| Basic Information | |
|---|---|
| Family ID | F059321 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LGCRISGLARPELLVEIEVTAVKGAGAGIEWIGPDAADPLDAS |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.76 % |
| % of genes from short scaffolds (< 2000 bps) | 92.54 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.552 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (13.433 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.627 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.791 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.63% β-sheet: 23.94% Coil/Unstructured: 70.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF05685 | Uma2 | 11.94 |
| PF00107 | ADH_zinc_N | 8.96 |
| PF00497 | SBP_bac_3 | 4.48 |
| PF02852 | Pyr_redox_dim | 3.73 |
| PF00578 | AhpC-TSA | 2.99 |
| PF00753 | Lactamase_B | 2.99 |
| PF03330 | DPBB_1 | 2.99 |
| PF02423 | OCD_Mu_crystall | 2.24 |
| PF02417 | Chromate_transp | 2.24 |
| PF13649 | Methyltransf_25 | 2.24 |
| PF08241 | Methyltransf_11 | 2.24 |
| PF07992 | Pyr_redox_2 | 1.49 |
| PF01464 | SLT | 1.49 |
| PF07690 | MFS_1 | 1.49 |
| PF13302 | Acetyltransf_3 | 1.49 |
| PF02720 | DUF222 | 1.49 |
| PF02705 | K_trans | 1.49 |
| PF04392 | ABC_sub_bind | 1.49 |
| PF03061 | 4HBT | 0.75 |
| PF08240 | ADH_N | 0.75 |
| PF04909 | Amidohydro_2 | 0.75 |
| PF00144 | Beta-lactamase | 0.75 |
| PF00528 | BPD_transp_1 | 0.75 |
| PF00656 | Peptidase_C14 | 0.75 |
| PF12146 | Hydrolase_4 | 0.75 |
| PF02313 | Fumarate_red_D | 0.75 |
| PF03473 | MOSC | 0.75 |
| PF13620 | CarboxypepD_reg | 0.75 |
| PF01963 | TraB_PrgY_gumN | 0.75 |
| PF01593 | Amino_oxidase | 0.75 |
| PF01575 | MaoC_dehydratas | 0.75 |
| PF00583 | Acetyltransf_1 | 0.75 |
| PF00581 | Rhodanese | 0.75 |
| PF14226 | DIOX_N | 0.75 |
| PF13267 | DUF4058 | 0.75 |
| PF02585 | PIG-L | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 11.94 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 2.24 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 2.24 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.49 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 1.49 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.75 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG1916 | Pheromone shutdown protein TraB, contains GTxH motif (function unknown) | Function unknown [S] | 0.75 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.75 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.75 |
| COG3080 | Fumarate reductase subunit D | Energy production and conversion [C] | 0.75 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.30 % |
| Unclassified | root | N/A | 9.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_13805009 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
| 3300000564|RepKanNP_BrdU_F12BDRAFT_1013470 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300001431|F14TB_100294225 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300002911|JGI25390J43892_10101663 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 646 | Open in IMG/M |
| 3300003324|soilH2_10364186 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1354 | Open in IMG/M |
| 3300004281|Ga0066397_10098244 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300004463|Ga0063356_101066703 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300004480|Ga0062592_101188898 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300004633|Ga0066395_10130055 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300005181|Ga0066678_10992482 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005332|Ga0066388_101731998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1107 | Open in IMG/M |
