| Basic Information | |
|---|---|
| Family ID | F059488 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 42 residues |
| Representative Sequence | QELKKEVEESLRAFAQMQKVLKQIAQVNLELLKERKRQRP |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.73 % |
| % of genes near scaffold ends (potentially truncated) | 89.55 % |
| % of genes from short scaffolds (< 2000 bps) | 93.28 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.299 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.925 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.403 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.239 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF13546 | DDE_5 | 61.94 |
| PF01609 | DDE_Tnp_1 | 4.48 |
| PF01695 | IstB_IS21 | 0.75 |
| PF14690 | zf-ISL3 | 0.75 |
| PF01592 | NifU_N | 0.75 |
| PF13714 | PEP_mutase | 0.75 |
| PF01569 | PAP2 | 0.75 |
| PF00872 | Transposase_mut | 0.75 |
| PF05977 | MFS_3 | 0.75 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.75 |
| PF12704 | MacB_PCD | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 4.48 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 4.48 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 4.48 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 4.48 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 4.48 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 4.48 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.75 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.75 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.30 % |
| Unclassified | root | N/A | 9.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908039|B3_v_NODE_2699_len_786_cov_6_381680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 836 | Open in IMG/M |
| 2140918024|NODE_58809_length_805_cov_16.496895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300004082|Ga0062384_100387656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300004635|Ga0062388_101331241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300005445|Ga0070708_100406664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1283 | Open in IMG/M |
| 3300005534|Ga0070735_10227885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
| 3300005538|Ga0070731_10113251 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300005586|Ga0066691_10287579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300005591|Ga0070761_10007316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 6328 | Open in IMG/M |
| 3300005591|Ga0070761_10283481 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300005764|Ga0066903_104268150 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300006031|Ga0066651_10478399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300006086|Ga0075019_10097623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1686 | Open in IMG/M |
| 3300006354|Ga0075021_10051230 | All Organisms → cellular organisms → Bacteria | 2387 | Open in IMG/M |
| 3300006796|Ga0066665_10393460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
| 3300007258|Ga0099793_10471540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300009088|Ga0099830_10538453 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300009089|Ga0099828_10437667 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300009089|Ga0099828_11884866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300009090|Ga0099827_10103860 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300009090|Ga0099827_10499344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300009521|Ga0116222_1460200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300009614|Ga0116104_1055328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 854 | Open in IMG/M |
| 3300009672|Ga0116215_1283309 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300010301|Ga0134070_10347271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300010326|Ga0134065_10466001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300010379|Ga0136449_100739585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1640 | Open in IMG/M |
