NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059488

Metagenome / Metatranscriptome Family F059488

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059488
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 42 residues
Representative Sequence QELKKEVEESLRAFAQMQKVLKQIAQVNLELLKERKRQRP
Number of Associated Samples 122
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.73 %
% of genes near scaffold ends (potentially truncated) 89.55 %
% of genes from short scaffolds (< 2000 bps) 93.28 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.299 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(14.925 % of family members)
Environment Ontology (ENVO) Unclassified
(19.403 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.239 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 54.41%    β-sheet: 0.00%    Coil/Unstructured: 45.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF13546DDE_5 61.94
PF01609DDE_Tnp_1 4.48
PF01695IstB_IS21 0.75
PF14690zf-ISL3 0.75
PF01592NifU_N 0.75
PF13714PEP_mutase 0.75
PF01569PAP2 0.75
PF00872Transposase_mut 0.75
PF05977MFS_3 0.75
PF07592DDE_Tnp_ISAZ013 0.75
PF12704MacB_PCD 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 4.48
COG3293TransposaseMobilome: prophages, transposons [X] 4.48
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 4.48
COG5421TransposaseMobilome: prophages, transposons [X] 4.48
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 4.48
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 4.48
COG0822Fe-S cluster assembly scaffold protein IscU, NifU familyPosttranslational modification, protein turnover, chaperones [O] 0.75
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.75
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.75
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.30 %
UnclassifiedrootN/A9.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908039|B3_v_NODE_2699_len_786_cov_6_381680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6836Open in IMG/M
2140918024|NODE_58809_length_805_cov_16.496895All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300004082|Ga0062384_100387656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium896Open in IMG/M
3300004635|Ga0062388_101331241All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300005445|Ga0070708_100406664All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1283Open in IMG/M
3300005534|Ga0070735_10227885All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1134Open in IMG/M
3300005538|Ga0070731_10113251All Organisms → cellular organisms → Bacteria1797Open in IMG/M
3300005586|Ga0066691_10287579All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium969Open in IMG/M
3300005591|Ga0070761_10007316All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus6328Open in IMG/M
3300005591|Ga0070761_10283481All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300005764|Ga0066903_104268150All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300006031|Ga0066651_10478399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium660Open in IMG/M
3300006086|Ga0075019_10097623All Organisms → cellular organisms → Bacteria → Acidobacteria1686Open in IMG/M
3300006354|Ga0075021_10051230All Organisms → cellular organisms → Bacteria2387Open in IMG/M
3300006796|Ga0066665_10393460All Organisms → cellular organisms → Bacteria → Acidobacteria1142Open in IMG/M
3300007258|Ga0099793_10471540All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300009088|Ga0099830_10538453All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300009089|Ga0099828_10437667All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300009089|Ga0099828_11884866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300009090|Ga0099827_10103860All Organisms → cellular organisms → Bacteria2263Open in IMG/M
3300009090|Ga0099827_10499344All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1045Open in IMG/M
3300009521|Ga0116222_1460200All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300009614|Ga0116104_1055328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6854Open in IMG/M