| 3300005436|Ga0070713_102168740 | All Organisms → cellular organisms → Archaea | 538 | Open in IMG/M |
| 3300005438|Ga0070701_10662721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
| 3300005457|Ga0070662_101997393 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005547|Ga0070693_101448289 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005549|Ga0070704_100174737 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300005552|Ga0066701_10589027 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005557|Ga0066704_10545380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 756 | Open in IMG/M |
| 3300005578|Ga0068854_101652799 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005713|Ga0066905_100571267 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005713|Ga0066905_101409180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
| 3300005718|Ga0068866_11144456 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005719|Ga0068861_100477687 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1122 | Open in IMG/M |
| 3300005764|Ga0066903_100403471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2251 | Open in IMG/M |
| 3300005841|Ga0068863_100678066 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300006049|Ga0075417_10724736 | Not Available | 512 | Open in IMG/M |
| 3300006169|Ga0082029_1523321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300006845|Ga0075421_101270321 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300006845|Ga0075421_102039934 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006847|Ga0075431_100616607 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300006852|Ga0075433_11460728 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
| 3300006853|Ga0075420_101437802 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
| 3300006880|Ga0075429_100470395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1101 | Open in IMG/M |
| 3300006880|Ga0075429_101344195 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 623 | Open in IMG/M |
| 3300006914|Ga0075436_100957343 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006914|Ga0075436_101072276 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006969|Ga0075419_11413774 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300007076|Ga0075435_101649828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300009012|Ga0066710_102686757 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 711 | Open in IMG/M |
| 3300009100|Ga0075418_12860450 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 527 | Open in IMG/M |
| 3300009137|Ga0066709_102844516 | Not Available | 640 | Open in IMG/M |
| 3300009444|Ga0114945_10786790 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 583 | Open in IMG/M |
| 3300009792|Ga0126374_10253261 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1151 | Open in IMG/M |
| 3300009792|Ga0126374_11223513 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
| 3300009810|Ga0105088_1079045 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009814|Ga0105082_1086506 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300009822|Ga0105066_1175033 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010047|Ga0126382_10041664 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2617 | Open in IMG/M |
| 3300010047|Ga0126382_10417752 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300010048|Ga0126373_10995132 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300010303|Ga0134082_10131668 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300010323|Ga0134086_10271714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 651 | Open in IMG/M |