| 3300010379|Ga0136449_101152897 | Not Available | 1227 | Open in IMG/M |
| 3300010379|Ga0136449_104667108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300012096|Ga0137389_10943748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300012189|Ga0137388_11061259 | Not Available | 746 | Open in IMG/M |
| 3300012203|Ga0137399_11268584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300012206|Ga0137380_11391459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300012209|Ga0137379_10168322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2103 | Open in IMG/M |
| 3300012211|Ga0137377_10222400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1813 | Open in IMG/M |
| 3300012358|Ga0137368_10519541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300012923|Ga0137359_11030256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300012924|Ga0137413_11809657 | Not Available | 504 | Open in IMG/M |
| 3300012925|Ga0137419_11172434 | Not Available | 642 | Open in IMG/M |
| 3300012927|Ga0137416_11578106 | Not Available | 597 | Open in IMG/M |
| 3300012944|Ga0137410_11677679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300012975|Ga0134110_10481444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300012976|Ga0134076_10274671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300014164|Ga0181532_10291810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300014167|Ga0181528_10558049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300014489|Ga0182018_10128144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1465 | Open in IMG/M |
| 3300014489|Ga0182018_10539968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300014490|Ga0182010_10043783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 2114 | Open in IMG/M |
| 3300014655|Ga0181516_10098628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1474 | Open in IMG/M |
| 3300014838|Ga0182030_10593451 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300015082|Ga0167662_1006320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1433 | Open in IMG/M |
| 3300016387|Ga0182040_10136744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1726 | Open in IMG/M |
| 3300017934|Ga0187803_10142045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300017970|Ga0187783_10624722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300018046|Ga0187851_10298800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 934 | Open in IMG/M |
| 3300018468|Ga0066662_11053920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300019787|Ga0182031_1451708 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300019881|Ga0193707_1122532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300020581|Ga0210399_11438876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300021073|Ga0210378_10361316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300021168|Ga0210406_10878364 | Not Available | 676 | Open in IMG/M |
| 3300021170|Ga0210400_10190264 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300021432|Ga0210384_10521285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1069 | Open in IMG/M |
| 3300021478|Ga0210402_11472988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300021559|Ga0210409_10630988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 941 | Open in IMG/M |
| 3300024240|Ga0224522_1117651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300025359|Ga0208322_1015053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300025386|Ga0208585_1013341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
| 3300025406|Ga0208035_1010519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1496 | Open in IMG/M |
| 3300025409|Ga0208321_1034627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 827 | Open in IMG/M |
| 3300025898|Ga0207692_10245071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300026309|Ga0209055_1205280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300026316|Ga0209155_1052288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1584 | Open in IMG/M |
