Basic Information | |
---|---|
Family ID | F059220 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 134 |
Average Sequence Length | 43 residues |
Representative Sequence | GQLVDVDLDNVFKKLDESRNHILSRGELLPDWAAEPMAAV |
Number of Associated Samples | 121 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.51 % |
% of genes from short scaffolds (< 2000 bps) | 93.28 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.761 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.702 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.030 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.701 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF00106 | adh_short | 55.97 |
PF13561 | adh_short_C2 | 35.07 |
PF00248 | Aldo_ket_red | 1.49 |
PF07690 | MFS_1 | 1.49 |
PF07944 | Glyco_hydro_127 | 0.75 |
PF05368 | NmrA | 0.75 |
PF09360 | zf-CDGSH | 0.75 |
PF00296 | Bac_luciferase | 0.75 |
PF00107 | ADH_zinc_N | 0.75 |
PF00892 | EamA | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.75 |
COG3533 | Beta-L-arabinofuranosidase, GH127 family | Carbohydrate transport and metabolism [G] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.76 % |
Unclassified | root | N/A | 2.24 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2044078003|MGB_F548DK201ERARZ | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
2189573004|GZGWRS402JZ3TZ | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300000443|F12B_10194448 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300001431|F14TB_101178557 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300004157|Ga0062590_103009872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 505 | Open in IMG/M |
3300005176|Ga0066679_10183156 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300005179|Ga0066684_10344204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 996 | Open in IMG/M |
3300005179|Ga0066684_10368097 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300005328|Ga0070676_11453818 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005338|Ga0068868_100864456 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300005344|Ga0070661_100476428 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300005353|Ga0070669_101117662 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300005437|Ga0070710_11019751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
3300005438|Ga0070701_10065554 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
3300005444|Ga0070694_101235691 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300005455|Ga0070663_100661821 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300005459|Ga0068867_102232583 | Not Available | 520 | Open in IMG/M |
3300005507|Ga0074259_11488500 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300005518|Ga0070699_101453487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
3300005539|Ga0068853_101605701 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300005540|Ga0066697_10719696 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005617|Ga0068859_101844882 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300005719|Ga0068861_100663996 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300005719|Ga0068861_101489541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
3300005840|Ga0068870_10227153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1146 | Open in IMG/M |
3300005844|Ga0068862_100971056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 839 | Open in IMG/M |
3300006175|Ga0070712_100460507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1060 | Open in IMG/M |
3300006358|Ga0068871_101078603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 750 | Open in IMG/M |
3300006844|Ga0075428_102298445 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300006854|Ga0075425_102804270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 536 | Open in IMG/M |
3300006881|Ga0068865_101402465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 624 | Open in IMG/M |
3300006904|Ga0075424_101281366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 779 | Open in IMG/M |