| 3300010358|Ga0126370_10556131 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300010359|Ga0126376_10494848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1130 | Open in IMG/M |
| 3300010359|Ga0126376_10598723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1042 | Open in IMG/M |
| 3300010361|Ga0126378_10331484 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1629 | Open in IMG/M |
| 3300010362|Ga0126377_10799430 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300010366|Ga0126379_10256403 | Not Available | 1726 | Open in IMG/M |
| 3300010366|Ga0126379_12456561 | Not Available | 620 | Open in IMG/M |
| 3300010376|Ga0126381_100980109 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1219 | Open in IMG/M |
| 3300010376|Ga0126381_102387810 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300010397|Ga0134124_10769751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 959 | Open in IMG/M |
| 3300010398|Ga0126383_10432778 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1360 | Open in IMG/M |
| 3300010398|Ga0126383_10547875 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1222 | Open in IMG/M |
| 3300010398|Ga0126383_13213526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300010403|Ga0134123_10421078 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300010403|Ga0134123_10600557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
| 3300010403|Ga0134123_11368485 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012040|Ga0137461_1056979 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300012174|Ga0137338_1014819 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300012203|Ga0137399_10719185 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 841 | Open in IMG/M |
| 3300012210|Ga0137378_10433531 | Not Available | 1218 | Open in IMG/M |
| 3300012225|Ga0137434_1026582 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300012350|Ga0137372_10530834 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 872 | Open in IMG/M |
| 3300012360|Ga0137375_11207443 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012582|Ga0137358_10034655 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3327 | Open in IMG/M |
| 3300012582|Ga0137358_10236819 | Not Available | 1243 | Open in IMG/M |
| 3300012582|Ga0137358_10812407 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012922|Ga0137394_10138121 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300012929|Ga0137404_10084701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2521 | Open in IMG/M |
| 3300012971|Ga0126369_12185239 | Not Available | 641 | Open in IMG/M |
| 3300013306|Ga0163162_10141261 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2521 | Open in IMG/M |
| 3300014882|Ga0180069_1090955 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300014884|Ga0180104_1089411 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 866 | Open in IMG/M |
| 3300015053|Ga0137405_1009784 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 557 | Open in IMG/M |
| 3300015259|Ga0180085_1250746 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300015358|Ga0134089_10171097 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 865 | Open in IMG/M |
| 3300015359|Ga0134085_10409083 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300017656|Ga0134112_10358394 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
| 3300018078|Ga0184612_10148054 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300018078|Ga0184612_10610634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300018079|Ga0184627_10135567 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1304 | Open in IMG/M |