| 3300026320|Ga0209131_1085569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1691 | Open in IMG/M |
| 3300026359|Ga0257163_1034118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300026535|Ga0256867_10190755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300026542|Ga0209805_1402810 | Not Available | 527 | Open in IMG/M |
| 3300026557|Ga0179587_10521999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300026990|Ga0207824_1033038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300027334|Ga0209529_1029579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300027559|Ga0209222_1053132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300027652|Ga0209007_1086301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300027652|Ga0209007_1105461 | Not Available | 708 | Open in IMG/M |
| 3300027676|Ga0209333_1087751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300027692|Ga0209530_1157187 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300027768|Ga0209772_10104321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300027812|Ga0209656_10468756 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300027843|Ga0209798_10565423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300027853|Ga0209274_10003340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7718 | Open in IMG/M |
| 3300027853|Ga0209274_10081582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1575 | Open in IMG/M |
| 3300027853|Ga0209274_10361038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300027898|Ga0209067_10079174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1690 | Open in IMG/M |
| 3300027905|Ga0209415_10875941 | Not Available | 614 | Open in IMG/M |
| 3300028020|Ga0265351_1020795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300028536|Ga0137415_10730907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 801 | Open in IMG/M |
| 3300028574|Ga0302153_10160106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300028780|Ga0302225_10243383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300028792|Ga0307504_10013231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1915 | Open in IMG/M |
| 3300028792|Ga0307504_10346981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300028795|Ga0302227_10153710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300028860|Ga0302199_1087593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300029913|Ga0311362_11313289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300029923|Ga0311347_10909405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300029939|Ga0311328_11027247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300029943|Ga0311340_11473548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300029944|Ga0311352_10574935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300030004|Ga0302186_10144054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300030520|Ga0311372_11182917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 982 | Open in IMG/M |
| 3300030706|Ga0310039_10207413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300030908|Ga0074005_10693670 | Not Available | 614 | Open in IMG/M |
| 3300031231|Ga0170824_104758608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300031446|Ga0170820_15161221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300031545|Ga0318541_10054634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2059 | Open in IMG/M |
| 3300031640|Ga0318555_10418920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300031680|Ga0318574_10902937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300031708|Ga0310686_100299563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300031708|Ga0310686_104227200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300031715|Ga0307476_10063726 | All Organisms → cellular organisms → Bacteria | 2539 | Open in IMG/M |
| 3300031724|Ga0318500_10118169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1222 | Open in IMG/M |
| 3300031740|Ga0307468_100120051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1615 | Open in IMG/M |