3300009094|Ga0111539_11120716 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300009148|Ga0105243_11808650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
3300009156|Ga0111538_11282211 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300009162|Ga0075423_12946995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
3300009174|Ga0105241_10455295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1133 | Open in IMG/M |
3300009174|Ga0105241_10514159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1070 | Open in IMG/M |
3300009545|Ga0105237_10694956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1024 | Open in IMG/M |
3300010038|Ga0126315_10064459 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300010154|Ga0127503_11229669 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300010336|Ga0134071_10176054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1049 | Open in IMG/M |
3300010375|Ga0105239_11502956 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300010396|Ga0134126_12554407 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300010397|Ga0134124_10786286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 950 | Open in IMG/M |
3300010401|Ga0134121_12471057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 561 | Open in IMG/M |
3300011119|Ga0105246_10552938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 987 | Open in IMG/M |
3300011271|Ga0137393_11321341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 610 | Open in IMG/M |
3300012096|Ga0137389_10229966 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
3300012198|Ga0137364_10654652 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300012204|Ga0137374_11113039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
3300012206|Ga0137380_10259637 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
3300012207|Ga0137381_11041195 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300012209|Ga0137379_10457635 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300012212|Ga0150985_104129418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1136 | Open in IMG/M |
3300012360|Ga0137375_10586251 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300012475|Ga0157317_1033539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
3300012505|Ga0157339_1058850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 528 | Open in IMG/M |
3300012896|Ga0157303_10035146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 946 | Open in IMG/M |
3300012910|Ga0157308_10070906 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300012913|Ga0157298_10336842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
3300012915|Ga0157302_10416245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
3300012958|Ga0164299_10409663 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300013100|Ga0157373_10344655 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300013297|Ga0157378_12199711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
3300013297|Ga0157378_12942595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 528 | Open in IMG/M |
3300013306|Ga0163162_10098988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3006 | Open in IMG/M |
3300013306|Ga0163162_12051272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
3300013307|Ga0157372_12277032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
3300013308|Ga0157375_10769231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1113 | Open in IMG/M |
3300013308|Ga0157375_13088340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 556 | Open in IMG/M |
3300014318|Ga0075351_1154003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
3300014969|Ga0157376_10116677 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
3300015077|Ga0173483_10161589 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300015371|Ga0132258_13517761 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300015372|Ga0132256_100448505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1397 | Open in IMG/M |
3300015373|Ga0132257_102311359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 697 | Open in IMG/M |
3300015374|Ga0132255_106216724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 505 | Open in IMG/M |
