Basic Information | |
---|---|
Family ID | F059254 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 134 |
Average Sequence Length | 44 residues |
Representative Sequence | LKVLATRRYPGPAFDELGDVEVLALAELESPRPDVEVLVVANEP |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 69.70 % |
% of genes near scaffold ends (potentially truncated) | 97.76 % |
% of genes from short scaffolds (< 2000 bps) | 91.79 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.67 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.791 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.910 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.343 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.731 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.72% β-sheet: 15.28% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF00413 | Peptidase_M10 | 40.30 |
PF00580 | UvrD-helicase | 14.18 |
PF13361 | UvrD_C | 4.48 |
PF06267 | DUF1028 | 2.24 |
PF02811 | PHP | 2.24 |
PF00082 | Peptidase_S8 | 2.24 |
PF04199 | Cyclase | 1.49 |
PF00005 | ABC_tran | 1.49 |
PF12804 | NTP_transf_3 | 1.49 |
PF02274 | ADI | 1.49 |
PF00565 | SNase | 0.75 |
PF13365 | Trypsin_2 | 0.75 |
PF07883 | Cupin_2 | 0.75 |
PF08823 | PG_binding_2 | 0.75 |
PF12681 | Glyoxalase_2 | 0.75 |
PF01654 | Cyt_bd_oxida_I | 0.75 |
PF00498 | FHA | 0.75 |
PF01933 | CofD | 0.75 |
PF14333 | DUF4389 | 0.75 |
PF02826 | 2-Hacid_dh_C | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 40.30 |
COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 14.18 |
COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 14.18 |
COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 14.18 |
COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 2.99 |
COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 1.49 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.49 |
COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 1.49 |
COG4874 | Uncharacterized conserved protein | Function unknown [S] | 1.49 |
COG0391 | Archaeal 2-phospho-L-lactate transferase/Bacterial gluconeogenesis factor, CofD/UPF0052 family | Carbohydrate transport and metabolism [G] | 0.75 |
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.79 % |
Unclassified | root | N/A | 8.21 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725002|GPICC_F5MS3JC01EPZIH | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
2170459021|G14TP7Y01B262B | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
2209111007|2215229300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2135739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2415177 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101174401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
3300000891|JGI10214J12806_10352436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
3300000891|JGI10214J12806_12046480 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300000956|JGI10216J12902_103507602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1069 | Open in IMG/M |
3300000956|JGI10216J12902_108911022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1356 | Open in IMG/M |
3300000956|JGI10216J12902_123343470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
3300001537|A2065W1_10565835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
3300001686|C688J18823_10332807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
3300001686|C688J18823_10632067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
3300001686|C688J18823_10697105 | Not Available | 646 | Open in IMG/M |