| 3300031754|Ga0307475_10769923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300031769|Ga0318526_10178239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300031823|Ga0307478_11040339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300031823|Ga0307478_11298160 | Not Available | 605 | Open in IMG/M |
| 3300031893|Ga0318536_10431982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300032164|Ga0315283_10162813 | Not Available | 2387 | Open in IMG/M |
| 3300032205|Ga0307472_102429201 | Not Available | 532 | Open in IMG/M |
| 3300032898|Ga0335072_10552767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300033158|Ga0335077_10362348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1568 | Open in IMG/M |
| 3300033408|Ga0316605_12458985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300033433|Ga0326726_11194063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 740 | Open in IMG/M |
| 3300033798|Ga0334821_020334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1339 | Open in IMG/M |
| 3300034078|Ga0373900_031717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300034088|Ga0373912_0078821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.22% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.22% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.73% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.73% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.99% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.99% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.24% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.49% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.49% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.49% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.75% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.75% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.75% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908039 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
| 2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009614 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024240 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T25 | Environmental | Open in IMG/M |
| 3300025359 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025386 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025409 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030004 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030908 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033798 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-S | Environmental | Open in IMG/M |
| 3300034078 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.1 | Engineered | Open in IMG/M |
| 3300034088 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B3_v_01056210 | 2124908039 | Soil | RRVRQVPVPREMKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRR |
| B_all_v_00251130 | 2140918024 | Soil | VSLGKRRVRQVPVPREMKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRR |
| Ga0062384_1003876561 | 3300004082 | Bog Forest Soil | IPVPGEMKKEVEESLRAFAQTQKLLKQIAGVNLELLKERKRQRQ* |
| Ga0062388_1013312412 | 3300004635 | Bog Forest Soil | ELKKEVEESLRAFAQTQKVLKQIAQVNLELFKERKRQRR* |
| Ga0070708_1004066643 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IPIPSELKKDVEESLRAFAQMQKLLRQIAQVNLELFKERKRHRS* |
| Ga0070735_102278852 | 3300005534 | Surface Soil | EEVEQNLRAFAQLQKVLKQIAQVNLELLKEHKRQRL* |
| Ga0070731_101132513 | 3300005538 | Surface Soil | ELKEEVEESLRAFAQTQSLLKQVAQVNLELLKEHKRQRS* |
| Ga0066691_102875791 | 3300005586 | Soil | GNRQVRQVPVPSELTKEVEENLRAFAQVQKLLKQIAQVNLELFKERKRQRP* |
| Ga0070761_100073161 | 3300005591 | Soil | MAEVEESLRALARTRKLIKQIAQINLDLLKERKRRRQ* |
| Ga0070761_102834811 | 3300005591 | Soil | VRQIPVPREMQSEAEESLHAFAQMQKVLRQIAQVNLELFMERTRQRP* |
| Ga0066903_1042681502 | 3300005764 | Tropical Forest Soil | EVEESLRAFAQTHTLLKQIAQVNLELFKERKRQRP* |
| Ga0066651_104783992 | 3300006031 | Soil | SELKKQVGESLRAFAQTQKLLKQIAQVNLELFKERKRQRP* |
| Ga0075019_100976231 | 3300006086 | Watersheds | KEVEASLRAFAQTQKLLKQIGAVNLDLLKERKRQRQ* |