3300017944|Ga0187786_10571229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
3300017947|Ga0187785_10610746 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300017961|Ga0187778_10440652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 859 | Open in IMG/M |
3300017973|Ga0187780_10197992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1400 | Open in IMG/M |
3300018056|Ga0184623_10298464 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300018058|Ga0187766_10280054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1075 | Open in IMG/M |
3300018089|Ga0187774_10178849 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300018468|Ga0066662_10461159 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300022756|Ga0222622_10308511 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300022893|Ga0247787_1004255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1599 | Open in IMG/M |
3300024179|Ga0247695_1051349 | Not Available | 602 | Open in IMG/M |
3300024186|Ga0247688_1080031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
3300024287|Ga0247690_1012039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 984 | Open in IMG/M |
3300025326|Ga0209342_11174978 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300025898|Ga0207692_10017091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3227 | Open in IMG/M |
3300025908|Ga0207643_10036163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2769 | Open in IMG/M |
3300025912|Ga0207707_10690930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 857 | Open in IMG/M |
3300025912|Ga0207707_10757930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 811 | Open in IMG/M |
3300025921|Ga0207652_10363481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1306 | Open in IMG/M |
3300025923|Ga0207681_11408975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
3300025929|Ga0207664_10041891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3570 | Open in IMG/M |
3300025929|Ga0207664_11369798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 628 | Open in IMG/M |
3300025932|Ga0207690_11501573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 563 | Open in IMG/M |
3300025935|Ga0207709_10510407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 940 | Open in IMG/M |
3300025935|Ga0207709_11286284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 604 | Open in IMG/M |
3300025937|Ga0207669_10916505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 733 | Open in IMG/M |
3300025937|Ga0207669_10933407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 726 | Open in IMG/M |
3300025944|Ga0207661_10228698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1646 | Open in IMG/M |
3300025961|Ga0207712_10455446 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300025961|Ga0207712_10786257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 836 | Open in IMG/M |
3300025961|Ga0207712_12065941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
3300025972|Ga0207668_12138224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
3300026067|Ga0207678_10154460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1960 | Open in IMG/M |
3300026067|Ga0207678_10442447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1129 | Open in IMG/M |
3300026142|Ga0207698_10509667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1172 | Open in IMG/M |
3300027561|Ga0209887_1025308 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300027909|Ga0209382_10867473 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300028380|Ga0268265_12511529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
3300028592|Ga0247822_11036650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 679 | Open in IMG/M |
3300028705|Ga0307276_10072535 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300028711|Ga0307293_10026676 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
3300028720|Ga0307317_10035896 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
3300028791|Ga0307290_10185822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 762 | Open in IMG/M |