3300004013|Ga0055465_10081998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 933 | Open in IMG/M |
3300004081|Ga0063454_100450506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 884 | Open in IMG/M |
3300004156|Ga0062589_101202923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
3300005093|Ga0062594_100191480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1411 | Open in IMG/M |
3300005164|Ga0066815_10038652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300005180|Ga0066685_10265165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1186 | Open in IMG/M |
3300005184|Ga0066671_10208557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1180 | Open in IMG/M |
3300005440|Ga0070705_100652861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
3300005444|Ga0070694_100720611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
3300005468|Ga0070707_100083039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3095 | Open in IMG/M |
3300005535|Ga0070684_101032105 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300005552|Ga0066701_10026432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2964 | Open in IMG/M |
3300005553|Ga0066695_10306356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
3300005558|Ga0066698_10235560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1260 | Open in IMG/M |
3300005561|Ga0066699_10410133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
3300005575|Ga0066702_10614254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
3300005575|Ga0066702_10962270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
3300005578|Ga0068854_101295717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
3300005615|Ga0070702_101568805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300005713|Ga0066905_101096931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
3300005842|Ga0068858_100571748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1095 | Open in IMG/M |
3300006048|Ga0075363_100980005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300006173|Ga0070716_101291709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
3300006194|Ga0075427_10027389 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300006575|Ga0074053_11753041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300006576|Ga0074047_12012264 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
3300006755|Ga0079222_12458081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300006797|Ga0066659_11200241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
3300006876|Ga0079217_10578816 | Not Available | 722 | Open in IMG/M |
3300006903|Ga0075426_11341555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300007076|Ga0075435_100682794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
3300009101|Ga0105247_11482195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300009137|Ga0066709_101670555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
3300009147|Ga0114129_13195915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
3300009840|Ga0126313_10648825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
3300010325|Ga0134064_10342143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
3300010326|Ga0134065_10079430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1059 | Open in IMG/M |
3300010333|Ga0134080_10626999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
3300010373|Ga0134128_12454386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
3300010999|Ga0138505_100005181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1341 | Open in IMG/M |
3300011269|Ga0137392_10905204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