| Ga0075021_100512304 | 3300006354 | Watersheds | RQVRQIPIPGEMKKEVEESLRAFAQMQKLLKQIAGLNLELLKERKRQRQ* |
| Ga0066665_103934601 | 3300006796 | Soil | ELKKEVEESLHAFAQMQKALKQIAQVNLELFKERKRQRR* |
| Ga0099793_104715402 | 3300007258 | Vadose Zone Soil | IPSEMKKGVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRQ* |
| Ga0099830_105384531 | 3300009088 | Vadose Zone Soil | RVRQIPVPRELKKEVEASLRAFAQAQKLLKQIGAVNLELLRERKRQR* |
| Ga0099828_104376673 | 3300009089 | Vadose Zone Soil | ELKKEVEASLRAFAQTQKLLKQIGAVNLELLRERKRQR* |
| Ga0099828_118848661 | 3300009089 | Vadose Zone Soil | RKVRQIPIPGEFKKEVEDSLRAFAKMRKLLRQIAQVNLDLLKERKRRR* |
| Ga0099827_101038604 | 3300009090 | Vadose Zone Soil | GNRQVRQIPIPSELKKEVEESLRAFAQMQKVLKQIAQVNLELLRERKRQRP* |
| Ga0099827_104993441 | 3300009090 | Vadose Zone Soil | VRQIPIPGEFKKEVEDSLRAFAKMRKLLRQIAQVNLDLLKERKRRR* |
| Ga0116222_14602001 | 3300009521 | Peatlands Soil | GELKKEVEESLRAFAQVQKLLKQIAQVNLELFRERKRQRP* |
| Ga0116104_10553282 | 3300009614 | Peatland | EMKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRR* |
| Ga0116215_12833091 | 3300009672 | Peatlands Soil | RKVRQVPIPNERLSEVEEGLRAFAQTRKLLKQIAQINVDLLKERKRQRQ* |
| Ga0134070_103472711 | 3300010301 | Grasslands Soil | NRQVRQIPIPSELKKEVEESLRAFAQMQKVLKQIAQVNLELLRERKRQRP* |
| Ga0134065_104660011 | 3300010326 | Grasslands Soil | SELKKEVEESLRAFAQMQKVLKQIAQVNLELLRERKRQRP* |
| Ga0136449_1007395853 | 3300010379 | Peatlands Soil | LKEEVEESLRAFSQTQKVLKQIAQVNLELLKERKRQRR* |
| Ga0136449_1011528972 | 3300010379 | Peatlands Soil | VRQVPIPGELKKEVEESLRAFAQVQKLLKQIAQVNLELFRERKRQRP* |
| Ga0136449_1046671081 | 3300010379 | Peatlands Soil | EVEESLRAFAQVQKLLKQIAQVNLELFRERKRQRP* |
| Ga0137389_109437482 | 3300012096 | Vadose Zone Soil | LKKEVEESLRAFAQMQKVLKQIAQVNLELFRERKRQRP* |
| Ga0137388_110612591 | 3300012189 | Vadose Zone Soil | SEKKKQVEESLSEFAQTQELRKQIGAVNLELLRERKQQR* |
| Ga0137399_112685841 | 3300012203 | Vadose Zone Soil | GVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRQ* |
| Ga0137380_113914592 | 3300012206 | Vadose Zone Soil | VRQVPIPSELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS* |
| Ga0137379_101683222 | 3300012209 | Vadose Zone Soil | MKKEVEESLRAFAQMQKLLKQIAGVNLEVLKERKRRRR* |
| Ga0137377_102224003 | 3300012211 | Vadose Zone Soil | QVRQIPVPSELKKEVEESLHAFAQMQKALKQIAQVNLELFKERKRQRR* |
| Ga0137368_105195411 | 3300012358 | Vadose Zone Soil | MKKEVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRP* |
| Ga0137359_110302561 | 3300012923 | Vadose Zone Soil | RQVRQIPVPSEMKKEVEESLRAFAQMQNVLKQIAQVNLELFKERKRQRP* |
| Ga0137413_118096572 | 3300012924 | Vadose Zone Soil | LSVSLGSRGVRQVPVPQEMKKEVGESLLAFARAQKLLKQIAGLNLESWKERKRRR* |
| Ga0137419_111724342 | 3300012925 | Vadose Zone Soil | GNRRVRQIPVPRELKKEVEASLRAFAQTQKLLKQIGAVNLELLRERKRQR* |
| Ga0137416_115781061 | 3300012927 | Vadose Zone Soil | QVPVPQEMKKEVGESLLAFARAQKLLKQVAGLNLESWKERKRRR* |
| Ga0137410_116776791 | 3300012944 | Vadose Zone Soil | VPGEMKKEVEGSLRAFAQTQKLLKQIAGVNLELLKERKRQRQ* |
| Ga0134110_104814441 | 3300012975 | Grasslands Soil | RQVPVPSELKKEVEENLRAFAQVQKLLKQIAQVNLELFKERKRQRP* |
| Ga0134076_102746712 | 3300012976 | Grasslands Soil | KKEVEESLRAFAQMQDVLKQIAQLNLELFKERKRQRP* |
| Ga0181532_102918101 | 3300014164 | Bog | QVPIPSELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS* |
| Ga0181528_105580491 | 3300014167 | Bog | KVEERLRSFAETQSLLKQIAQVNLELLKERKRQPS* |
| Ga0182018_101281442 | 3300014489 | Palsa | NRQVRQVPIPSELKEEVEESLRAFAQTQSLLKQIAQVNLELLKERKRQRL* |
| Ga0182018_105399681 | 3300014489 | Palsa | QVPIPSELKEEVEESLRAFAQTQSLLKQIAQVNLELLKERKRQRS* |
| Ga0182010_100437831 | 3300014490 | Fen | RRVRQVPVPREMKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRR* |
| Ga0181516_100986281 | 3300014655 | Bog | LKKEVEESLRAFAQVQHVLKQIAQVNLELFKERKRQRP* |
| Ga0182030_105934513 | 3300014838 | Bog | VPIELKKEVEESLRAFAQAQNVLKQIAQVNLELFKERKRQRP* |
| Ga0167662_10063201 | 3300015082 | Glacier Forefield Soil | PGEMKKEVEDSLRAFAQTQELLKQIAGINFELLRERKRKR* |
| Ga0182040_101367441 | 3300016387 | Soil | IPNELRREVEKSLRAFAQTQTLLKQIAQVNLELFKERKRQRR |
