhizosphere | MSQGLTPEFAMGYRAMMLDSIMREAEITKKVFAAIPDAKSDYKPDPHAR |
| Ga0070717_1000353914 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQMTPEVALGYRAITLDGFKNEVEITKKVIAAVPDAKSDY |
| Ga0075015_1000867191 | 3300006102 | Watersheds | MSQGLTPEFVLGYRAMMLDGITREAEITKKVIAAVPDENSHYK |
| Ga0116222_14186291 | 3300009521 | Peatlands Soil | MSHGLTPEFVLGYRAMMLDGLNREAEITEKVIAAVPDAKSDYKPD |
| Ga0116218_13969192 | 3300009522 | Peatlands Soil | MTPEFVLGLRAVMLEGFKNEAEITKKVIAAIPDAKSDYR |
| Ga0116111_10234001 | 3300009616 | Peatland | MSQQGLTPEFAIGYRDLMLDGFKNEAEVTKKVIAAVPV |
| Ga0116224_102425712 | 3300009683 | Peatlands Soil | MPDMTPEFALGLRAVMLDGFKMEAEITKKVIAAVPDAKSDYRPDP |
| Ga0074046_107528502 | 3300010339 | Bog Forest Soil | MSQGLTPEFASGYCAMMLDGITREAEITKKVIAAVPDAASSY |
| Ga0126370_116460812 | 3300010358 | Tropical Forest Soil | MTPEFALGLRAMMLDGILREAECTKRVIGAVPDAKADY |
| Ga0134128_117623722 | 3300010373 | Terrestrial Soil | MTPDFAAGLCAMMLDGIQREAECTKRVLAAVPDDKSDYRPDPNARTAREL |
| Ga0136449_1014627152 | 3300010379 | Peatlands Soil | MSEQQGLTAEFAQGYCAMTLDGILREAEITKKVIAAVPDAASSYRPDPNAR |
| Ga0136449_1030401851 | 3300010379 | Peatlands Soil | MSHGLTPEFALGYRAMMLDGINREAQTTRRVIAAIPD |
| Ga0126383_109665062 | 3300010398 | Tropical Forest Soil | MSQGLTPEFALGMRAVMLDGIAREAECTKRVLSAVPDGASD* |
| Ga0150983_105123072 | 3300011120 | Forest Soil | MNPEFAIGLCHMMIDGVTRELETTKKVLAAIPDNKTDYKPDPHTRTAFEL |
| Ga0150983_120216682 | 3300011120 | Forest Soil | MSAPQGFTSEFAVGYRALMLGGIVREAEVTRKVIAAVPD |
| Ga0150983_122890271 | 3300011120 | Forest Soil | MSQGLTPEFVLGYRAMMLDGITREAEITKKVIAAVPD |
| Ga0137378_100229101 | 3300012210 | Vadose Zone Soil | MTPEFALGYRAVTLEGFKNEVEITKKVIAAVPDAKSDY |
| Ga0137366_111477191 | 3300012354 | Vadose Zone Soil | MTPEFALGYRAVTLEGFKNEVEITKKVIAAVPDAKSDYRPDPCARS |
| Ga0137404_121238261 | 3300012929 | Vadose Zone Soil | MSEQQGMSPEFALGFRAVMLDGVMREVEITKKVIGAVPDAASSYKPDPNAR |
| Ga0137407_122748372 | 3300012930 | Vadose Zone Soil | MSPEFVLGYRAVLLDGLTREAEITKKVIAAIPDGASSYKPD |
| Ga0157373_102142703 | 3300013100 | Corn Rhizosphere | MTPEFAAGLCAMMLDGIQREAECTKRVLAAVPDDKSDYRPDPNA |
| Ga0182037_107526102 | 3300016404 | Soil | MSPGLTPEFALGFRGTMLDGIAREAEITKRVIGAVPEAASEYR |
| Ga0187802_101022821 | 3300017822 | Freshwater Sediment | MSHQGLSPEFALAYRAMMLDGILREAECTKKVIAAVPDAQS |
| Ga0187802_101738092 | 3300017822 | Freshwater Sediment | MSQGMTPEFVLGYRAMMLDGIAREAECTKKIIAAVPDAKSDYKPDPHARTAKE |
| Ga0187818_102273322 | 3300017823 | Freshwater Sediment | MHAPTPEFVAAYRAMMLDGVTREAEITKKVIAAVPDSKSSYRPDP |
| Ga0187820_13160822 | 3300017924 | Freshwater Sediment | MSQMTPEFALGYRAAMLASFKNEAEITKKVIAAIPDAKSDYRPDP |
| Ga0187806_11552292 | 3300017928 | Freshwater Sediment | MSQGLTPDFVLGYRAMMLDGIAREAECTKRVIAAVPDAKSDYR |