3300009672|Ga0116215_1283309All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300010301|Ga0134070_10347271All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300010326|Ga0134065_10466001All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300010379|Ga0136449_100739585All Organisms → cellular organisms → Bacteria → Acidobacteria1640Open in IMG/M
3300010379|Ga0136449_101152897Not Available1227Open in IMG/M
3300010379|Ga0136449_104667108All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300012096|Ga0137389_10943748All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300012189|Ga0137388_11061259Not Available746Open in IMG/M
3300012203|Ga0137399_11268584All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300012206|Ga0137380_11391459All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300012209|Ga0137379_10168322All Organisms → cellular organisms → Bacteria → Acidobacteria2103Open in IMG/M
3300012211|Ga0137377_10222400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1813Open in IMG/M
3300012358|Ga0137368_10519541All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300012923|Ga0137359_11030256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300012924|Ga0137413_11809657Not Available504Open in IMG/M
3300012925|Ga0137419_11172434Not Available642Open in IMG/M
3300012927|Ga0137416_11578106Not Available597Open in IMG/M
3300012944|Ga0137410_11677679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300012975|Ga0134110_10481444All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300012976|Ga0134076_10274671All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium724Open in IMG/M
3300014164|Ga0181532_10291810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium926Open in IMG/M
3300014167|Ga0181528_10558049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300014489|Ga0182018_10128144All Organisms → cellular organisms → Bacteria → Acidobacteria1465Open in IMG/M
3300014489|Ga0182018_10539968All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300014490|Ga0182010_10043783All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA62114Open in IMG/M
3300014655|Ga0181516_10098628All Organisms → cellular organisms → Bacteria → Acidobacteria1474Open in IMG/M
3300014838|Ga0182030_10593451All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300015082|Ga0167662_1006320All Organisms → cellular organisms → Bacteria → Acidobacteria1433Open in IMG/M
3300016387|Ga0182040_10136744All Organisms → cellular organisms → Bacteria → Acidobacteria1726Open in IMG/M
3300017934|Ga0187803_10142045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium944Open in IMG/M
3300017970|Ga0187783_10624722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium779Open in IMG/M
3300018046|Ga0187851_10298800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus934Open in IMG/M
3300018468|Ga0066662_11053920All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300019787|Ga0182031_1451708All Organisms → cellular organisms → Bacteria1763Open in IMG/M
3300019881|Ga0193707_1122532All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium756Open in IMG/M
3300020581|Ga0210399_11438876All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300021073|Ga0210378_10361316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300021168|Ga0210406_10878364Not Available676Open in IMG/M
3300021170|Ga0210400_10190264All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300021432|Ga0210384_10521285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61069Open in IMG/M
3300021478|Ga0210402_11472988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300021559|Ga0210409_10630988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium941Open in IMG/M
3300024240|Ga0224522_1117651All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300025359|Ga0208322_1015053All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300025386|Ga0208585_1013341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium905Open in IMG/M
3300025406|Ga0208035_1010519All Organisms → cellular organisms → Bacteria → Acidobacteria1496Open in IMG/M