3300011991|Ga0120153_1022222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1414 | Open in IMG/M |
3300012198|Ga0137364_11153114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
3300012201|Ga0137365_11158297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
3300012204|Ga0137374_10572121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
3300012209|Ga0137379_10485619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1144 | Open in IMG/M |
3300012353|Ga0137367_10776765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
3300012354|Ga0137366_10852984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
3300012356|Ga0137371_10361933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
3300012356|Ga0137371_10429863 | Not Available | 1023 | Open in IMG/M |
3300012358|Ga0137368_10348073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 986 | Open in IMG/M |
3300012510|Ga0157316_1004285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1075 | Open in IMG/M |
3300012685|Ga0137397_10149464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1730 | Open in IMG/M |
3300012918|Ga0137396_10685896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
3300012948|Ga0126375_11521349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
3300012957|Ga0164303_11479414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
3300012960|Ga0164301_10941883 | Not Available | 674 | Open in IMG/M |
3300012961|Ga0164302_10450184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 894 | Open in IMG/M |
3300012961|Ga0164302_11774256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300012986|Ga0164304_10997710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
3300012988|Ga0164306_11268180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
3300012989|Ga0164305_10874602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
3300013306|Ga0163162_10965428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
3300014150|Ga0134081_10415650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300014259|Ga0075311_1172422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
3300014272|Ga0075327_1058524 | Not Available | 1144 | Open in IMG/M |
3300014301|Ga0075323_1117751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
3300014314|Ga0075316_1048175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 919 | Open in IMG/M |
3300014745|Ga0157377_11278617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
3300015077|Ga0173483_10214150 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300015242|Ga0137412_11050781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
3300015356|Ga0134073_10351310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
3300015373|Ga0132257_100000126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 46376 | Open in IMG/M |
3300015374|Ga0132255_104698443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
3300018027|Ga0184605_10440759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300018052|Ga0184638_1086226 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300018071|Ga0184618_10021752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2110 | Open in IMG/M |
3300019361|Ga0173482_10586119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
3300021080|Ga0210382_10032395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1972 | Open in IMG/M |
3300021445|Ga0182009_10585278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
3300022756|Ga0222622_10176680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1399 | Open in IMG/M |