| Ga0187821_102682362 | 3300017936 | Freshwater Sediment | MSQMTPEVALGYRAITLDGFKNEVEITKKVIAAVPDAKSDYRPDA |
| Ga0187879_100059858 | 3300017946 | Peatland | MSDQQGITPEFALGYCAMTLDGILREAEITKKVIAAVPDAASSYRPDP |
| Ga0187847_102716841 | 3300017948 | Peatland | MSDQQDITREFALGYCAMTLDGILREAEITKKVIAAVPDAASSYRPDPKARTAKE |
| Ga0187847_105197872 | 3300017948 | Peatland | MSQQGMTPEFALGYCAMMLDGIQREAESTKRVIAAIPDEKSEYRHDPNGRTAK |
| Ga0187817_100636021 | 3300017955 | Freshwater Sediment | MATAQQALTPEMAAGFRAVMLDGVTRELEITKKVLSAIPDAKANYRPDPHARTAWELAWH |
| Ga0187779_101038943 | 3300017959 | Tropical Peatland | MSQGMTPEFVLGYRAMMLDGIQREAEITKKVIAAVPDAASSYKPDPNA |
| Ga0187781_113013471 | 3300017972 | Tropical Peatland | MSQHGVTPEFALGYCAMMLDGITREAECTKKVIAAIPDAKSD |
| Ga0187781_114731212 | 3300017972 | Tropical Peatland | MSQGMTPEFVLAYRAMMLNGIAREAECTKKIIAAVPDANSDYKPDPHARTAK |
| Ga0187804_100839182 | 3300018006 | Freshwater Sediment | MHAPTPDFVAAYRTLMLDGVTREAEITKKVIAAVPDSKSGYRPDPCARTAWEL |
| Ga0187810_104596342 | 3300018012 | Freshwater Sediment | MSEQGLTAEFAQGYCAMTLDGILREAEITKKVIAAVPDAASSYKPDPNARSAK |
| Ga0187887_109106991 | 3300018043 | Peatland | MSQQGMTPEFALGYCATMLDGIQREAESTKRVIPAIPDEKSEYRHDPNGRT |
| Ga0187851_100371301 | 3300018046 | Peatland | MSDQQGITPEFALGYCAMTLDGILREAEITKKVIAAVPDAASSYRPDPNARTA |
| Ga0187858_108854842 | 3300018057 | Peatland | MSQQGMSPEFALGYRAMMLDGITREAEITKKVIAAVPDAASSYKP |
| Ga0187772_101086173 | 3300018085 | Tropical Peatland | MSAQALTPEFAAAYCAMMIDGITREAEITKKVIAA |
| Ga0187769_111032522 | 3300018086 | Tropical Peatland | MSQGMTPEFALGYRAMMLDGVLREAEVTKKVIAAVPDAKSDYRHDPNG |
| Ga0187770_104758241 | 3300018090 | Tropical Peatland | MSQGLTPEFALGYRARMLEGLNREAETTKRVIAAVPD |
| Ga0187800_17128102 | 3300019278 | Peatland | MSAQQGLTPEFAAVYCAMMLDGISREAEITKKVIAAVPDAASGYRPDPCSRTAKELA |
| Ga0187800_17901932 | 3300019278 | Peatland | MSEQGFTPEFAQTYCAMMLDGILREVEITKKVIAAVPDAASHYKPDPN |
| Ga0187797_16193472 | 3300019284 | Peatland | MATAQQGLTPEFAMGFCQMMLDGVSREQEITRKVIAAIPDARSDYKPDPHA |
| Ga0210401_106130162 | 3300020583 | Soil | MADSQQALTPELAAAFCAVMLDGVTREMEVTKKVLAAIPDAKAQYKPDPNARTAWQLAWH |
| Ga0210405_113468441 | 3300021171 | Soil | MSEGLTPDFVLAYRAMMLDGIQREAECTKRVISAVPDEKSDYRPDPKAR |
| Ga0210385_106630821 | 3300021402 | Soil | MSQITPEFVLGLRTLMLDGFKRETEITKKVIAAVPDAK |
| Ga0210386_102149473 | 3300021406 | Soil | MSEQGLTPEFAQGYCAMTLDGILREAEITKKVIAAVPDA |
| Ga0210386_104475692 | 3300021406 | Soil | MSQITPEFVLGLRTLMLDGFKRETEITKKVIAAVPDAKS |
| Ga0210386_112087162 | 3300021406 | Soil | MSQGLTPEFVLGYRAMMLDGIAREAEITKKVIGAVPDAKAEHRPDPHA |
| Ga0210391_100642241 | 3300021433 | Soil | MSQITPEFVLGLRTLMLDGFKRETEITKKVIAAVPDA |