3300025409|Ga0208321_1034627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6827Open in IMG/M
3300025898|Ga0207692_10245071All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1072Open in IMG/M
3300026309|Ga0209055_1205280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300026316|Ga0209155_1052288All Organisms → cellular organisms → Bacteria → Acidobacteria1584Open in IMG/M
3300026320|Ga0209131_1085569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61691Open in IMG/M
3300026359|Ga0257163_1034118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium802Open in IMG/M
3300026535|Ga0256867_10190755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium754Open in IMG/M
3300026542|Ga0209805_1402810Not Available527Open in IMG/M
3300026557|Ga0179587_10521999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium780Open in IMG/M
3300026990|Ga0207824_1033038All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300027334|Ga0209529_1029579All Organisms → cellular organisms → Bacteria → Acidobacteria936Open in IMG/M
3300027559|Ga0209222_1053132All Organisms → cellular organisms → Bacteria → Acidobacteria779Open in IMG/M
3300027652|Ga0209007_1086301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300027652|Ga0209007_1105461Not Available708Open in IMG/M
3300027676|Ga0209333_1087751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium850Open in IMG/M
3300027692|Ga0209530_1157187All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300027768|Ga0209772_10104321All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium873Open in IMG/M
3300027812|Ga0209656_10468756All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300027843|Ga0209798_10565423All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300027853|Ga0209274_10003340All Organisms → cellular organisms → Bacteria → Acidobacteria7718Open in IMG/M
3300027853|Ga0209274_10081582All Organisms → cellular organisms → Bacteria → Acidobacteria1575Open in IMG/M
3300027853|Ga0209274_10361038All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium749Open in IMG/M
3300027898|Ga0209067_10079174All Organisms → cellular organisms → Bacteria → Acidobacteria1690Open in IMG/M
3300027905|Ga0209415_10875941Not Available614Open in IMG/M
3300028020|Ga0265351_1020795All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300028536|Ga0137415_10730907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6801Open in IMG/M
3300028574|Ga0302153_10160106All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300028780|Ga0302225_10243383All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium859Open in IMG/M
3300028792|Ga0307504_10013231All Organisms → cellular organisms → Bacteria → Proteobacteria1915Open in IMG/M
3300028792|Ga0307504_10346981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300028795|Ga0302227_10153710All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300028860|Ga0302199_1087593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1020Open in IMG/M
3300029913|Ga0311362_11313289All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300029923|Ga0311347_10909405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300029939|Ga0311328_11027247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300029943|Ga0311340_11473548All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300029944|Ga0311352_10574935All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300030004|Ga0302186_10144054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium849Open in IMG/M
3300030520|Ga0311372_11182917All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium982Open in IMG/M
3300030706|Ga0310039_10207413All Organisms → cellular organisms → Bacteria → Acidobacteria770Open in IMG/M
3300030908|Ga0074005_10693670Not Available614Open in IMG/M
3300031231|Ga0170824_104758608All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300031446|Ga0170820_15161221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300031545|Ga0318541_10054634All Organisms → cellular organisms → Bacteria → Acidobacteria2059Open in IMG/M