| 3300018422|Ga0190265_11495084 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 789 | Open in IMG/M |
| 3300018431|Ga0066655_10954635 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300019458|Ga0187892_10065574 | All Organisms → cellular organisms → Bacteria | 2358 | Open in IMG/M |
| 3300021081|Ga0210379_10453047 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300022534|Ga0224452_1073023 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1035 | Open in IMG/M |
| 3300022694|Ga0222623_10056738 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1509 | Open in IMG/M |
| 3300025324|Ga0209640_10273072 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300025558|Ga0210139_1014066 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1503 | Open in IMG/M |
| 3300025580|Ga0210138_1153997 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300025905|Ga0207685_10757898 | Not Available | 532 | Open in IMG/M |
| 3300025918|Ga0207662_10378059 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 956 | Open in IMG/M |
| 3300025922|Ga0207646_11225805 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300025923|Ga0207681_11856715 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300025928|Ga0207700_11728026 | Not Available | 551 | Open in IMG/M |
| 3300026088|Ga0207641_12079016 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300026296|Ga0209235_1048108 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300026297|Ga0209237_1014718 | All Organisms → cellular organisms → Bacteria | 4599 | Open in IMG/M |
| 3300026313|Ga0209761_1210945 | Not Available | 834 | Open in IMG/M |
| 3300026351|Ga0257170_1065057 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027209|Ga0209875_1032467 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300027527|Ga0209684_1036180 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300027654|Ga0209799_1042857 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 1009 | Open in IMG/M |
| 3300027821|Ga0209811_10094804 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1067 | Open in IMG/M |
| 3300027862|Ga0209701_10061877 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300027873|Ga0209814_10256302 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300027880|Ga0209481_10300505 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300027882|Ga0209590_10342487 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300028381|Ga0268264_10595805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1089 | Open in IMG/M |
| 3300028812|Ga0247825_10809001 | Not Available | 677 | Open in IMG/M |
| 3300030006|Ga0299907_10877558 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300031198|Ga0307500_10251379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300031543|Ga0318516_10858498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300031680|Ga0318574_10327073 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 892 | Open in IMG/M |
| 3300031744|Ga0306918_10585126 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 875 | Open in IMG/M |
| 3300031770|Ga0318521_10527772 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 711 | Open in IMG/M |
| 3300031793|Ga0318548_10132318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1210 | Open in IMG/M |
| 3300031833|Ga0310917_10874863 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
| 3300031854|Ga0310904_10324327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
| 3300031997|Ga0315278_11444784 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300032052|Ga0318506_10129638 | Not Available | 1095 | Open in IMG/M |