3300025167|Ga0209642_10405743 | Not Available | 763 | Open in IMG/M |
3300025567|Ga0210076_1027188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1224 | Open in IMG/M |
3300025567|Ga0210076_1046146 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300025910|Ga0207684_10486052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1059 | Open in IMG/M |
3300025941|Ga0207711_11658201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300025961|Ga0207712_10052320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2860 | Open in IMG/M |
3300026023|Ga0207677_10037526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3168 | Open in IMG/M |
3300026040|Ga0208144_1017793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
3300026062|Ga0208654_1034760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
3300026317|Ga0209154_1240678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
3300026325|Ga0209152_10144420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 905 | Open in IMG/M |
3300026548|Ga0209161_10131423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1467 | Open in IMG/M |
3300026550|Ga0209474_10426166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
3300027169|Ga0209897_1038471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 692 | Open in IMG/M |
3300027561|Ga0209887_1017421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1770 | Open in IMG/M |
3300027775|Ga0209177_10210053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
3300027957|Ga0209857_1068613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 609 | Open in IMG/M |
3300028592|Ga0247822_10080010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2326 | Open in IMG/M |
3300028714|Ga0307309_10017778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1351 | Open in IMG/M |
3300028716|Ga0307311_10227289 | Not Available | 551 | Open in IMG/M |
3300028719|Ga0307301_10300427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
3300028744|Ga0307318_10142338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 821 | Open in IMG/M |
3300028744|Ga0307318_10296070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
3300028784|Ga0307282_10116005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1252 | Open in IMG/M |
3300028787|Ga0307323_10274040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
3300028796|Ga0307287_10283770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 626 | Open in IMG/M |
3300028807|Ga0307305_10103349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1316 | Open in IMG/M |
3300028811|Ga0307292_10236729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 756 | Open in IMG/M |
3300028811|Ga0307292_10421458 | Not Available | 568 | Open in IMG/M |
3300028876|Ga0307286_10118125 | Not Available | 939 | Open in IMG/M |
3300028884|Ga0307308_10082734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1523 | Open in IMG/M |
3300028885|Ga0307304_10257076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300031226|Ga0307497_10163446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 935 | Open in IMG/M |
3300031854|Ga0310904_11098355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
3300031996|Ga0308176_10121272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2341 | Open in IMG/M |