3300031640|Ga0318555_10418920All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300031680|Ga0318574_10902937All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300031708|Ga0310686_100299563All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300031708|Ga0310686_104227200All Organisms → cellular organisms → Bacteria → Acidobacteria770Open in IMG/M
3300031715|Ga0307476_10063726All Organisms → cellular organisms → Bacteria2539Open in IMG/M
3300031724|Ga0318500_10118169All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1222Open in IMG/M
3300031740|Ga0307468_100120051All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61615Open in IMG/M
3300031754|Ga0307475_10769923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium765Open in IMG/M
3300031769|Ga0318526_10178239All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300031823|Ga0307478_11040339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300031823|Ga0307478_11298160Not Available605Open in IMG/M
3300031893|Ga0318536_10431982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300032164|Ga0315283_10162813Not Available2387Open in IMG/M
3300032205|Ga0307472_102429201Not Available532Open in IMG/M
3300032898|Ga0335072_10552767All Organisms → cellular organisms → Bacteria → Acidobacteria1174Open in IMG/M
3300033158|Ga0335077_10362348All Organisms → cellular organisms → Bacteria → Acidobacteria1568Open in IMG/M
3300033408|Ga0316605_12458985All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300033433|Ga0326726_11194063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6740Open in IMG/M
3300033798|Ga0334821_020334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61339Open in IMG/M
3300034078|Ga0373900_031717All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium911Open in IMG/M
3300034088|Ga0373912_0078821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium837Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.22%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.22%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.48%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.73%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.73%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.73%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.73%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.99%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.99%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.24%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.24%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.24%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.49%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.49%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.49%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.49%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.49%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.49%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.49%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry1.49%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.75%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.75%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.75%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.75%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.75%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.75%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.75%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908039Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4EnvironmentalOpen in IMG/M
2140918024Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009614Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015082Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024240Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T25EnvironmentalOpen in IMG/M
3300025359Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025386Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025406Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025409Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026359Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-AEnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026990Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes)EnvironmentalOpen in IMG/M