3300028819|Ga0307296_10026246 | All Organisms → cellular organisms → Bacteria | 3075 | Open in IMG/M |
3300030336|Ga0247826_11456341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
3300031170|Ga0307498_10246584 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300031226|Ga0307497_10072435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1273 | Open in IMG/M |
3300031748|Ga0318492_10766603 | Not Available | 518 | Open in IMG/M |
3300031847|Ga0310907_10209244 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300031897|Ga0318520_10059526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2037 | Open in IMG/M |
3300031938|Ga0308175_102683134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
3300031943|Ga0310885_10218080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 952 | Open in IMG/M |
3300031944|Ga0310884_10394994 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300031996|Ga0308176_10829580 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300032782|Ga0335082_10043867 | All Organisms → cellular organisms → Bacteria | 4670 | Open in IMG/M |
3300033433|Ga0326726_11333934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.70% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.22% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.22% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.99% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.99% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.99% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.24% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.24% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.24% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.24% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.49% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.49% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.75% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.75% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
Switchgrass, Maize And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Switchgrass, Maize And Miscanthus Rhizosphere | 0.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.75% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.75% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.75% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2044078003 | Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL | Environmental | Open in IMG/M |
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Host-Associated | Open in IMG/M |
3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MGB_37750 | 2044078003 | Switchgrass, Maize And Miscanthus Rhizosphere | VDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG |
FG2_08663670 | 2189573004 | Grass Soil | AQLDDIFTKLDESRNHILSEGELLPEWAAAPATAV |
F12B_101944482 | 3300000443 | Soil | AVKRNGELVGANLDNVFAKLDESRNHIRAAGELLPDWAAEPMAAV* |
F14TB_1011785572 | 3300001431 | Soil | VRKHLDNVFAKLDESRNHILAAGELLPDWAAEPMAAV* |
Ga0062590_1030098722 | 3300004157 | Soil | FVAGRAVKRRGKLVDGNLDSVFAKLDESRNHILSAGGLLPDWAAETVAAG* |
Ga0066679_101831563 | 3300005176 | Soil | RNGELVNVDLDDALRKLDESRNHILSRGELLPNWAAEPVAAA* |
Ga0066684_103442041 | 3300005179 | Soil | VAGNAVKRNGELVGHDLKSIYRRLEESRNHILSRGELLPDWCAEPVAAV* |
Ga0066684_103680972 | 3300005179 | Soil | RHGQLVDADLDSLFRKLDESRNHILSRGELLPDWASKPMATV* |
Ga0070676_114538181 | 3300005328 | Miscanthus Rhizosphere | VFVAGRAVKRNGELVIADLDNVFAKLDESRNHILSAGELLPDWAAEPMAAV* |
Ga0068868_1008644561 | 3300005338 | Miscanthus Rhizosphere | FVAGRAVKRNGELVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA* |
Ga0070661_1004764281 | 3300005344 | Corn Rhizosphere | NAVKRHGQLVGADLQKAFRQLEESRNHILGQGELLPDWAAETSAAV* |
Ga0070669_1011176621 | 3300005353 | Switchgrass Rhizosphere | NGQLVDVDLDNVFKKLDESRKHILSRGELLPDWAAEPMAAV* |
Ga0070710_110197511 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GNAVKRNGQLVGHDLKSIYRKLEDSRNHILSRGELLPDWCAESVAAV* |
Ga0070701_100655544 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | GNAVKRHGQLVGADLPKAFRQLEESRNHILGQGELLPDWAAETSAAV* |
Ga0070694_1012356911 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GRAVKRNGELVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA* |