| Ga0210390_103079202 | 3300021474 | Soil | MSQGLTPDFILGYRAMMLDGIAREAECTKKVIAAVPDAKSDYRPDAH |
| Ga0210398_106686371 | 3300021477 | Soil | MSAQQGLTPEFALGYCAMTLDGILREAEITKKVIAAVPDAASSYKHDPNG |
| Ga0210410_101930852 | 3300021479 | Soil | MSQGMSPEFALGYRAMMLDGIVREAQVTKKVIAAVPDASSSYKPDPCAR |
| Ga0242647_10057211 | 3300022505 | Soil | MSEQGLTPEFAQGYCAMTLDGILREAEITKKVIAAV |
| Ga0242669_10664011 | 3300022528 | Soil | MSEQGLTPEFAQGYCAMTLDGILREAEITKKVIAAVPDAASSYKPDPKARTAKEL |
| Ga0224562_10021661 | 3300022733 | Soil | MSDQQGLTPEFALGFRAVMLDGVTRELELTKKVLAAIPDAKSDYRPDPS |
| Ga0224564_10826761 | 3300024271 | Soil | MSEQQGLTAEFAQGYCAMTLDGIMREAEITKKIIAAVPDAASSYK |
| Ga0209171_101873182 | 3300025320 | Iron-Sulfur Acid Spring | MSQGMTPEFAQGYCAMMVDGIMREAEITKKIIAAVPDAASSYKP |
| Ga0208193_10859691 | 3300025463 | Peatland | MSAQQGLTPEFALGYCAMMLDGITREAEITKKVIAAVPDAASGYKSDPCAR |
| Ga0207699_107478341 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQGMTPEFAAGLCAMMLDGIQREAECTKRVLAAVPDDKSDYRPDPNARTAR |
| Ga0207663_108499882 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQGMTPEFAAGLCAMMLDGIQREAECTKRVLAAVPD |
| Ga0207641_113401611 | 3300026088 | Switchgrass Rhizosphere | MSQGLTPEFAMGYRAMMLDSIKREAEITKKVFAAIPDAKSDYKPD |
| Ga0207698_125716671 | 3300026142 | Corn Rhizosphere | MSQGLTPEFAMGYRAMMLDSIMREAEITKKVFAAIPDAKSDYKPDPHARTGWE |
| Ga0179587_102555512 | 3300026557 | Vadose Zone Soil | MSQQGLSPEFVLGYRAVMLDGLTREAEITKKVIAAVPDAASSYKPDAN |
| Ga0208066_1009041 | 3300026916 | Soil | MSQQGLSPEFALGYRAVLLDGFTREAEITKKVIAA |
| Ga0208994_10430441 | 3300027164 | Forest Soil | MSQGLTPEFALGYRAMMVDGITREVETTKKVISAVPDAAS |
| Ga0209580_103352582 | 3300027842 | Surface Soil | MSQGMSPEFALGYRAMMLDGIVREAEVTRKVIAAIPDA |
| Ga0209274_107586852 | 3300027853 | Soil | MSQGMSPEFALGYCAMMLNGITREAEITKKVIAAVPDAASSYKPDPHARTAK |
| Ga0209275_105595301 | 3300027884 | Soil | MSQGMSPEFALGYRAMMLDGITREAEITKKVIAAVPDAASSYKP |
| Ga0209168_106259861 | 3300027986 | Surface Soil | MSAQECLTAEFVTGYRAMMLDGIMREAEITKKVIAAVPEA |
| Ga0209526_102819821 | 3300028047 | Forest Soil | MSDQGMTPEFAQGYCAMMLDGIMREAEITKKIIAAVP |
| Ga0302219_102036302 | 3300028747 | Palsa | MSQGMSPEFALGYCAMMLDGITREAEITKKVIAAVPDAASSYKPDPKART |
| Ga0302224_103769911 | 3300028759 | Palsa | MSQGMSPEFALGYCAMMLDGITREAEITKKVIAAVPDAASSYKPDPKARTAK |
| Ga0302278_103791371 | 3300028866 | Bog | MSNQQGITPEFALGYCAMTLDGILREAEITKKVIAAVPDAASSYR |
| Ga0308309_117339772 | 3300028906 | Soil | MSQQGMTPEFALGYCAMMLDGIQREAECTKRVIAAVPDEKSDYRHDPNGRTAKDL |
| Ga0311358_105403742 | 3300029915 | Bog | MSDQQGITPEFALGYCAMTLDGILREAETTKKVIAAVPDAASSYRPDP |
| Ga0311363_115610432 | 3300029922 | Fen | MSNQQGITPEFALGYCAMTLDGILREAEITKKVIAAVPDAASSYRPDPKARTAK |
| Ga0311340_107219642 | 3300029943 | Palsa | MSQGMSPEFALGYRAMMLDGITREAEITKKVIAAVPDAASSY |