3300027334Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028020Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030004Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030908Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033798Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-SEnvironmentalOpen in IMG/M
3300034078Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.1EngineeredOpen in IMG/M
3300034088Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.1EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B3_v_010562102124908039SoilRRVRQVPVPREMKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRR
B_all_v_002511302140918024SoilVSLGKRRVRQVPVPREMKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRR
Ga0062384_10038765613300004082Bog Forest SoilIPVPGEMKKEVEESLRAFAQTQKLLKQIAGVNLELLKERKRQRQ*
Ga0062388_10133124123300004635Bog Forest SoilELKKEVEESLRAFAQTQKVLKQIAQVNLELFKERKRQRR*
Ga0070708_10040666433300005445Corn, Switchgrass And Miscanthus RhizosphereIPIPSELKKDVEESLRAFAQMQKLLRQIAQVNLELFKERKRHRS*
Ga0070735_1022788523300005534Surface SoilEEVEQNLRAFAQLQKVLKQIAQVNLELLKEHKRQRL*
Ga0070731_1011325133300005538Surface SoilELKEEVEESLRAFAQTQSLLKQVAQVNLELLKEHKRQRS*
Ga0066691_1028757913300005586SoilGNRQVRQVPVPSELTKEVEENLRAFAQVQKLLKQIAQVNLELFKERKRQRP*
Ga0070761_1000731613300005591SoilMAEVEESLRALARTRKLIKQIAQINLDLLKERKRRRQ*
Ga0070761_1028348113300005591SoilVRQIPVPREMQSEAEESLHAFAQMQKVLRQIAQVNLELFMERTRQRP*
Ga0066903_10426815023300005764Tropical Forest SoilEVEESLRAFAQTHTLLKQIAQVNLELFKERKRQRP*
Ga0066651_1047839923300006031SoilSELKKQVGESLRAFAQTQKLLKQIAQVNLELFKERKRQRP*
Ga0075019_1009762313300006086WatershedsKEVEASLRAFAQTQKLLKQIGAVNLDLLKERKRQRQ*
Ga0075021_1005123043300006354WatershedsRQVRQIPIPGEMKKEVEESLRAFAQMQKLLKQIAGLNLELLKERKRQRQ*
Ga0066665_1039346013300006796SoilELKKEVEESLHAFAQMQKALKQIAQVNLELFKERKRQRR*
Ga0099793_1047154023300007258Vadose Zone SoilIPSEMKKGVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRQ*
Ga0099830_1053845313300009088Vadose Zone SoilRVRQIPVPRELKKEVEASLRAFAQAQKLLKQIGAVNLELLRERKRQR*
Ga0099828_1043766733300009089Vadose Zone SoilELKKEVEASLRAFAQTQKLLKQIGAVNLELLRERKRQR*
Ga0099828_1188486613300009089Vadose Zone SoilRKVRQIPIPGEFKKEVEDSLRAFAKMRKLLRQIAQVNLDLLKERKRRR*
Ga0099827_1010386043300009090Vadose Zone SoilGNRQVRQIPIPSELKKEVEESLRAFAQMQKVLKQIAQVNLELLRERKRQRP*
Ga0099827_1049934413300009090Vadose Zone SoilVRQIPIPGEFKKEVEDSLRAFAKMRKLLRQIAQVNLDLLKERKRRR*
Ga0116222_146020013300009521Peatlands SoilGELKKEVEESLRAFAQVQKLLKQIAQVNLELFRERKRQRP*
Ga0116104_105532823300009614PeatlandEMKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRR*
Ga0116215_128330913300009672Peatlands SoilRKVRQVPIPNERLSEVEEGLRAFAQTRKLLKQIAQINVDLLKERKRQRQ*
Ga0134070_1034727113300010301Grasslands SoilNRQVRQIPIPSELKKEVEESLRAFAQMQKVLKQIAQVNLELLRERKRQRP*
Ga0134065_1046600113300010326Grasslands SoilSELKKEVEESLRAFAQMQKVLKQIAQVNLELLRERKRQRP*
Ga0136449_10073958533300010379Peatlands SoilLKEEVEESLRAFSQTQKVLKQIAQVNLELLKERKRQRR*
Ga0136449_10115289723300010379Peatlands SoilVRQVPIPGELKKEVEESLRAFAQVQKLLKQIAQVNLELFRERKRQRP*
Ga0136449_10466710813300010379Peatlands SoilEVEESLRAFAQVQKLLKQIAQVNLELFRERKRQRP*
Ga0137389_1094374823300012096Vadose Zone SoilLKKEVEESLRAFAQMQKVLKQIAQVNLELFRERKRQRP*
Ga0137388_1106125913300012189Vadose Zone SoilSEKKKQVEESLSEFAQTQELRKQIGAVNLELLRERKQQR*
Ga0137399_1126858413300012203Vadose Zone SoilGVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRQ*
Ga0137380_1139145923300012206Vadose Zone SoilVRQVPIPSELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS*
Ga0137379_1016832223300012209Vadose Zone SoilMKKEVEESLRAFAQMQKLLKQIAGVNLEVLKERKRRRR*
Ga0137377_1022240033300012211Vadose Zone SoilQVRQIPVPSELKKEVEESLHAFAQMQKALKQIAQVNLELFKERKRQRR*
Ga0137368_1051954113300012358Vadose Zone SoilMKKEVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRP*
Ga0137359_1103025613300012923Vadose Zone SoilRQVRQIPVPSEMKKEVEESLRAFAQMQNVLKQIAQVNLELFKERKRQRP*
Ga0137413_1180965723300012924Vadose Zone SoilLSVSLGSRGVRQVPVPQEMKKEVGESLLAFARAQKLLKQIAGLNLESWKERKRRR*