3300032013|Ga0310906_10037491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2275 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.42% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.45% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.99% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.99% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.99% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.24% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.24% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.24% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.24% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.49% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.49% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.75% |
Speleothem And Rock Wall Surfaces | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces | 0.75% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725002 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
2209111007 | Cave microbial community (Dry rock wall) | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026040 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICC_01994690 | 2067725002 | Soil | VKVLATRRYPGRALDELDVEVLPLTDLREPRDDVEALI |
L02_00504990 | 2170459007 | Grass Soil | RLPGPAWDELRDVEVGPLGERREDVEAIVVANERVDEAMLDLLPSL |
4NP_02857980 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | LKVLATRRYPGPAFEELADVEVGSLADLHAPRPDVQALLVANETVPR |
2214298991 | 2209111007 | Speleothem And Rock Wall Surfaces | VRILATRRYPGPAFDELEGVEVRPLAELDAARPDVEGLVV |
ICChiseqgaiiDRAFT_21357391 | 3300000033 | Soil | LKVLATQRYPGPAFDELGHVEVRALAELKGPRPEVEALVVANEPVPLDLLPEL |
ICChiseqgaiiDRAFT_24151771 | 3300000033 | Soil | VRVLATRRYPGPALDELSDLEIATLASLDGPRADVEGLVVANERPPLE |
INPhiseqgaiiFebDRAFT_1011744011 | 3300000364 | Soil | LKVLATRRYPGPAFDELGDVEIGAPEARDDVEALIV |
JGI10214J12806_103524362 | 3300000891 | Soil | VKVLATRRYPGPAFEELDDVEVFPLSELAAPRPDVEAL |
JGI10214J12806_120464803 | 3300000891 | Soil | VKVLATRRYPGPALHELADLEIAPLASLDAPRPDVEGLVVANEPPPL |
JGI10216J12902_1035076023 | 3300000956 | Soil | LKVLATHRYPGPAFDELGDVEVRALAELEAPRPDVEALVVANEPVPLDLLPGLRL |
JGI10216J12902_1089110223 | 3300000956 | Soil | LKVLATRRYPGPAFDELLDVEVGPLEAHANIEALVVANEPVDPAAFPSLRL |
JGI10216J12902_1233434701 | 3300000956 | Soil | LKVLATRRYPGPAFDELGEVEVGALEPREDVEALIVANEPIDAAHFPSLRL |
A2065W1_105658352 | 3300001537 | Permafrost | LKVLSTRKYPGPAFDELADVEVQPLAELTSPRPQVEALVVANEPVP |
C688J18823_103328071 | 3300001686 | Soil | LKVLATRRYPGPAFDELGDVEVRALGELRSARPDVQALLVANEPVPLDLLPAL |
C688J18823_106320672 | 3300001686 | Soil | LKVLATRRYPGPAFDELGDVEVGPLQPRGDVEALLVANEPVDASDF |
C688J18823_106971051 | 3300001686 | Soil | VKILSTRRYPGRAFDELREVEVVPLASLGEPREDVEGLLVANEPV |
Ga0055465_100819982 | 3300004013 | Natural And Restored Wetlands | VKVLSTRRYPGPAFDELPDVVVAALDHLREPDPGIEALIV |
Ga0063454_1004505061 | 3300004081 | Soil | VRVLATRRYPGPAFAELDDVEIAALEEVTEPRRGVEALIGGNERVDAA |
Ga0062589_1012029232 | 3300004156 | Soil | LKVLATRRYPGPAFEELRDVEVGELRPRDDVEALVVANDPVEPAHFP |
Ga0062594_1001914801 | 3300005093 | Soil | LKILATRRYPGPAFDELGDAEIGPLRPRDDVEVLVVANEP |
Ga0066815_100386522 | 3300005164 | Soil | MLAGVKVFATRRYPGPAFDELDDVEVAPLERLEAPRDDVEGLIVANEPVPLDLLPSL |
Ga0066685_102651653 | 3300005180 | Soil | LKVLATHRYPGPAFDELGDVEVRALADLESPRPEVEALVVANEPVPLDLLPGLR |
Ga0066671_102085573 | 3300005184 | Soil | LKVLAARRYPGPALAELSDMEVLAPSELWSRRPDVEVLIVANEPVPFDLLPS |
Ga0070705_1006528612 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAGVKVFATRRYPGPAFDELDDVEVAPLVQLDAPRDDVEGLVVANEPVP |
Ga0070694_1007206112 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAGVKVFATRRYPGPAFDELDDVEVAPLVQLDAPRDDVEGLVV |
Ga0070707_1000830394 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LKVLATRRYPGPAFDELTDVEIGPLSKPRPDVQAVVVANEPVP |
Ga0070684_1010321051 | 3300005535 | Corn Rhizosphere | MLAVVKVFATRRYPGPAFDELGDVEVAPLDALEGPRDDVSGLIVANEPVPLERF |