| Ga0311353_112662681 | 3300030399 | Palsa | MTEQQAQGMPAEFALGYRQMMLDGLSRELEITKKVIAA |
| Ga0316363_104413651 | 3300030659 | Peatlands Soil | MSEQQGLTAEFAQGYCAMTLDGILREAEITKKVIAAVPDAAS |
| Ga0310039_100791382 | 3300030706 | Peatlands Soil | MSQGMSPEFALGYRAMMLDGIQREAEVTKKVIAAVPDAA |
| Ga0310039_103862711 | 3300030706 | Peatlands Soil | MSHGLTPEFALGYRAMMLDGINREAQTTRRVIAAIP |
| Ga0307482_10291242 | 3300030730 | Hardwood Forest Soil | MSQQGLTPEFALGYRAMMLDGIVREAEVTKRVIAAVPDAASSYKPDPNA |
| Ga0265754_10323141 | 3300031040 | Soil | MSQGMSPEFALGYRAMMLDGITREAETTKKVIAAVPDSASSYKPDPVARTAKEL |
| Ga0170834_1083712932 | 3300031057 | Forest Soil | MSQGLTPEFALGYRAMMVDGITREVETTKKVISAVPDAASSFKP |
| Ga0170824_1042873041 | 3300031231 | Forest Soil | MSQPTGISTEVALGYRAIMVDGFRREIETTKKVIAAIPDTQS |
| Ga0170818_1152584153 | 3300031474 | Forest Soil | MSQGLTPDFILGYRAMMLDGIAREAECTKKVIAAVPDAKSDYRPDPHA |
| Ga0307476_103012402 | 3300031715 | Hardwood Forest Soil | MSQGLTPEFVLGYRAMMLDGITREAEITKKVIAAVPDAASGYKPDPN |
| Ga0307477_103400842 | 3300031753 | Hardwood Forest Soil | MSQGLTPEFVLGYRAMMLDGITREAEVTKKVIAAVPDAASN |
| Ga0307475_111165601 | 3300031754 | Hardwood Forest Soil | MSQQGLTPEFALGYRAMMLDGIVREAEVTKRVIAAVPDAASS |
| Ga0307473_105664651 | 3300031820 | Hardwood Forest Soil | MSQGLTPDFILGYRAMMLDGIAREAECTKKVIAAVPDAKSDYRPDPHARTA |
| Ga0307478_116746292 | 3300031823 | Hardwood Forest Soil | MSQQGLTPEFVLGYRAMMLDGITREAEITKKVIAAVPDAASSYKPDPN |
| Ga0307478_117750661 | 3300031823 | Hardwood Forest Soil | MSQGLTPEFALGYRAMMLDGVVREAATTQKVISAIPD |
| Ga0306923_122439042 | 3300031910 | Soil | MSQGLTPEFALGFRGTMLDGIAREAEITKRVIGAVPEAASEYRP |
| Ga0307479_105498082 | 3300031962 | Hardwood Forest Soil | MSQSLTPDFILGYRAMMLDGIAREAECTKKVIAAVPD |
| Ga0311301_110105051 | 3300032160 | Peatlands Soil | MSEQGLTPEFAQGYCAMTLDGILREAETTKKVIAAVPDA |
| Ga0306920_1032089901 | 3300032261 | Soil | MSQGLTPEFALGFRAVMLDGIAREAECTKRVIGAVPEAGSDYRPDPHARNAKEL |
| Ga0335079_107373741 | 3300032783 | Soil | MSQGLTPEFALGLRAMMLDGFLREAEVTKKVLAAVPDAKSDYKPDPHAR |
| Ga0335078_115203131 | 3300032805 | Soil | MSQGLTPEFALGYRAMMLDGIQREAECTKKVIAAIPDTQSDYRP |
| Ga0335074_116132701 | 3300032895 | Soil | MSQQGLSPEFALAYRAMMLDGIVREAETTKKVITAVPDAQS |
| Ga0335083_101153421 | 3300032954 | Soil | MSQQPTPEFVLGLRAYLLEGFKNEAEITKKVIGAVPDAKSD |
| Ga0335076_104601981 | 3300032955 | Soil | MSEGMTPEFALGYRAVMLEGIQREAEVTKKVIRAVP |
| Ga0335084_116585851 | 3300033004 | Soil | MSQALTPEFAAGLRALMLDGIAREAEITKRVIGAVPDAKSEYR |
| Ga0335073_115612481 | 3300033134 | Soil | MSQQGLSPEFALAYRAMMLDGIVREAETTKKVITAVPDAQSHYKPDPHARTAMELASHLA |
| Ga0334840_049840_1129_1248 | 3300033824 | Soil | MSDQQGITPEFALGYCAMTLDGILREAETTKKVIAAVPDA |
| ⦗Top⦘ |