Ga0137419_1117243423300012925Vadose Zone SoilGNRRVRQIPVPRELKKEVEASLRAFAQTQKLLKQIGAVNLELLRERKRQR*
Ga0137416_1157810613300012927Vadose Zone SoilQVPVPQEMKKEVGESLLAFARAQKLLKQVAGLNLESWKERKRRR*
Ga0137410_1167767913300012944Vadose Zone SoilVPGEMKKEVEGSLRAFAQTQKLLKQIAGVNLELLKERKRQRQ*
Ga0134110_1048144413300012975Grasslands SoilRQVPVPSELKKEVEENLRAFAQVQKLLKQIAQVNLELFKERKRQRP*
Ga0134076_1027467123300012976Grasslands SoilKKEVEESLRAFAQMQDVLKQIAQLNLELFKERKRQRP*
Ga0181532_1029181013300014164BogQVPIPSELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS*
Ga0181528_1055804913300014167BogKVEERLRSFAETQSLLKQIAQVNLELLKERKRQPS*
Ga0182018_1012814423300014489PalsaNRQVRQVPIPSELKEEVEESLRAFAQTQSLLKQIAQVNLELLKERKRQRL*
Ga0182018_1053996813300014489PalsaQVPIPSELKEEVEESLRAFAQTQSLLKQIAQVNLELLKERKRQRS*
Ga0182010_1004378313300014490FenRRVRQVPVPREMKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRR*
Ga0181516_1009862813300014655BogLKKEVEESLRAFAQVQHVLKQIAQVNLELFKERKRQRP*
Ga0182030_1059345133300014838BogVPIELKKEVEESLRAFAQAQNVLKQIAQVNLELFKERKRQRP*
Ga0167662_100632013300015082Glacier Forefield SoilPGEMKKEVEDSLRAFAQTQELLKQIAGINFELLRERKRKR*
Ga0182040_1013674413300016387SoilIPNELRREVEKSLRAFAQTQTLLKQIAQVNLELFKERKRQRR
Ga0187803_1014204513300017934Freshwater SedimentPSDWKKQVEEDLQAFAQAHKVLKQIAQLNLDLLKERKRQRQ
Ga0187783_1062472213300017970Tropical PeatlandIPVPNELRKEVEESLRAFAQTQKVLKQIAQVNLELFKERKRQRP
Ga0187851_1029880013300018046PeatlandMGYFCRAPKPIPSELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQR
Ga0066662_1105392013300018468Grasslands SoilELKKEVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRR
Ga0182031_145170823300019787BogMNKEVEESLRAFAQTQELLKQIAAINLELLRERKRQR
Ga0193707_112253213300019881SoilLKKEVEESLRAFAQTQTLLKQIALVNLELLKDRKRQRT
Ga0210399_1143887613300020581SoilMKKEVGESLLAFAQAQKLLKKIAGVNLESLKERKRRR
Ga0210378_1036131623300021073Groundwater SedimentIPSEMKKGVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRQ
Ga0210406_1087836413300021168SoilQIPIPKERRKEVGENLRAFAQTQKLLKQIAMVNLELLKERKRRR
Ga0210400_1019026433300021170SoilEVEESLRAFARTQNVLKQIAQVNLELLKERKRQER
Ga0210384_1052128523300021432SoilIPVPKEMKKEVGESMLAFAQAQKLLKQIAGVNLESLKERKRR
Ga0210402_1147298813300021478SoilIPGEMKKEVEDSLRAFAQMQKRLKQIAGVNLELLKERKRQQ
Ga0210409_1063098813300021559SoilNRQVRQVPIPSEMKQEVEESLRAFVQVQKLLKQIAQVNLELLKERKRQLP
Ga0224522_111765123300024240SoilRQIPVPRELKKDVEESLRAFAQMQKLLRQIAQVNLELFKERKRQRP
Ga0208322_101505313300025359PeatlandVRQIPIPGEMRKEVEDSLRAFAQTQKLLKQIAGLNLELLKERKRQR
Ga0208585_101334123300025386Arctic Peat SoilVQVPVEMNKEVEDSLRAFAQTQELLKQIAGINFELLRERKRHR
Ga0208035_101051923300025406PeatlandQVPIPSELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS
Ga0208321_103462723300025409PeatlandGEMKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRR
Ga0207692_1024507113300025898Corn, Switchgrass And Miscanthus RhizosphereNRQVRQIPVPGEMKKEVEESLRAFAQMQNVLKQIAQVNLELFKERKRQRT
Ga0209055_120528023300026309SoilEVEESLRAFAQMQKVLKQIAQVNLELLRERKRQRP
Ga0209155_105228823300026316SoilQLPIPSEMKKEVEESLRAFSQMQKVLKQIAQVNLELFKERKRQRP
Ga0209131_108556933300026320Grasslands SoilVPRELKKEVESNLRAFAQAQKLLKQIGAVNLELLRERKRQR
Ga0257163_103411813300026359SoilKKGVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRQ
Ga0256867_1019075513300026535SoilKKEVEESQRAFAQMQKVVKQIAQVNLELFKERKRQRP
Ga0209805_140281013300026542SoilKEVEASLRAFAQTQKLLKQIGAVNLELLRERKRQR
Ga0179587_1052199923300026557Vadose Zone SoilVPSEMKKEVEESLRAFAQMQNVLKQVAQVNLELFKERKRQRP
Ga0207824_103303813300026990Tropical Forest SoilQELKKEVEESLRAFAQMQKVLKQIAQVNLELLKERKRQRP
Ga0209529_102957913300027334Forest SoilEVEDSLRAFAQTQKLLKQIAGLNLELLKERKRQRQ
Ga0209222_105313213300027559Forest SoilQIQVPVEMNKEVEDSLRAFAETQELLKQIAAINLELLRERKRQR
Ga0209007_108630113300027652Forest SoilRQIPVPGEMKKEVEDSLRAFAQTQKLLKQIAGLNLELLKERKRQRQ
Ga0209007_110546113300027652Forest SoilKARQIQVPGEMMKEVEDSLRAFAQTQELLKQIAAINLELLRERKRQR
Ga0209333_108775113300027676Forest SoilIQVPGEMMKGVEDSLRAFAQTQELLKQIAAINLELLRERKRQR
Ga0209530_115718713300027692Forest SoilSLGDRKVRQIQVPDEMMKDVEDSLRAYAQTQELLKQIAAINLELLRERKRQR
Ga0209772_1010432113300027768Bog Forest SoilQIPVPGEMKKEVEDSLRAFAQTQKLLKQIAGVNLELLKERKRQRQ