Ga0066701_100264321 | 3300005552 | Soil | LKVLATRRYPGPAFDELSEVEVGPLSARREDVEAVIVA |
Ga0066695_103063561 | 3300005553 | Soil | LKVLATRRYPGPAFDELGDVEIGQLESRDDVDALIVANEPVDG |
Ga0066698_102355603 | 3300005558 | Soil | MSAWETRALKVLATRRYPGPAFDELTNVEIGPLSEPRPDVEAVIVANEP |
Ga0066699_104101333 | 3300005561 | Soil | LKVLATRRYPGPAFDELADVDVGPLTARPDVEGLIV |
Ga0066702_106142541 | 3300005575 | Soil | LKVLATRRYPGPAFDELEDVEVAPLETVTAPQDDIEALIVANEAVPLD |
Ga0066702_109622702 | 3300005575 | Soil | LKVLATRRYPGAAFDELGDVEIRPLEAHDDVEALIVANE |
Ga0068854_1012957172 | 3300005578 | Corn Rhizosphere | MLAGVKVFATRRYPGPAFDELDDVEVAPLVELDAPRDDVEG |
Ga0070702_1015688051 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAVVKVFATRRYPGPAFDELGDVELAPLDALEDPREDVGGLI |
Ga0066905_1010969311 | 3300005713 | Tropical Forest Soil | LKVLATRRYPGPAFEELGDVEIGPLQPRADVEALMVANEPVDPGAFPALGL |
Ga0068858_1005717483 | 3300005842 | Switchgrass Rhizosphere | LKVLATRRYPGPAFDELGDVEVRALGELESARPDV |
Ga0075363_1009800052 | 3300006048 | Populus Endosphere | VKILATRRYPGPAFDELDDVEVLALSELTAPRPDVEALV |
Ga0070716_1012917092 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LKVLATRRYPGPAFDELGDVEVRALGELESARPDVEALLVA |
Ga0075427_100273891 | 3300006194 | Populus Rhizosphere | VKVLATRRYPGPALDELSDLEIATLASLDGPRADVEGLVVANERPPLELL |
Ga0074053_117530412 | 3300006575 | Soil | MLAGVKVFATRRYPGPAFDELGDVEVGPLERLEAPRDD |
Ga0074047_120122644 | 3300006576 | Soil | VKILSTRRYPGPAFDELDDVEVQPLAELDSSRPDIEGLVVANEPVPLDLLP |
Ga0079222_124580812 | 3300006755 | Agricultural Soil | MLAGVKVFATRRYPGPAFDELGDVEVAPLEAAGEDVEGLVVANEPVPL |
Ga0066659_112002411 | 3300006797 | Soil | MRIIATRRYPGPAFDELTDVEVLPLTALGGPRPGVEGLVVANEPVPFDLL |
Ga0079217_105788161 | 3300006876 | Agricultural Soil | VKVLATRRYPGPAFDELGDVEISSLGLERPRPDVEGMI |
Ga0075426_113415551 | 3300006903 | Populus Rhizosphere | VKVLATRRYPGPAFDELDDVEVLALSELTALRPDVEALVVANEPPPLDLLPDLR |
Ga0075435_1006827943 | 3300007076 | Populus Rhizosphere | LKVLATRRYPGPAFDELRDVEIGAPSSPRSDVVVVIVANEPVPLD |
Ga0105247_114821951 | 3300009101 | Switchgrass Rhizosphere | MLAGVKVFATRRYPGPAFDELDDVEVAPLVQLDAPRDDVEGLVVANEPVPLDLLPR |
Ga0066709_1016705552 | 3300009137 | Grasslands Soil | LKVLATRRYPGPGFEELRDVEVGELRPRHDVEALVVATD |
Ga0114129_131959151 | 3300009147 | Populus Rhizosphere | VKVLATRRYPGPALDELSDLEIATLASLDGPRADVEGLVVANERPPLELLPSLR |
Ga0126313_106488251 | 3300009840 | Serpentine Soil | LKVLATRRYPGPAFDELDDVEVGPLEPRPDVEALIV |
Ga0134064_103421432 | 3300010325 | Grasslands Soil | LKVLATRRYPGPAFEELRDAEVGSLSAPRDGVEAVI |
Ga0134065_100794303 | 3300010326 | Grasslands Soil | LKILATRRYPGPAFDELGDVEVGQLQPRDDVEVLV |
Ga0134080_106269992 | 3300010333 | Grasslands Soil | MLAAVVKVLATRRYPGPAFEELDVEVLPLDALASARNDVEGLIVANEE |
Ga0134128_124543861 | 3300010373 | Terrestrial Soil | LKILATRRYPGPAFDELGDAEIGPLRPRDDVEVLVVANEPVDPAAFPALRL |
Ga0138505_1000051813 | 3300010999 | Soil | LKVLATRRYPGPAFDELGDVEVRALAELQSARPDVEALL |
Ga0137392_109052041 | 3300011269 | Vadose Zone Soil | LKVLATRRYPGPAFDELADVEVRALAELTTPRPDVEALVVAN |
Ga0120153_10222223 | 3300011991 | Permafrost | LKVLATRRYPGPAFDELGDVEVRALAELESPRPEVEALVVANEPVPLDLLPGLRL |
Ga0137389_110115591 | 3300012096 | Vadose Zone Soil | VKVLSTHRLPGPAWEELRDVEVAALGARREDVEALIVANERVDEATLDLLPS |
Ga0137364_111531142 | 3300012198 | Vadose Zone Soil | LKVLATHRYPGPAFDELGDVEVQALADLQSPRPEVEALV |
Ga0137365_111582972 | 3300012201 | Vadose Zone Soil | LKVLATRRYPGPAFDELADVDVRALAELVSPRPDVEGLVVANEPVPVELLPGLR |
Ga0137374_105721211 | 3300012204 | Vadose Zone Soil | LKVLATRRYPGPAFEELSDAEVAPLEPREDVEVLIVAN |