| Ga0187803_101420451 | 3300017934 | Freshwater Sediment | PSDWKKQVEEDLQAFAQAHKVLKQIAQLNLDLLKERKRQRQ |
| Ga0187783_106247221 | 3300017970 | Tropical Peatland | IPVPNELRKEVEESLRAFAQTQKVLKQIAQVNLELFKERKRQRP |
| Ga0187851_102988001 | 3300018046 | Peatland | MGYFCRAPKPIPSELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQR |
| Ga0066662_110539201 | 3300018468 | Grasslands Soil | ELKKEVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRR |
| Ga0182031_14517082 | 3300019787 | Bog | MNKEVEESLRAFAQTQELLKQIAAINLELLRERKRQR |
| Ga0193707_11225321 | 3300019881 | Soil | LKKEVEESLRAFAQTQTLLKQIALVNLELLKDRKRQRT |
| Ga0210399_114388761 | 3300020581 | Soil | MKKEVGESLLAFAQAQKLLKKIAGVNLESLKERKRRR |
| Ga0210378_103613162 | 3300021073 | Groundwater Sediment | IPSEMKKGVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRQ |
| Ga0210406_108783641 | 3300021168 | Soil | QIPIPKERRKEVGENLRAFAQTQKLLKQIAMVNLELLKERKRRR |
| Ga0210400_101902643 | 3300021170 | Soil | EVEESLRAFARTQNVLKQIAQVNLELLKERKRQER |
| Ga0210384_105212852 | 3300021432 | Soil | IPVPKEMKKEVGESMLAFAQAQKLLKQIAGVNLESLKERKRR |
| Ga0210402_114729881 | 3300021478 | Soil | IPGEMKKEVEDSLRAFAQMQKRLKQIAGVNLELLKERKRQQ |
| Ga0210409_106309881 | 3300021559 | Soil | NRQVRQVPIPSEMKQEVEESLRAFVQVQKLLKQIAQVNLELLKERKRQLP |
| Ga0224522_11176512 | 3300024240 | Soil | RQIPVPRELKKDVEESLRAFAQMQKLLRQIAQVNLELFKERKRQRP |
| Ga0208322_10150531 | 3300025359 | Peatland | VRQIPIPGEMRKEVEDSLRAFAQTQKLLKQIAGLNLELLKERKRQR |
| Ga0208585_10133412 | 3300025386 | Arctic Peat Soil | VQVPVEMNKEVEDSLRAFAQTQELLKQIAGINFELLRERKRHR |
| Ga0208035_10105192 | 3300025406 | Peatland | QVPIPSELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS |
| Ga0208321_10346272 | 3300025409 | Peatland | GEMKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRR |
| Ga0207692_102450711 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | NRQVRQIPVPGEMKKEVEESLRAFAQMQNVLKQIAQVNLELFKERKRQRT |
| Ga0209055_12052802 | 3300026309 | Soil | EVEESLRAFAQMQKVLKQIAQVNLELLRERKRQRP |
| Ga0209155_10522882 | 3300026316 | Soil | QLPIPSEMKKEVEESLRAFSQMQKVLKQIAQVNLELFKERKRQRP |
| Ga0209131_10855693 | 3300026320 | Grasslands Soil | VPRELKKEVESNLRAFAQAQKLLKQIGAVNLELLRERKRQR |
| Ga0257163_10341181 | 3300026359 | Soil | KKGVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRQ |
| Ga0256867_101907551 | 3300026535 | Soil | KKEVEESQRAFAQMQKVVKQIAQVNLELFKERKRQRP |
| Ga0209805_14028101 | 3300026542 | Soil | KEVEASLRAFAQTQKLLKQIGAVNLELLRERKRQR |
| Ga0179587_105219992 | 3300026557 | Vadose Zone Soil | VPSEMKKEVEESLRAFAQMQNVLKQVAQVNLELFKERKRQRP |
| Ga0207824_10330381 | 3300026990 | Tropical Forest Soil | QELKKEVEESLRAFAQMQKVLKQIAQVNLELLKERKRQRP |
| Ga0209529_10295791 | 3300027334 | Forest Soil | EVEDSLRAFAQTQKLLKQIAGLNLELLKERKRQRQ |
| Ga0209222_10531321 | 3300027559 | Forest Soil | QIQVPVEMNKEVEDSLRAFAETQELLKQIAAINLELLRERKRQR |
| Ga0209007_10863011 | 3300027652 | Forest Soil | RQIPVPGEMKKEVEDSLRAFAQTQKLLKQIAGLNLELLKERKRQRQ |
| Ga0209007_11054611 | 3300027652 | Forest Soil | KARQIQVPGEMMKEVEDSLRAFAQTQELLKQIAAINLELLRERKRQR |
| Ga0209333_10877511 | 3300027676 | Forest Soil | IQVPGEMMKGVEDSLRAFAQTQELLKQIAAINLELLRERKRQR |
| Ga0209530_11571871 | 3300027692 | Forest Soil | SLGDRKVRQIQVPDEMMKDVEDSLRAYAQTQELLKQIAAINLELLRERKRQR |
| Ga0209772_101043211 | 3300027768 | Bog Forest Soil | QIPVPGEMKKEVEDSLRAFAQTQKLLKQIAGVNLELLKERKRQRQ |
| Ga0209656_104687561 | 3300027812 | Bog Forest Soil | NRKVRQVPIPNARLSEVEEGLRAFAQTRKLLKQIAQINVDLLKERKRRRQ |
| Ga0209798_105654232 | 3300027843 | Wetland Sediment | AEMKEEVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRL |
| Ga0209274_100033403 | 3300027853 | Soil | MAEVEESLRALARTRKLIKQIAQINLDLLKERKRRRQ |
| Ga0209274_100815821 | 3300027853 | Soil | KKEVEDSLRAFAQTHALLKQIAQVNLELFKERKRQRP |
| Ga0209274_103610383 | 3300027853 | Soil | RQVPVPNELKQEVEESLRAFAQTQKALKQIAQVNLELFKERKHQRP |
| Ga0209067_100791741 | 3300027898 | Watersheds | RKEVEASLRAFAQTQKLLKQIGAVNLDLLKERKRQRQ |
| Ga0209415_108759412 | 3300027905 | Peatlands Soil | VPEEMKQEVGESLLAFAQAQKLLKQIGAVNLESLKERKRRR |