| 3300033433|Ga0326726_11447295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 669 | Open in IMG/M |
| 3300034664|Ga0314786_167017 | Not Available | 526 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.19% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.22% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.99% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.24% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.75% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.75% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.75% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000564 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_138050092 | 3300000363 | Soil | ARPELVVEIEVAAVKGAGAGIQWIGPDATDPLDA* |
| RepKanNP_BrdU_F12BDRAFT_10134701 | 3300000564 | Soil | CRIAGLARPELLVEVEVAAVRGARNGIEWIGPDAVDPLDRA* |
| F14TB_1002942253 | 3300001431 | Soil | SSLGCRIAGLARPELLVEVEVAAVRGARDGIEWIAPEALDPLDRA* |
| JGI25390J43892_101016631 | 3300002911 | Grasslands Soil | GCRITGLARPELLVEVEVAAVKGAHAGIEWVGPDAADPLDRA* |
| soilH2_103641861 | 3300003324 | Sugarcane Root And Bulk Soil | CRITGLARPELVVEIEVTAVKGASAGIQSIGPDAVDPLDA* |
| Ga0066397_100982443 | 3300004281 | Tropical Forest Soil | PASLGCRISGLARPELLVEIEVTAVKGAGVGIEWIGPDAADPLDAS* |
| Ga0063356_1010667032 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TPFAKSHPASLGCRISGLARPELVVEIEVTAVKGAGANIQWIEPDPVDALDA* |
| Ga0062592_1011888981 | 3300004480 | Soil | GCRIAGLARPELLVEVEVAAVKGARAGIEWIGPDDVDPLDAAKAR* |
| Ga0066395_101300553 | 3300004633 | Tropical Forest Soil | KSGPSSLGCRIAGLARPELLVEVEVAAVKGAHANIEWIAPDPVDPLDRT* |
| Ga0066678_109924822 | 3300005181 | Soil | LGCRIAGLARPGLVVEIEVTAVKGARANIEWIGPDAVDPLDAP* |
| Ga0066388_1017319981 | 3300005332 | Tropical Forest Soil | CRIAGLARPELLVEVEVAAVKGAHAGIEWVGPDAADPLDRA* |
| Ga0070713_1021687401 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LGCRISGLARPELLVEIEVTAVKGAGAGIEWIGPDAADPLDAS* |
| Ga0070701_106627211 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | FAKSHPTSLGCRISGLARPELVVEIEVTAVKGAGAEIQWIGPDATDPLDAS* |
| Ga0070662_1019973931 | 3300005457 | Corn Rhizosphere | HPTSLGCRISGLARPELVVEIEVTAVKGAGTGIQWIGPDATDPLG* |
| Ga0070693_1014482892 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | HPTSLGCRISGLARPELVVEIEVTAVKGAGAAIQWIGPDATDPLDAS* |
| Ga0070704_1001747371 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TPFAKSHPASLGCRISGLARPELIVEIEVTAVKGAGANIQWIEPDPVDALDA* |
| Ga0066701_105890271 | 3300005552 | Soil | SLGCRIAGLARPELLVEVEVAAVKGAHAGIEWVEADAVDALDRA* |
| Ga0066704_105453802 | 3300005557 | Soil | PASLGCRIAGLARPELLVEVEVAAVKGAHAGIEWVGPDADDPLDRA* |
| Ga0068854_1016527992 | 3300005578 | Corn Rhizosphere | SLGCRIAGLARPELLVEVEVTAVKGAHAGIESIGPDATDPLDRG* |
| Ga0066905_1005712671 | 3300005713 | Tropical Forest Soil | YPASLGCRISGLARPELLVEIEVTAVKGGGAGIEWIGPDATDPLDAS* |
| Ga0066905_1014091803 | 3300005713 | Tropical Forest Soil | SLGCRIAGLARPELLVEVEVAAVRGARDGIEWIGPDDVDPLDSR* |
| Ga0068866_111444563 | 3300005718 | Miscanthus Rhizosphere | FAKSHPASLGCRISGLARPELVVEVEVTAVKGAGGGIQWIGPEAVDPLDAS* |
| Ga0068861_1004776872 | 3300005719 | Switchgrass Rhizosphere | SLGCRISGLARPELVVEIEVTAVKGAGANIQWIEPDPVDALDA* |
| Ga0066903_1004034716 | 3300005764 | Tropical Forest Soil | ELLVEVEVAAVKGAHAGIEWIGPDAVDPLDAAPR* |
| Ga0068863_1006780662 | 3300005841 | Switchgrass Rhizosphere | TPFAKSHPASLGCRISGLARPELVVEIEVTAVKGAGANIQWIGPDPVDALDA* |
| Ga0075417_107247362 | 3300006049 | Populus Rhizosphere | TGLARPELLVEIEVSAVKGAGKEIDSIGPDPTDPVG* |
| Ga0082029_15233212 | 3300006169 | Termite Nest | ASLGCRIAGLARPELLVEIEVTAVKGAGANIERVGPDPVDPLDA* |
| Ga0075421_1012703213 | 3300006845 | Populus Rhizosphere | AKSHPTSLGCRISGLARPELVVEIEVTAVKGAGTDIQWIGPDATDPLG* |