Ga0137379_104856191 | 3300012209 | Vadose Zone Soil | LKVLATHRYPGAPFDERGDVEVRALADLESPRLELEALVVANEPVPLDLQPG |
Ga0137367_107767651 | 3300012353 | Vadose Zone Soil | LKVLATRRYPGPAFEELGDVEVGPLTPRDDVEAVIVANEP |
Ga0137366_108529842 | 3300012354 | Vadose Zone Soil | LKVLATRRYPGPAFDELADVEVGPLEAAPAGVEALVVANEP |
Ga0137371_103619331 | 3300012356 | Vadose Zone Soil | MSACETHALKVLATRRYPGSAFEELSDVEVMPLAALTEPRHDVEGLIVANEP |
Ga0137371_104298631 | 3300012356 | Vadose Zone Soil | VKVVATRRYPGPAFDELDDLELLPLAALDGARPDVEALLVTNEPVPLDL |
Ga0137368_103480733 | 3300012358 | Vadose Zone Soil | LKVLATRRYPGPAFEELEDVEVGSLSARDDVQALIV |
Ga0157316_10042851 | 3300012510 | Arabidopsis Rhizosphere | MRDPAAVKVLATRRYPGPALTELGDLEIAPLGALDEPRDDVEGL |
Ga0137397_101494643 | 3300012685 | Vadose Zone Soil | LKVLATRRYPGPAFDELADVEVRALSELKSPSPDVE |
Ga0137396_106858961 | 3300012918 | Vadose Zone Soil | LKVLATRRYPGPAFDELADVEVRALSELKSPRPDVEA |
Ga0126375_115213491 | 3300012948 | Tropical Forest Soil | LKVLATRRYPGPAFDELRDVEVGPLEARDDVEALIVANEPVDPAAF |
Ga0164303_114794142 | 3300012957 | Soil | MLAAVKVFATRRYPGPAFDELGDVEVARLDSLQEPRHDVEGLIVANEPV |
Ga0164301_109418831 | 3300012960 | Soil | MLAAVVNVLATRRYPGPAFDELGDVEVAPLDSLHKPREDVEGLIVANEPVSLQL |
Ga0164302_104501841 | 3300012961 | Soil | LKVLATRRYPGPAFDELGDVEVRALGELESARPDVEALLVANEPVPV |
Ga0164302_117742562 | 3300012961 | Soil | VKVFATRRYPGPAFDELDDVEAAPLERLEAPRDDVEG |
Ga0164304_109977102 | 3300012986 | Soil | LKVLATRRYPGPAFDELRGVEIAPLETVTSAQDGIEALILANEPVRLELF |
Ga0164306_112681802 | 3300012988 | Soil | LKVLATLRYPGPAFDELGDVEVRALAELKSSRPEIEALIVANEPVPL |
Ga0164305_108746021 | 3300012989 | Soil | MLAGVKVFATRRFPGPAFDELDDVEVAPLERLEAPREDVEGLI |
Ga0163162_109654281 | 3300013306 | Switchgrass Rhizosphere | VKVLATRRYPGPAFEQLDAVEVSPLAELTRPRADVEALVVANE |
Ga0134081_104156501 | 3300014150 | Grasslands Soil | MSAWDTRRLKVLATRRYPGPAFDELRDVELGQLEEPRDDVEALIV |
Ga0075311_11724222 | 3300014259 | Natural And Restored Wetlands | VRVLATRRYPGPALDELSDLEIATLASLEGPRPDVEGLVVANEPPPFELLPSL |
Ga0075327_10585241 | 3300014272 | Natural And Restored Wetlands | VKVLATRRYPGPALDELGEVEVLPLHAITQPRPDVEALVVANEPVPLELLPGL |
Ga0075323_11177512 | 3300014301 | Natural And Restored Wetlands | VKVLATRRYPGPALGELADLEVAPLTSLEGPRADVEGLVVANEPPPFELL |
Ga0075316_10481752 | 3300014314 | Natural And Restored Wetlands | MKVLATRRYPGPAFDELDDVEVAALESLTDSRPGIEALVAG |
Ga0157377_112786171 | 3300014745 | Miscanthus Rhizosphere | VKVLATRRYPGAAFAELDNVEIAALEDVTAPRPGVEALI |
Ga0173483_102141501 | 3300015077 | Soil | VRVLATRRYPGPALDELSDLEIATLASLDGPRADVEGLVVANERPPLELLPS |
Ga0137412_110507812 | 3300015242 | Vadose Zone Soil | LKVLATRRYPGPAFDELGDVEVLALAELESPRPDVEVLVVANEP |
Ga0134073_103513101 | 3300015356 | Grasslands Soil | LKVLATRRYPGPAFDELGDVEVGPLQSRDDVEALL |
Ga0132257_1000001261 | 3300015373 | Arabidopsis Rhizosphere | VQVLATRRYPGPAFDELANVEVVALPSLDAPRPGIEGLVVANEPP |
Ga0132255_1046984432 | 3300015374 | Arabidopsis Rhizosphere | LKVLATRRYPGPAFDELGDVEVGPLEPRGDVEALIVANE |
Ga0184605_104407592 | 3300018027 | Groundwater Sediment | LKVLATRRYPGPAFDEFVDVEVQALAELESHRSAVDALVG |
Ga0184638_10862262 | 3300018052 | Groundwater Sediment | VKVVATRRYPGPAFDELVDVEVLPLDKLREPRDDVEGLVVAN |
Ga0184618_100217523 | 3300018071 | Groundwater Sediment | VKVVATRRYPGPAFDELDDVEIAPLDALGRARADVEGLVVANEPVPFDLL |
Ga0173482_105861191 | 3300019361 | Soil | MLAGVKVFATRRYPGPAFDELDDVEVAPLETLEASRDDLQGL |
Ga0210382_100323951 | 3300021080 | Groundwater Sediment | LKVLATRRYPGPAFDELADVEVQALAELDSPRPDVEALVVANEPVPLALLP |
Ga0182009_105852782 | 3300021445 | Soil | LTVLATRRYPGPAFGELGDVEIGPLQPRDDVDVLVVANEPI |