Ga0209656_1046875613300027812Bog Forest SoilNRKVRQVPIPNARLSEVEEGLRAFAQTRKLLKQIAQINVDLLKERKRRRQ
Ga0209798_1056542323300027843Wetland SedimentAEMKEEVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRL
Ga0209274_1000334033300027853SoilMAEVEESLRALARTRKLIKQIAQINLDLLKERKRRRQ
Ga0209274_1008158213300027853SoilKKEVEDSLRAFAQTHALLKQIAQVNLELFKERKRQRP
Ga0209274_1036103833300027853SoilRQVPVPNELKQEVEESLRAFAQTQKALKQIAQVNLELFKERKHQRP
Ga0209067_1007917413300027898WatershedsRKEVEASLRAFAQTQKLLKQIGAVNLDLLKERKRQRQ
Ga0209415_1087594123300027905Peatlands SoilVPEEMKQEVGESLLAFAQAQKLLKQIGAVNLESLKERKRRR
Ga0265351_102079513300028020SoilKEVEESLRAFAQTQELLKQIAAINLELLRERKRQR
Ga0137415_1073090713300028536Vadose Zone SoilRGVRQVPVPQEMKKEVGESLLAFARAQKLLKQVAGLNLESWKERKRRR
Ga0302153_1016010613300028574BogQVPIPGELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS
Ga0302225_1024338323300028780PalsaELKQEVEESLRAFAQTQKVLKQIAQVNLELFKERKHQRL
Ga0307504_1001323113300028792SoilPRELKKEVEGSLRAFAQMQRVLKQIAQVNLELFKEQKRQRP
Ga0307504_1034698123300028792SoilGITPIPSEMKKGVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRQ
Ga0302227_1015371013300028795PalsaNKEVEDSLRAFAQTQELLKQIAAINLELLRERKRQR
Ga0302199_108759313300028860BogVPIPGELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS
Ga0311362_1131328913300029913BogDRQVRQIPVPGEMKKEVEDSLRAFAQTQKLLKQIAGLNLELLKERKRQRQ
Ga0311347_1090940513300029923FenEVEECLRAFARMQTVLKQIAQVNVDLFKERKRQRP
Ga0311328_1102724713300029939BogQIPIPGEMRKEVEASLRAFAQTQKVLKQIAGVNLELLKERKRQRQ
Ga0311340_1147354813300029943PalsaGNRHVRQVPIPNELKKEVEESLRAFAQTQKVLRQIAQVNLELFKERKRQRP
Ga0311352_1057493513300029944PalsaRQVPVPGEMKKEVGDSLRAFAQTQKLLKQIAGVNLELLKERKRQRQ
Ga0302186_1014405413300030004BogELKEEVEESLRAFAETQSLLKQIAQVNLELLKERKRQRS
Ga0311372_1118291723300030520PalsaDRKVRQIQVPGEMKKEVEDSLRAFAQTQELLKQIAGINLELLRERKRRRQ
Ga0310039_1020741323300030706Peatlands SoilVRQVPIPGELKKEVEESLRAFAQVQKLLKQIAQVNLELFRERKRQRP
Ga0074005_1069367013300030908SoilVPEEMKKEVGESLRAFARTQKLLKQIAAVNVELLKERKRNE
Ga0170824_10475860813300031231Forest SoilPIPSELKKEVEESLRAFAQMQKVLKQIAQVNLELLKERKRQRK
Ga0170820_1516122123300031446Forest SoilLPVPGEMKKEVEESLRAFAQMQNVLKQIAQVNLELFKERKRQRP
Ga0318541_1005463443300031545SoilPNQLKKEVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRP
Ga0318555_1041892023300031640SoilRQVRQIPVPNELRKEVEESLGAFAQTQKVLKQIALLNLELFKERKRQRP
Ga0318574_1090293723300031680SoilPIPNQLKKEVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRP
Ga0310686_10029956313300031708SoilKKEVEESLRAFAQTQKVLKQIAQVNLELFKERKRQRR
Ga0310686_10422720013300031708SoilIPIPGEMKKEVEDSLRAFAQMQKLLKQIAGVNLALLKERKRRQ
Ga0307476_1006372633300031715Hardwood Forest SoilKKEVEDSLRAFAHTQELLKQIAGINLELLRERKRQRR
Ga0318500_1011816913300031724SoilQVRQIPIPNELKKEVEESLRAFAQMQKVLKQIAQVNLELFKERKRRRP
Ga0307468_10012005113300031740Hardwood Forest SoilKEMKKEVGESLLAFAQTQKLLKQIAGVNLESLKERKRRR
Ga0307475_1076992313300031754Hardwood Forest SoilLSVSLGGRKVRQIQVPGEMKKEVEDSLRAFAHTQELLKQIAGINLELLRERKRQRR
Ga0318526_1017823913300031769SoilPGEMKKEVEGSLRAFAQTQKLLKQIAGVNLELLKKRKRRQ
Ga0307478_1104033913300031823Hardwood Forest SoilPIPSELKKEVEESLRAFAQTQKVLKQIAQVNLELFKERKRQRP
Ga0307478_1129816023300031823Hardwood Forest SoilIPKERRKEVGENLRAFAQTQKLLKQIAMVNLELLKERKRRR
Ga0318536_1043198223300031893SoilVPIPNELRREVEKSLRAFAQTQTLLKQIAQVNLELFKERKRQRR
Ga0315283_1016281333300032164SedimentKKEVEESLRAFAQMRKLLKQIAQVNLDLLKERKRQRP
Ga0307472_10242920123300032205Hardwood Forest SoilRELKIEVEESLRAFAQTQKLLKQIGAVNLELLRERKRQR
Ga0335072_1055276723300032898SoilEMKKEVEHSLRAFAQTQELLKQIAGINFELLRERKRQR
Ga0335077_1036234813300033158SoilKREVEESLRAFAQMQKVLKQIAQVNLELFKERKRQRP
Ga0316605_1245898513300033408SoilVRQIPVPSELKKEVEESLKAFAQMQKVLKQIAQVNLDLFKERKRQRQ
Ga0326726_1119406323300033433Peat SoilMEVEQGQRAFAQAQKLLKQIAAVNLEMLKERKRRG
Ga0334821_020334_117_2303300033798SoilMKKEVGESLLAFAQAQKLLKQIGEVNIELLKERKRRL
Ga0373900_031717_133_2493300034078Sediment SlurryMKKEVEESLRAFAQMQKLLKQIAQVNLDLLKERKRQRP
Ga0373912_0078821_10_1263300034088Sediment SlurryMKKEVEESLRAFAQMRRLLKQIAQVNLDLLKEHKRQRP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.