| Ga0075421_1020399342 | 3300006845 | Populus Rhizosphere | GCRIAGLARPELLVEIEVLAVKGAGAGIESIGPDPVDPVDR* |
| Ga0075431_1006166071 | 3300006847 | Populus Rhizosphere | ASLGCRISGLARPELVVEVEVAAVKGAGAGIQWIGADPVDPLDGR* |
| Ga0075433_114607281 | 3300006852 | Populus Rhizosphere | ARPELVVEIEVTAVKGAGANIQWIEPDPVDALDA* |
| Ga0075420_1014378021 | 3300006853 | Populus Rhizosphere | LLASALGCRISGLAQPDLVVEIEATAVKGAGRGIQWIGPDAVDPLDAG* |
| Ga0075429_1004703953 | 3300006880 | Populus Rhizosphere | VIAQILLASALGCRISGLAQPDLVVEIEATAVKGAGRGIQWIGPDAMDPLDAG* |
| Ga0075429_1013441951 | 3300006880 | Populus Rhizosphere | PFAKSHPTSLGCRISGLARPELVVEIEVAAVKGAGAGIQWIGPDATDPLDA* |
| Ga0075436_1009573432 | 3300006914 | Populus Rhizosphere | LARPELLVEVEVAAVRGARDGIEWIAPDAVDPLDRAPAS* |
| Ga0075436_1010722762 | 3300006914 | Populus Rhizosphere | GSCPSSLGCRIAGLARPELLVEVEVTAVKGAHASIDWIAPDAIDPVDRS* |
| Ga0075419_114137741 | 3300006969 | Populus Rhizosphere | VIAQILLASALGCRISGLAQPDLVVEIEATAVKGAGRGIQWIGPDAVDPLDAG* |
| Ga0075435_1016498281 | 3300007076 | Populus Rhizosphere | PASLGCRIAGLARPELLVEIEVTAVKGAHANIEWIGPDATDPLDG* |
| Ga0066710_1026867571 | 3300009012 | Grasslands Soil | GLARPELLVEVEVAAVKGAHAGIEWIGPDAVDPLDGGGA |
| Ga0075418_128604502 | 3300009100 | Populus Rhizosphere | GCRISGLARPELVVEVEVTAIKGAGAGIQWIGPDATDPLDT* |
| Ga0066709_1028445162 | 3300009137 | Grasslands Soil | PGSLGCRIAGLARPELLVEVEVAAVKGAHAGIEWIGPDAVDPLDGSGA* |
| Ga0114945_107867901 | 3300009444 | Thermal Springs | LGCRIAGLARPELLVEVEVAAVKGARDGIEWIGPDAVDPLDH* |
| Ga0126374_102532613 | 3300009792 | Tropical Forest Soil | CRISGLARPELLVEIEVTAVKGAGAGIEWIGPDAADPLDAS* |
| Ga0126374_112235132 | 3300009792 | Tropical Forest Soil | RPELLVEVEVAAVKGAHANIEWIAPDPVDPLDRT* |
| Ga0105088_10790452 | 3300009810 | Groundwater Sand | SSLGCRIAGLARPELLVEVEVAAVRGARDGIEWIGPDAVDPLDRA* |
| Ga0105082_10865062 | 3300009814 | Groundwater Sand | PAYFAGSRPTSMDCRIAGLARPELLVEVEITAVKGAGRGIESIGPDPTDPVDR* |
| Ga0105066_11750332 | 3300009822 | Groundwater Sand | AGLARPELLVEVEVAAVRGARDGIEWIGPDAVDVLDLPSV* |
| Ga0126382_100416644 | 3300010047 | Tropical Forest Soil | SLGCRISGLARPEFLVEIEVAAVKGAGAGIEWIGADAVDPLDAS* |
| Ga0126382_104177521 | 3300010047 | Tropical Forest Soil | SCPASLGCRVAALARPELLVEVEVTAIRGAGAAIERIEPEAVDVLDR* |
| Ga0126373_109951321 | 3300010048 | Tropical Forest Soil | KSYPASLGCRISGLARPELLVEIEVTAVKGAGAGIEWIGPDAADPLDAS* |
| Ga0134082_101316683 | 3300010303 | Grasslands Soil | FAKSCPASLGCRIAGLARPELLVEVEVAAVKGAHAGIEWVGPDATDPLDR* |
| Ga0134086_102717141 | 3300010323 | Grasslands Soil | IAGLARPELLVEVEVAAVKGAHAGIEWIAPDAADALDLRPR* |
| Ga0126370_105561311 | 3300010358 | Tropical Forest Soil | GCRISGLARPELLVEIEVTAVKGAGAGIEWIGPDAADPLDAS* |
| Ga0126376_104948481 | 3300010359 | Tropical Forest Soil | LARPELLVEVEVAALKGAHAGIEWIGPDAADPLDRA* |
| Ga0126376_105987232 | 3300010359 | Tropical Forest Soil | CPASLGCRIAGLARPELLVEVEMAAVKGAHASIEWVGPDAADPLDRG* |
| Ga0126378_103314841 | 3300010361 | Tropical Forest Soil | KSCPTSLGCRIAGLAGPELLVEVEVAAVKGAHGGIEWVAPDPVDPLDRV* |
| Ga0126377_107994301 | 3300010362 | Tropical Forest Soil | AKSHPASLGCRITGLARPELLVEIEVTAVKGAGANIEWIGPDTTDPLDA* |
| Ga0126379_102564033 | 3300010366 | Tropical Forest Soil | ARPELLVEIEVTAVKGAGAGIEWIGPDATDPLDAA* |
| Ga0126379_124565612 | 3300010366 | Tropical Forest Soil | AGLARPELLVEVEVAAVKGAHANIEWIGPDPVDPLDGA* |
| Ga0126381_1009801091 | 3300010376 | Tropical Forest Soil | KSHPASLGCRISGLARPELLVEIEVTAVKGAGAGIEWIGPDAADPLDAS* |
| Ga0126381_1023878102 | 3300010376 | Tropical Forest Soil | HPDLLVEVEVAAVKGAHAGIEWVSPDAQDPLDGPST* |
| Ga0134124_107697512 | 3300010397 | Terrestrial Soil | GCRISGLARPELIVEIEVTAVKGAGANIQWIEPDPVDALDA* |