Ga0070663_1006618211 | 3300005455 | Corn Rhizosphere | GKLLDADLDSVFAKLDASRNHILGQGELLPDWAAEPAAAV* |
Ga0068867_1022325831 | 3300005459 | Miscanthus Rhizosphere | KLVDADLNRTFQKLDESRNHILGEGELLPDWAAASAAAV* |
Ga0074259_114885002 | 3300005507 | Arabidopsis Rhizosphere | VFVAGKAVKRGGQLVGADLDKIFQKLDESRNHILGEGGLLPDWAAETSATV* |
Ga0070699_1014534872 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RLVDVDVDGVVRKLEESRNHILSRGGLLPEWAAEPMAAV* |
Ga0068853_1016057011 | 3300005539 | Corn Rhizosphere | GKLVDVDVKSVIRKLEESRNHILSQGGLLPDWCAEPAAV* |
Ga0066697_107196962 | 3300005540 | Soil | AVKRNGELVNVDLDDVIRKLDESRNHILSHGELLPNWAAEPVAAA* |
Ga0068859_1018448822 | 3300005617 | Switchgrass Rhizosphere | KRHGQLVGADLPKAFRQLEESRNHILGQGELLPDWAAETSAAV* |
Ga0068861_1006639962 | 3300005719 | Switchgrass Rhizosphere | GGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG* |
Ga0068861_1014895412 | 3300005719 | Switchgrass Rhizosphere | GNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG* |
Ga0068870_102271533 | 3300005840 | Miscanthus Rhizosphere | KLVDGNLDRVYAKLDESRNHILSQGGLLPDWAAEAVAAA* |
Ga0068862_1009710561 | 3300005844 | Switchgrass Rhizosphere | DGNLDRVYAKLDESRNHILSQGGLLPDWAAEAVAAA* |
Ga0070712_1004605071 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GRAVKRNGELVGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG* |
Ga0068871_1010786032 | 3300006358 | Miscanthus Rhizosphere | VDVKSVVQKLEESRNHILSKGGLLPDWAAEPVAAT* |
Ga0075428_1022984452 | 3300006844 | Populus Rhizosphere | VAGQAVKRGGELVDVDLTRTFAQLDESRDAILSKGGLLPEWADQPTAAA* |
Ga0075425_1028042701 | 3300006854 | Populus Rhizosphere | LVGVDLKQVFQKLDESRNHILGEGGLLPDWAAESATAA* |
Ga0068865_1014024651 | 3300006881 | Miscanthus Rhizosphere | VKRNCELVGANLDNVFAKLDESRNHILSRGELLPDWASEPMAAV* |
Ga0075424_1012813661 | 3300006904 | Populus Rhizosphere | VGADLEKAFRQLDESRNHILGAGELLPDWAAAPATAV* |
Ga0111539_111207161 | 3300009094 | Populus Rhizosphere | LVIADLDNVFAKLDESRNHILSAGELLPDWAAEPMAAV* |
Ga0105243_118086502 | 3300009148 | Miscanthus Rhizosphere | VFVAGNAVKRGGKLVGADLGQTFGKLDESRNHILGEGGLLPEWASASTAVI* |
Ga0111538_112822111 | 3300009156 | Populus Rhizosphere | DLDNVFAKLDESRNHILSAGELLPDWAAEPMAAV* |
Ga0075423_129469951 | 3300009162 | Populus Rhizosphere | GRAVKRHGQLVDADLDRTFRKLDESRNHILGEGGLLPDWASQSAAV* |
Ga0105241_104552952 | 3300009174 | Corn Rhizosphere | AVKRGGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG* |
Ga0105241_105141593 | 3300009174 | Corn Rhizosphere | VGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG* |
Ga0105237_106949563 | 3300009545 | Corn Rhizosphere | NLDNVFAKLDESRNHILSAGGLLPDWAAETVAAG* |
Ga0126315_100644593 | 3300010038 | Serpentine Soil | DLDNVFKKLEESRNHILSRGELLPDWAVEPMAAV* |
Ga0127503_112296691 | 3300010154 | Soil | SVFVAGNAVKRHGQLVGTDLEKTFRQLDESRNHILGEGELLPEWCAAPAAAI* |
Ga0134071_101760543 | 3300010336 | Grasslands Soil | GQLVDADLGQIYRKLDDSRNHILGEGGLLPDWAAEPAAAI* |
Ga0105239_115029562 | 3300010375 | Corn Rhizosphere | DVDVKSVIRKLEESRNHILSQGGLLPDWCAEPAAV* |
Ga0134126_125544071 | 3300010396 | Terrestrial Soil | DTDLEGVFRKLEESRNHILSRGELLPDWASKPMAAV* |
Ga0134124_107862861 | 3300010397 | Terrestrial Soil | AGRAVKRGGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG* |
Ga0134121_124710572 | 3300010401 | Terrestrial Soil | FVAGNAVKRHGQLVGADLQKAFRQLEESRNHILGQGELLPDWAAETSAAV* |
Ga0105246_105529381 | 3300011119 | Miscanthus Rhizosphere | AVKRNGQLVGHDLKSVFQKLDESRNHVLGEGGLLPDWAAESATPA* |
Ga0137393_113213411 | 3300011271 | Vadose Zone Soil | GRLVDVDVDRVVQNLDESRNHILSRGGLLPEWAAEPMAAV* |
Ga0137389_102299661 | 3300012096 | Vadose Zone Soil | VKRNGELVDADLDDIFSKLDESRNHILSRGDLLPEWASEPVAAV* |
Ga0137364_106546522 | 3300012198 | Vadose Zone Soil | DLGDIFRRLDESRDHILSRGELLPDWASEPVATA* |
Ga0137374_111130392 | 3300012204 | Vadose Zone Soil | DVDRVVQKLDESRNHILSRGGLLPEWAAEPMAAV* |
Ga0137380_102596371 | 3300012206 | Vadose Zone Soil | NGELVDANLADIFRRLDESRNHILFHGGLLPEWASESVAAV* |
Ga0137381_110411951 | 3300012207 | Vadose Zone Soil | RNGELVDANLADIFRRLDESRNHILSHGGLLPEWASESVAAV* |
Ga0137379_104576352 | 3300012209 | Vadose Zone Soil | RAVKRNGELVDADLDDIFRKLDESRNHILSRGELLPDWASEPVAAA* |