Ga0222622_101766802 | 3300022756 | Groundwater Sediment | MRVLATRRYPGPAFDELDDVEVTPLAALRKPREDVEGLILANEPV |
Ga0209642_104057431 | 3300025167 | Soil | VKILSTRRFPGPAFDELDDVEVRRLTDLHEPRADVEALAVANEPIPLEL |
Ga0210076_10271881 | 3300025567 | Natural And Restored Wetlands | VRVLSTRRYPGPAFDELADVVVAALDALREPDPGIEALIVANEPVPLGLLPAL |
Ga0210076_10461461 | 3300025567 | Natural And Restored Wetlands | VKVLATRRYPGPALDELSDLEIATLASLEGPRPDVEGLVVANEPPP |
Ga0207684_104860521 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LKVLATRRYPGPAFEELTDVAIGPLAADPDVAALIVANE |
Ga0207711_116582012 | 3300025941 | Switchgrass Rhizosphere | MLAGVKVFATRRYPGPAFDELDDVEVAPLVELDAPRDDVE |
Ga0207712_100523201 | 3300025961 | Switchgrass Rhizosphere | MLAGVKVFATRRYPGPAFDELDEVEVAPLAQLDAPR |
Ga0207677_100375261 | 3300026023 | Miscanthus Rhizosphere | VRVKILATRRYPGPAFEELAEVEVAPLASVTEPREHL |
Ga0208144_10177931 | 3300026040 | Natural And Restored Wetlands | MKVLATRRYPGPAFDELDDVEVAALESLTDSRPGIEALVAGNETV |
Ga0208654_10347601 | 3300026062 | Natural And Restored Wetlands | VKVLATRRYPGPALDELGEVEVLPLHAITQPRPDVEALVV |
Ga0209154_12406781 | 3300026317 | Soil | LKVLATRRYPGAAFDELGDVEIGALEAHDDVEALIVANEPVSADLFPAL |
Ga0209152_101444202 | 3300026325 | Soil | LKVLATRRYPGPAFEELRDVEVAPLEPRDDVEVLIVANEPVT |
Ga0209161_101314233 | 3300026548 | Soil | LKVLATRRYPGPAFDELRDVEVAPLEARDDVEALI |
Ga0209474_104261661 | 3300026550 | Soil | LKVLATRRYPGPAFEELDDVEVGPLSDLRAPRPEVEALVV |
Ga0209897_10384712 | 3300027169 | Groundwater Sand | VKILATRRYPGSAFDELDDVEVSSLAALDALRPDVEGLVVSNEPVPLELLPRLRVV |
Ga0209887_10174213 | 3300027561 | Groundwater Sand | LKVLATRRYPGPAFEELEDVEVQPLSELRSPRPEVEALAVANEP |
Ga0209177_102100531 | 3300027775 | Agricultural Soil | MKILATRRYPGPAFDELAPEIVPLADLREPRGDVEGLIVANEPVPLDLLPA |
Ga0209857_10686131 | 3300027957 | Groundwater Sand | VKILATRRYPGSAFDELDDVEVSSLAALDALRPDVEGLVVSNE |
Ga0247822_100800103 | 3300028592 | Soil | VRILATRRLPGPAFDELGTVEVGALSEVREPRPDVEA |
Ga0307309_100177781 | 3300028714 | Soil | LKVLATRRYPGPAFDELGDVEVRALAELQSARPDVEALLVANEP |
Ga0307311_102272892 | 3300028716 | Soil | VKILATRRYPGPALEELDEVEVAPLASLTEPREDIEGLLAANEPVPLDCLPRLRV |
Ga0307301_103004271 | 3300028719 | Soil | VKVVATRRYPGPAFCELDDVEVVSLDALGRTRADVE |
Ga0307318_101423383 | 3300028744 | Soil | MKVVATRRYPGPAFDELDDVEVTPLDALGPAREDVE |
Ga0307318_102960701 | 3300028744 | Soil | LKVLATHRYPGPAFDELGDVEVRALAELEGPRPEVEALVVANEPVPLELLPE |
Ga0307282_101160051 | 3300028784 | Soil | MLAAAVKVLATRRYPGPAFDELDVDVLPLDRLDAPREDVEGLIVANEPVALDLLP |
Ga0307323_102740401 | 3300028787 | Soil | LKVLATRRYPGPAFEELGDVEVAPLAARADVETLIVANEPVDAALFPSLRLV |
Ga0307287_102837701 | 3300028796 | Soil | VKVVATRRYPGPPFDELDDVEIAPLDALGRARADVE |
Ga0307305_101033493 | 3300028807 | Soil | MKVVATRRYPGPAFDELDDVEVTPLDALGPAREDVEGLVVAN |
Ga0307292_102367292 | 3300028811 | Soil | MKVVATRRYPGPAFDELDDVEVTPLDALGPAREDVEGLV |
Ga0307292_104214581 | 3300028811 | Soil | MRVLATRRYPGSAFDELEDVEVTPLDALREPREDVEGLILANEPV |
Ga0307286_101181253 | 3300028876 | Soil | MRVLATRRYPGSAFDELEDVEVTPLDALREPREDVEGLILANEPVPL |
Ga0307308_100827343 | 3300028884 | Soil | LKVLATHRYPGPAFDELGHVEVQALAELETPRPDVEALAVANEPVP |
Ga0307304_102570761 | 3300028885 | Soil | LKVLATHRYPGPAFDELGEVEVQALADMKSPRPEVEALVVANE |
Ga0307497_101634463 | 3300031226 | Soil | LKVLATRRYPGPAFDELGDVEVRALRELESARPDVEALLVA |
Ga0310904_110983551 | 3300031854 | Soil | VQVLATRRYPGPAFDELANVEIVALPSLDAPRPGIEGLVVANEPPPLDLLPGL |
Ga0308176_101212721 | 3300031996 | Soil | VKVLATRRYPGPAFDELDEVEVSALADLTQPRVDVE |
Ga0310906_100374911 | 3300032013 | Soil | VQVLATRRYPGPAFDELANVEIVVLPSLDAPRPGIEGLVVANEPPP |
⦗Top⦘ |