| Ga0126383_104327781 | 3300010398 | Tropical Forest Soil | SAPSSLGCRVSGLARPELLVEVEVAAVKGAHAGIEWIGPDAVDPLDAAPR* |
| Ga0126383_105478753 | 3300010398 | Tropical Forest Soil | PASLGCRISGLARPELLVEIEVTAVKGAGAGIEWIGPDAADPLDAS* |
| Ga0126383_132135261 | 3300010398 | Tropical Forest Soil | RVAGLARPELLVEVEVAAVKGAHAGIEWVAPDAVDPLDRV* |
| Ga0134123_104210781 | 3300010403 | Terrestrial Soil | KSHPTSLGCRISGLARPELVVEIEVTAVKGAGTDIQWIGPDATDPLG* |
| Ga0134123_106005571 | 3300010403 | Terrestrial Soil | ARPELVVEIEVTAVKGAGANIPWIEPDPVDALDA* |
| Ga0134123_113684852 | 3300010403 | Terrestrial Soil | MGCRIMGLARPELLVEVEVMAVKGAGTGIEAIGPDPVDPVDR* |
| Ga0137461_10569791 | 3300012040 | Soil | PTSLGCRISGLARSELVVEVEVTAVKGAGAGIQWIGPDATDPLDAD* |
| Ga0137338_10148191 | 3300012174 | Soil | TGPTARPELLVEVEVAAVKGAGAAIEWIAHDPVDVLDR* |
| Ga0137399_107191852 | 3300012203 | Vadose Zone Soil | RPELLVEVEVTAVKGAHAGIAWVSPDAVDPLDRI* |
| Ga0137378_104335311 | 3300012210 | Vadose Zone Soil | LARPELLVEVEVTAVKGAHAGIESIGPDPTDPLDRG* |
| Ga0137434_10265822 | 3300012225 | Soil | LGCRISGLARSELVVEVEVTAVKGAGAGIQWIGPDATDPLDAD* |
| Ga0137372_105308341 | 3300012350 | Vadose Zone Soil | AGLARPELLVEVEVAAVKGAHAGIEWIGPDAVDPLDGGGA* |
| Ga0137375_112074432 | 3300012360 | Vadose Zone Soil | ELLVEVEVAAVKGARAGIEWIGPDEVDPLDAVTGW* |
| Ga0137358_100346551 | 3300012582 | Vadose Zone Soil | AWFAKSCPASLVCRIAGLARPELLVEVEVTAVKGAHAGIAWVSPDAVDPLDRI* |
| Ga0137358_102368194 | 3300012582 | Vadose Zone Soil | CRIAGLARPELLVEVEVAAVKNAHAGIEWVGPDAADPLDRA* |
| Ga0137358_108124071 | 3300012582 | Vadose Zone Soil | PTSLGCRISGLARPELLVEVEVTAVKGAGAGIQWIAPDAVDPLDD* |
| Ga0137394_101381211 | 3300012922 | Vadose Zone Soil | GCRISGLARPELVVEVEVTAVKGAGGGIQWIGPDAVDPLDAS* |
| Ga0137404_100847013 | 3300012929 | Vadose Zone Soil | IAGLARPELLVEVEVTAVKGAHAGIAWVSPDAVDPLDRI* |
| Ga0126369_121852392 | 3300012971 | Tropical Forest Soil | CRVAALARPELLVEVEALAIKGARVDIEQVAPDVIDPLDAR* |
| Ga0163162_101412611 | 3300013306 | Switchgrass Rhizosphere | CRISGLARPELVVEVEVTAVKGAGGGIQWIGPDAVDPLDAS* |
| Ga0180069_10909551 | 3300014882 | Soil | SHPTSLGCRISGLARSELVGEVEVTAVKGAGAGIQWIGPDATDPLDAD* |
| Ga0180104_10894111 | 3300014884 | Soil | TSLGCRIAGLARPELLVEVEVAALKGAGANIEWIAPDEVDPLDER* |
| Ga0137405_10097841 | 3300015053 | Vadose Zone Soil | AGLARPELLVEVEVTAVKGAHAGIAWVSPDAVDPLDRI* |
| Ga0180085_12507461 | 3300015259 | Soil | TARPELLVEVEVAAVKGAGAAIEWIAPDPVDVLDR* |
| Ga0134089_101710972 | 3300015358 | Grasslands Soil | RPELLVEVEVAAVKGAHAGIEWVEADAVDALDRA* |
| Ga0134085_104090832 | 3300015359 | Grasslands Soil | RPDLLLEVEVAAVRGARDGIEWVGPDAVDPLDRPRTG* |
| Ga0134112_103583941 | 3300017656 | Grasslands Soil | VSLGCRIAGLARPELLVEVEVAAVKGAHAGIEWIGPDAVDPLDGGGA |
| Ga0184612_101480541 | 3300018078 | Groundwater Sediment | TSLGCRISGLARSELVVEVEVTAVKGAGAGIQWIGPDATDPLDAD |
| Ga0184612_106106341 | 3300018078 | Groundwater Sediment | GCRISGLARPELVVEVEVTAVKGAGAGIQWIGPDVADPLDGADPLDGA |
| Ga0184627_101355671 | 3300018079 | Groundwater Sediment | SHPTSLGCRISGLARPELVVEVEVTAIKGAGAGIQWIGPDAADPLDGA |
| Ga0190265_114950842 | 3300018422 | Soil | SLGCRISGLARPELVVEVEVTAVRGAGTGIQWIGPDAVDPLDAH |
| Ga0066655_109546351 | 3300018431 | Grasslands Soil | KSCHASLGCRIAGLARPELLVEVEVAAVKGAHAGIEWVGPDADDPLDRA |
| Ga0187892_100655745 | 3300019458 | Bio-Ooze | LARSELVVEVEVTAVKGAGAGIQWIGPDATDPLDAD |
| Ga0210379_104530471 | 3300021081 | Groundwater Sediment | PASLGCRIAGLARPELVVEVEVTAVKGAGAAIESIGPDPVDPLDAATAGGR |
| Ga0224452_10730231 | 3300022534 | Groundwater Sediment | ISGLARPELVVEVEVTAVKGAGAGIQWIGPDVADPLDGA |
| Ga0222623_100567383 | 3300022694 | Groundwater Sediment | GLARPELVVEVEVTAVKGAGAGIQWIGPDVADPLDGA |