Ga0150985_1041294183 | 3300012212 | Avena Fatua Rhizosphere | GRAVKRNGVLVDVDVKSVVRKLEESRNHILSKGGLLPDWAAEPVAAI* |
Ga0137375_105862512 | 3300012360 | Vadose Zone Soil | DVDVDRVVQKLDESRNHILSRGGLLPDWASEPMAAV* |
Ga0157317_10335392 | 3300012475 | Arabidopsis Rhizosphere | GRAIKRNGQLVDHNLQNVFQKLDESRNYILSRGELLPEWASEPMAAV* |
Ga0157339_10588501 | 3300012505 | Arabidopsis Rhizosphere | VKRNGELVGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG* |
Ga0157303_100351461 | 3300012896 | Soil | AVKRDGKLVDGNLDRVYAKLDESRNHILSQGGLLPDWAAETVAAA* |
Ga0157308_100709062 | 3300012910 | Soil | DSVFVAGNALKRDGKLVDVDLRKTFDQLDASRNSILGQGGLLPDWAAEATATTA* |
Ga0157298_103368421 | 3300012913 | Soil | ADLPKAFTQLEESRNHILGQGELLPDWAAETSAAV* |
Ga0157302_104162451 | 3300012915 | Soil | ANLDDIFRRLDESRNHILSRGELLPDWASEPVAAV* |
Ga0164299_104096632 | 3300012958 | Soil | GADLEKAFRQLDESRNHILGAGELLPDWAAAPAAAVQR* |
Ga0157373_103446551 | 3300013100 | Corn Rhizosphere | RAVKRNGALVGIDLKSVFGKLEESRNHILSHGELLPDWCAEPVAAV* |
Ga0157378_121997112 | 3300013297 | Miscanthus Rhizosphere | GQLVDVDLDNVFKKLDESRNHILSRGELLPDWAAEPMAAV* |
Ga0157378_129425951 | 3300013297 | Miscanthus Rhizosphere | VAGNAVKRGGKLVGADLGQTFGKLDESRNHILGEGGLLPEWASASTAVI* |
Ga0163162_100989881 | 3300013306 | Switchgrass Rhizosphere | RGGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG* |
Ga0163162_120512722 | 3300013306 | Switchgrass Rhizosphere | SVFVAGRAVKRNGELVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA* |
Ga0157372_122770322 | 3300013307 | Corn Rhizosphere | VAGNAVKRAGELVGVDVKSVIRKLEESRNHILSQGGLLPDWCAEPAAV* |
Ga0157375_107692311 | 3300013308 | Miscanthus Rhizosphere | KRDGKLVEGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG* |
Ga0157375_130883401 | 3300013308 | Miscanthus Rhizosphere | LVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA* |
Ga0075351_11540031 | 3300014318 | Natural And Restored Wetlands | ANLDQIFRKLDESRNHILGAGGLLPEWAAESATAV* |
Ga0157376_101166774 | 3300014969 | Miscanthus Rhizosphere | GKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG* |
Ga0173483_101615891 | 3300015077 | Soil | GRAVKRNGTLVDVDLGKTFQKLDESRNHILGEGELLPEWAAAPAAAI* |
Ga0132258_135177612 | 3300015371 | Arabidopsis Rhizosphere | GNAVKRNGQLVGADLKDIFQKLDESRNHILGEGELLPDWAAEPATAV* |
Ga0132256_1004485051 | 3300015372 | Arabidopsis Rhizosphere | GELVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA* |
Ga0132257_1023113592 | 3300015373 | Arabidopsis Rhizosphere | FVAGNAVKRHGQLVGADLEKAFRQLDESRNHILGEGQLLPEWAAARAAAV* |
Ga0132255_1062167241 | 3300015374 | Arabidopsis Rhizosphere | QLVGADLEKAFRQLDESRNHILGAGELLPDWAAAPAAAV* |
Ga0187786_105712291 | 3300017944 | Tropical Peatland | GVDMKSVVQKLEESRNSILGQGGLLPDWAAETAGAHSH |
Ga0187785_106107462 | 3300017947 | Tropical Peatland | VAGKAVKRNGELVGADLDSVFAKLDASRNHILGQGELLPDWAAESAAAV |
Ga0187778_104406521 | 3300017961 | Tropical Peatland | VDIKSVIGKLEESRNHILSQGGLLPDWCAEPAAAV |
Ga0187780_101979921 | 3300017973 | Tropical Peatland | AKRNGQLVGVDLKSVIQKLEESRNHILGQGGLLPEWAQETVGAHSH |
Ga0184623_102984642 | 3300018056 | Groundwater Sediment | ELVDADLSEIFRKLDESRNHTLSRGELLPEWASEPVAAPVAAL |
Ga0187766_102800543 | 3300018058 | Tropical Peatland | DMTSVIQKLEESRNHILGQGGLLPEWAQETVGAHSH |
Ga0187774_101788491 | 3300018089 | Tropical Peatland | RAVKRNGRLVDADLNAVFRKLEESRNHILSRGELLPDWASEQVAAG |
Ga0066662_104611593 | 3300018468 | Grasslands Soil | NAVKRNGKLQGVDRNSVFGKLGASRNHILSRGELLPDWCAEPVAAV |
Ga0222622_103085112 | 3300022756 | Groundwater Sediment | KRNGQLVDANLDQIFHKLDESRNHILSRGELLPDWAAEPVAAA |
Ga0247787_10042553 | 3300022893 | Soil | VDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA |
Ga0247695_10513491 | 3300024179 | Soil | KRNGQLVDTDLEGVFRKLEESRNHILSRGELLPDWAAAPVAAA |
Ga0247688_10800312 | 3300024186 | Soil | VGVDLKAVIEKLEESRNHILSQGGLLPEWCAEESAATV |
Ga0247690_10120391 | 3300024287 | Soil | LVGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG |
Ga0209342_111749782 | 3300025326 | Soil | FVAGQAVKRNGQLVGADLGQIFRKLDESRNHILGEGELLPDWAAEPAAAV |
Ga0207692_100170915 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AGRAVKRNGELVGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG |
Ga0207643_100361631 | 3300025908 | Miscanthus Rhizosphere | GRAVKRGGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG |
Ga0207707_106909302 | 3300025912 | Corn Rhizosphere | ELVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA |
Ga0207707_107579301 | 3300025912 | Corn Rhizosphere | LLGVDMKSVIGKLEESRNHILSAGNLLPDWCAEHAAHA |
Ga0207652_103634813 | 3300025921 | Corn Rhizosphere | AVKRNGQLVGHDLKSVFQKLDESRNHVLGEGGLLPDWAAESATPA |
Ga0207681_114089751 | 3300025923 | Switchgrass Rhizosphere | VKRDGKLVEGNLDRVFAKLDESRNHILSAGDLLPDWAAETVAAG |
Ga0207664_100418911 | 3300025929 | Agricultural Soil | ELVGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG |
Ga0207664_113697981 | 3300025929 | Agricultural Soil | GADLKSVITKLEESRNHILSQGGLLPDWAAESVAV |
Ga0207690_115015732 | 3300025932 | Corn Rhizosphere | VGADLQKAFRQLEESRNHILGQGELLPDWAAETSAAV |
Ga0207709_105104072 | 3300025935 | Miscanthus Rhizosphere | GKLVEGNLDSVFAKLDESRNHILSAGGLLPDWAAETVAAG |
Ga0207709_112862842 | 3300025935 | Miscanthus Rhizosphere | DSVFVAGNAVKRGGKLVGADLGQTFGKLDESRNHILGEGGLLPEWASASTAVI |
Ga0207669_109165051 | 3300025937 | Miscanthus Rhizosphere | RDGKLVEGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG |
Ga0207669_109334071 | 3300025937 | Miscanthus Rhizosphere | GADLEKTFRKLDESRNHILGQGELLPEWAASSAAAV |
Ga0207661_102286984 | 3300025944 | Corn Rhizosphere | RGGQLLGVDMKSVIGKLEESRNHILSAGNLLPDWCAEHAAHA |
Ga0207712_104554463 | 3300025961 | Switchgrass Rhizosphere | VFVAGRAVKRNGELVGHDLRQVFRKLDESRNHILGEGGLLPEWAAESAATA |
Ga0207712_107862571 | 3300025961 | Switchgrass Rhizosphere | GGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG |
Ga0207712_120659411 | 3300025961 | Switchgrass Rhizosphere | VDLKQVFQKLDESRNHILGEGGLLPDWAAESATAA |
Ga0207668_121382241 | 3300025972 | Switchgrass Rhizosphere | VAGNAVKRHGQLVGADLPKAFRQLEESRNHILGQGELLPDWAAETSAAV |
Ga0207678_101544601 | 3300026067 | Corn Rhizosphere | DGELVEGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG |
Ga0207678_104424472 | 3300026067 | Corn Rhizosphere | MRDLDSVFAKLDASRNHILGQGELLPDWAAEPAAAV |
Ga0207698_105096673 | 3300026142 | Corn Rhizosphere | VDMKSVIGKLEESRNHILSAGNLLPDWCAEHAAHA |
Ga0209887_10253081 | 3300027561 | Groundwater Sand | HDQHHRRELVDADLSEIFRKLDESRNHILSRGELLPEWASEPVAAPVAAV |
Ga0209382_108674731 | 3300027909 | Populus Rhizosphere | AGRAVKRNGELVGANLDNVFAKLDESRNHILSAGELLPDWAAEPMAAV |
Ga0268265_125115292 | 3300028380 | Switchgrass Rhizosphere | KRHGQLVGADLPKAFRQLEESRNHILGQGELLPDWAAETSAAV |
Ga0247822_110366501 | 3300028592 | Soil | FVAGRAVKRGGELVGVDLKQVFQKLDESRNHILGEGGLLPDWAAESATAA |
Ga0307276_100725352 | 3300028705 | Soil | QLVGADLDNVFKKLDESRNHILSRGELLPEWASEPMAAV |
Ga0307293_100266763 | 3300028711 | Soil | GRAVKRNGQLVDVELDSVFKKLDESRNHILSRGELLPEWASEPMAAV |
Ga0307317_100358961 | 3300028720 | Soil | VFVAGQAVKRNGELVDTDLRKTFEKLDESRDHILRDGGLLPDWAAAQSAAV |
Ga0307290_101858221 | 3300028791 | Soil | DTDLRKTFQKLDESRNHILGDGGLLPNWAAEASAAV |
Ga0307296_100262461 | 3300028819 | Soil | VAGQAMKRNGKLVDTDLRKTFQKLDESRNHILGDGGLLPNWVAEASAAV |
Ga0247826_114563412 | 3300030336 | Soil | TLVDVDLGKTFQKLDESRNHILGEGELLPEWAAAPAAAI |
Ga0307498_102465841 | 3300031170 | Soil | VDVDGVVQKLEESRNHILSRGGLLPEWAAEPMATV |
Ga0307497_100724351 | 3300031226 | Soil | GGKLVGVDLGQTFGKLDDSRNHILGEGGLLPEWATASTAVV |
Ga0318492_107666032 | 3300031748 | Soil | RAVKRGGELLGVDMKSIVGQLEESRNSILGQGGLLPDWALEPAGAHSH |
Ga0310907_102092441 | 3300031847 | Soil | GADLDNVFAKLDESRNHILSAGELLPDWAAEPMAAV |
Ga0318520_100595264 | 3300031897 | Soil | VKRGGELLGVDMKSIVGQLEESRNSILGQGGLLPDWALEPAGAHSH |
Ga0308175_1026831341 | 3300031938 | Soil | GVDLKAVIRKLEESRNHILSQGGLLPDWCAEEPAAAV |
Ga0310885_102180802 | 3300031943 | Soil | GRAVKRDGKLVEGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG |
Ga0310884_103949942 | 3300031944 | Soil | FIAGNAVKRHGQLVGADLPKAFRQLEESRNHILGQGELLPDWAAETSAAV |
Ga0308176_108295802 | 3300031996 | Soil | GVDLKSVFGKLEESRNHILSRGELLPDWCAEPAAAV |
Ga0335082_100438677 | 3300032782 | Soil | AGRALKRGGQLVGADMKSIVRKLEESRNSILGQGGLLPEWAMEPAGAHSH |
Ga0326726_113339341 | 3300033433 | Peat Soil | SVFVAGNAVKRGGQLVGVDMKSVIQKLEESRNSILGQGGLLPDWAAETAGAHSH |
⦗Top⦘ |