| Ga0265351_10207951 | 3300028020 | Soil | KEVEESLRAFAQTQELLKQIAAINLELLRERKRQR |
| Ga0137415_107309071 | 3300028536 | Vadose Zone Soil | RGVRQVPVPQEMKKEVGESLLAFARAQKLLKQVAGLNLESWKERKRRR |
| Ga0302153_101601061 | 3300028574 | Bog | QVPIPGELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS |
| Ga0302225_102433832 | 3300028780 | Palsa | ELKQEVEESLRAFAQTQKVLKQIAQVNLELFKERKHQRL |
| Ga0307504_100132311 | 3300028792 | Soil | PRELKKEVEGSLRAFAQMQRVLKQIAQVNLELFKEQKRQRP |
| Ga0307504_103469812 | 3300028792 | Soil | GITPIPSEMKKGVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRQ |
| Ga0302227_101537101 | 3300028795 | Palsa | NKEVEDSLRAFAQTQELLKQIAAINLELLRERKRQR |
| Ga0302199_10875931 | 3300028860 | Bog | VPIPGELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS |
| Ga0311362_113132891 | 3300029913 | Bog | DRQVRQIPVPGEMKKEVEDSLRAFAQTQKLLKQIAGLNLELLKERKRQRQ |
| Ga0311347_109094051 | 3300029923 | Fen | EVEECLRAFARMQTVLKQIAQVNVDLFKERKRQRP |
| Ga0311328_110272471 | 3300029939 | Bog | QIPIPGEMRKEVEASLRAFAQTQKVLKQIAGVNLELLKERKRQRQ |
| Ga0311340_114735481 | 3300029943 | Palsa | GNRHVRQVPIPNELKKEVEESLRAFAQTQKVLRQIAQVNLELFKERKRQRP |
| Ga0311352_105749351 | 3300029944 | Palsa | RQVPVPGEMKKEVGDSLRAFAQTQKLLKQIAGVNLELLKERKRQRQ |
| Ga0302186_101440541 | 3300030004 | Bog | ELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS |
| Ga0311372_111829172 | 3300030520 | Palsa | DRKVRQIQVPGEMKKEVEDSLRAFAQTQELLKQIAGINLELLRERKRRRQ |
| Ga0310039_102074132 | 3300030706 | Peatlands Soil | VRQVPIPGELKKEVEESLRAFAQVQKLLKQIAQVNLELFRERKRQRP |
| Ga0074005_106936701 | 3300030908 | Soil | VPEEMKKEVGESLRAFARTQKLLKQIAAVNVELLKERKRNE |
| Ga0170824_1047586081 | 3300031231 | Forest Soil | PIPSELKKEVEESLRAFAQMQKVLKQIAQVNLELLKERKRQRK |
| Ga0170820_151612212 | 3300031446 | Forest Soil | LPVPGEMKKEVEESLRAFAQMQNVLKQIAQVNLELFKERKRQRP |
| Ga0318541_100546344 | 3300031545 | Soil | PNQLKKEVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRP |
| Ga0318555_104189202 | 3300031640 | Soil | RQVRQIPVPNELRKEVEESLGAFAQTQKVLKQIALLNLELFKERKRQRP |
| Ga0318574_109029372 | 3300031680 | Soil | PIPNQLKKEVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRP |
| Ga0310686_1002995631 | 3300031708 | Soil | KKEVEESLRAFAQTQKVLKQIAQVNLELFKERKRQRR |
| Ga0310686_1042272001 | 3300031708 | Soil | IPIPGEMKKEVEDSLRAFAQMQKLLKQIAGVNLALLKERKRRQ |
| Ga0307476_100637263 | 3300031715 | Hardwood Forest Soil | KKEVEDSLRAFAHTQELLKQIAGINLELLRERKRQRR |
| Ga0318500_101181691 | 3300031724 | Soil | QVRQIPIPNELKKEVEESLRAFAQMQKVLKQIAQVNLELFKERKRRRP |
| Ga0307468_1001200511 | 3300031740 | Hardwood Forest Soil | KEMKKEVGESLLAFAQTQKLLKQIAGVNLESLKERKRRR |
| Ga0307475_107699231 | 3300031754 | Hardwood Forest Soil | LSVSLGGRKVRQIQVPGEMKKEVEDSLRAFAHTQELLKQIAGINLELLRERKRQRR |
| Ga0318526_101782391 | 3300031769 | Soil | PGEMKKEVEGSLRAFAQTQKLLKQIAGVNLELLKKRKRRQ |
| Ga0307478_110403391 | 3300031823 | Hardwood Forest Soil | PIPSELKKEVEESLRAFAQTQKVLKQIAQVNLELFKERKRQRP |
| Ga0307478_112981602 | 3300031823 | Hardwood Forest Soil | IPKERRKEVGENLRAFAQTQKLLKQIAMVNLELLKERKRRR |
| Ga0318536_104319822 | 3300031893 | Soil | VPIPNELRREVEKSLRAFAQTQTLLKQIAQVNLELFKERKRQRR |
| Ga0315283_101628133 | 3300032164 | Sediment | KKEVEESLRAFAQMRKLLKQIAQVNLDLLKERKRQRP |
| Ga0307472_1024292012 | 3300032205 | Hardwood Forest Soil | RELKIEVEESLRAFAQTQKLLKQIGAVNLELLRERKRQR |
| Ga0335072_105527672 | 3300032898 | Soil | EMKKEVEHSLRAFAQTQELLKQIAGINFELLRERKRQR |
| Ga0335077_103623481 | 3300033158 | Soil | KREVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRP |
| Ga0316605_124589851 | 3300033408 | Soil | VRQIPVPSELKKEVEESLKAFAQMQKVLKQIAQVNLDLFKERKRQRQ |
| Ga0326726_111940632 | 3300033433 | Peat Soil | MEVEQGQRAFAQAQKLLKQIAAVNLEMLKERKRRG |
| Ga0334821_020334_117_230 | 3300033798 | Soil | MKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRL |
| Ga0373900_031717_133_249 | 3300034078 | Sediment Slurry | MKKEVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRP |
| Ga0373912_0078821_10_126 | 3300034088 | Sediment Slurry | MKKEVEESLRAFAQMRRLLKQIAQVNLDLLKEHKRQRP |
| ⦗Top⦘ |