| Ga0209640_102730723 | 3300025324 | Soil | GCRISGLARPELVVEIEVSAVKGAGAGIQWIGPDPTDPLDAA |
| Ga0210139_10140662 | 3300025558 | Natural And Restored Wetlands | ISGLARPELLVEVEVTAIKGAHAAIERVGPDVRDPLDA |
| Ga0210138_11539971 | 3300025580 | Natural And Restored Wetlands | GCRISGLARPELLVEVEVTAVKGAGAGIEWLGPDAVDPLDAS |
| Ga0207685_107578981 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SLGCRISGLARPELLVEIEVTAVKGAGAGIEWIGPDAADPLDAS |
| Ga0207662_103780591 | 3300025918 | Switchgrass Rhizosphere | PFAKSHPASLGCRISGLARPELIVEIEVTAVKGAGANIQWIEPDPVDALDA |
| Ga0207646_112258051 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RPELLVEVEVAAVKGARAGIEWIGPDEVDPLDAATAR |
| Ga0207681_118567153 | 3300025923 | Switchgrass Rhizosphere | AKSHPTSLGCRISGLARPELVVEVEVTAVKGAGGGIQWIGPDAVDPLDAS |
| Ga0207700_117280261 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RPASLGCRISGLARPELLVEIEVTAVKGAGAGIEWIGPDAADPLDAS |
| Ga0207641_120790161 | 3300026088 | Switchgrass Rhizosphere | LGCRIAGLARPELLVEVEVAAVKGARAGIEWIGPDDVDPLDAASGR |
| Ga0209235_10481083 | 3300026296 | Grasslands Soil | GCRIAGLARPELLVEVEVAAVKGAHAGIEWVAPDAVDALDLRPG |
| Ga0209237_10147188 | 3300026297 | Grasslands Soil | GCRIAGLARPELLVEVEVAAVKGAHAGIEWVGPDADDPLDRA |
| Ga0209761_12109451 | 3300026313 | Grasslands Soil | SCPASLGCRIAGLARPELLVEVEVAAVKGAHAGIEWVGPDADDPLDRA |
| Ga0257170_10650572 | 3300026351 | Soil | CRISGLARSELVVEVEVTAVKGAGAGIQWIGPDATDPLDAD |
| Ga0209875_10324672 | 3300027209 | Groundwater Sand | AGLARPELLVEVEVAAVRGARDGIEWVEADAVDALDRA |
| Ga0209684_10361802 | 3300027527 | Tropical Forest Soil | KSHPASLGCRISGLARPELLVEVEVSAVKGAGAGIEWIGPDAADPLDAS |
| Ga0209799_10428571 | 3300027654 | Tropical Forest Soil | ARPELLVEIEVAAVKGAGVGIEWIGPDAADPLDAS |
| Ga0209811_100948041 | 3300027821 | Surface Soil | WFAKSCPSSLGCRIAGLARPELVVEVEVTAVKGAHAGIESIGPDATDPLDRG |
| Ga0209701_100618775 | 3300027862 | Vadose Zone Soil | SLGCRISGLARSELVVEVEVTAVKGAGAGIQWIGPDATDPLDAD |
| Ga0209814_102563022 | 3300027873 | Populus Rhizosphere | PELLVEVEVAAVRGARDGIEWIAPDAVDPLDRAPAT |
| Ga0209481_103005053 | 3300027880 | Populus Rhizosphere | GLARPELVVEVEVTAVKGAGAGIQWIGPDETDPLDAR |
| Ga0209590_103424873 | 3300027882 | Vadose Zone Soil | HHELLVEVEVAALKGAHANIEWIGPDAVDPLDRSAV |
| Ga0268264_105958053 | 3300028381 | Switchgrass Rhizosphere | PSSLGCRIAGLARPELLVEVEVAAVKGARAGIEWIGPDDVDPLDAATAR |
| Ga0247825_108090012 | 3300028812 | Soil | TSLGCRISGLAQPELVVEVEVTAVKGAGGGIQWIGPDAVDPLDAS |
| Ga0299907_108775582 | 3300030006 | Soil | GAEVNRPYGQGPAWFAGSRPAALGCRIAALARPELLVEIEVAAVKGAGAGIERIGPDELDPVDRMR |
| Ga0307500_102513792 | 3300031198 | Soil | ASLGCRITGLARPELVVEIEVTAVKGAGANIQWIAPDPVDALDA |
| Ga0318516_108584981 | 3300031543 | Soil | SCPASLGCRIAGLTRPELLVEVEVAAVKGAHAGIEWVGPDAADPLDRA |
| Ga0318574_103270731 | 3300031680 | Soil | RIAGLARPELLVEVEVAAVKGAHANIEWVAADPVDPLDRT |
| Ga0306918_105851261 | 3300031744 | Soil | CRIAGLARPELLVEVEVAAVKGAHAGIEWVGPDAADPLDRA |
| Ga0318521_105277721 | 3300031770 | Soil | LARPELLVEVEVAAVKGAHANIEWVAADPVDPLDRT |
| Ga0318548_101323181 | 3300031793 | Soil | GLTRPELLVEVEVAAVKGAHAGIEWVGPDAADPLDRA |
| Ga0310917_108748631 | 3300031833 | Soil | GPSSLGCRIAGLARPELLVEVEVAAVKGAHANIEWVAADPVDPLDRT |
| Ga0310904_103243271 | 3300031854 | Soil | SRRILLASALGCRISGLAQPDLVVEIEVTAVKGAGSGIQWIGPDTVDPLDAG |
| Ga0315278_114447841 | 3300031997 | Sediment | ARPELLVEIEVAAVKGARAGIEWIGPDEVDPLDAAPAR |
| Ga0318506_101296381 | 3300032052 | Soil | SGLARPELLVEIEVTAVKGAGAGIEWIGPDATDPLDAS |
| Ga0326726_114472952 | 3300033433 | Peat Soil | WFAASCPTSLGCRVSGLARPELLVEVEVAAIKGAGAGIEWIAPDPVDPLDAA |
| Ga0314786_167017_1_141 | 3300034664 | Soil | PTSLGCRISGLAQPELVVEVEVTAVKGAGGGIQWIGPDAVDPLDAS |
| ⦗Top⦘ |