NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059220

Metagenome / Metatranscriptome Family F059220

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059220
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 43 residues
Representative Sequence GQLVDVDLDNVFKKLDESRNHILSRGELLPDWAAEPMAAV
Number of Associated Samples 121
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.51 %
% of genes from short scaffolds (< 2000 bps) 93.28 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.761 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(9.702 % of family members)
Environment Ontology (ENVO) Unclassified
(44.030 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(59.701 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.47%    β-sheet: 0.00%    Coil/Unstructured: 73.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF00106adh_short 55.97
PF13561adh_short_C2 35.07
PF00248Aldo_ket_red 1.49
PF07690MFS_1 1.49
PF07944Glyco_hydro_127 0.75
PF05368NmrA 0.75
PF09360zf-CDGSH 0.75
PF00296Bac_luciferase 0.75
PF00107ADH_zinc_N 0.75
PF00892EamA 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.75
COG3533Beta-L-arabinofuranosidase, GH127 familyCarbohydrate transport and metabolism [G] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.76 %
UnclassifiedrootN/A2.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2044078003|MGB_F548DK201ERARZAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium502Open in IMG/M
2189573004|GZGWRS402JZ3TZAll Organisms → cellular organisms → Bacteria501Open in IMG/M
3300000443|F12B_10194448All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300001431|F14TB_101178557All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300004157|Ga0062590_103009872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium505Open in IMG/M
3300005176|Ga0066679_10183156All Organisms → cellular organisms → Bacteria1328Open in IMG/M
3300005179|Ga0066684_10344204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria996Open in IMG/M
3300005179|Ga0066684_10368097All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300005328|Ga0070676_11453818All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005338|Ga0068868_100864456All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300005344|Ga0070661_100476428All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300005353|Ga0070669_101117662All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005437|Ga0070710_11019751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300005438|Ga0070701_10065554All Organisms → cellular organisms → Bacteria1928Open in IMG/M
3300005444|Ga0070694_101235691All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005455|Ga0070663_100661821All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300005459|Ga0068867_102232583Not Available520Open in IMG/M
3300005507|Ga0074259_11488500All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005518|Ga0070699_101453487All Organisms → cellular organisms → Bacteria → Terrabacteria group629Open in IMG/M
3300005539|Ga0068853_101605701All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005540|Ga0066697_10719696All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005617|Ga0068859_101844882All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300005719|Ga0068861_100663996All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300005719|Ga0068861_101489541All Organisms → cellular organisms → Bacteria → Terrabacteria group664Open in IMG/M
3300005840|Ga0068870_10227153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1146Open in IMG/M
3300005844|Ga0068862_100971056All Organisms → cellular organisms → Bacteria → Terrabacteria group839Open in IMG/M
3300006175|Ga0070712_100460507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1060Open in IMG/M
3300006358|Ga0068871_101078603All Organisms → cellular organisms → Bacteria → Terrabacteria group750Open in IMG/M
3300006844|Ga0075428_102298445All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300006854|Ga0075425_102804270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium536Open in IMG/M
3300006881|Ga0068865_101402465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium624Open in IMG/M
3300006904|Ga0075424_101281366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium779Open in IMG/M
3300009094|Ga0111539_11120716All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300009148|Ga0105243_11808650All Organisms → cellular organisms → Bacteria → Terrabacteria group642Open in IMG/M
3300009156|Ga0111538_11282211All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300009162|Ga0075423_12946995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium521Open in IMG/M
3300009174|Ga0105241_10455295All Organisms → cellular organisms → Bacteria → Terrabacteria group1133Open in IMG/M
3300009174|Ga0105241_10514159All Organisms → cellular organisms → Bacteria → Terrabacteria group1070Open in IMG/M
3300009545|Ga0105237_10694956All Organisms → cellular organisms → Bacteria → Terrabacteria group1024Open in IMG/M
3300010038|Ga0126315_10064459All Organisms → cellular organisms → Bacteria2025Open in IMG/M
3300010154|Ga0127503_11229669All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300010336|Ga0134071_10176054All Organisms → cellular organisms → Bacteria → Terrabacteria group1049Open in IMG/M
3300010375|Ga0105239_11502956All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300010396|Ga0134126_12554407All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300010397|Ga0134124_10786286All Organisms → cellular organisms → Bacteria → Terrabacteria group950Open in IMG/M
3300010401|Ga0134121_12471057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium561Open in IMG/M
3300011119|Ga0105246_10552938All Organisms → cellular organisms → Bacteria → Terrabacteria group987Open in IMG/M
3300011271|Ga0137393_11321341All Organisms → cellular organisms → Bacteria → Terrabacteria group610Open in IMG/M
3300012096|Ga0137389_10229966All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300012198|Ga0137364_10654652All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300012204|Ga0137374_11113039All Organisms → cellular organisms → Bacteria → Terrabacteria group561Open in IMG/M
3300012206|Ga0137380_10259637All Organisms → cellular organisms → Bacteria1564Open in IMG/M
3300012207|Ga0137381_11041195All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300012209|Ga0137379_10457635All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300012212|Ga0150985_104129418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1136Open in IMG/M
3300012360|Ga0137375_10586251All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300012475|Ga0157317_1033539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium510Open in IMG/M
3300012505|Ga0157339_1058850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium528Open in IMG/M
3300012896|Ga0157303_10035146All Organisms → cellular organisms → Bacteria → Terrabacteria group946Open in IMG/M
3300012910|Ga0157308_10070906All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300012913|Ga0157298_10336842All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300012915|Ga0157302_10416245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300012958|Ga0164299_10409663All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300013100|Ga0157373_10344655All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300013297|Ga0157378_12199711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium603Open in IMG/M
3300013297|Ga0157378_12942595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium528Open in IMG/M
3300013306|Ga0163162_10098988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3006Open in IMG/M
3300013306|Ga0163162_12051272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300013307|Ga0157372_12277032All Organisms → cellular organisms → Bacteria → Terrabacteria group622Open in IMG/M
3300013308|Ga0157375_10769231All Organisms → cellular organisms → Bacteria → Terrabacteria group1113Open in IMG/M
3300013308|Ga0157375_13088340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium556Open in IMG/M
3300014318|Ga0075351_1154003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium549Open in IMG/M
3300014969|Ga0157376_10116677All Organisms → cellular organisms → Bacteria2359Open in IMG/M
3300015077|Ga0173483_10161589All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300015371|Ga0132258_13517761All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300015372|Ga0132256_100448505All Organisms → cellular organisms → Bacteria → Terrabacteria group1397Open in IMG/M
3300015373|Ga0132257_102311359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium697Open in IMG/M
3300015374|Ga0132255_106216724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium505Open in IMG/M
3300017944|Ga0187786_10571229All Organisms → cellular organisms → Bacteria → Terrabacteria group526Open in IMG/M
3300017947|Ga0187785_10610746All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300017961|Ga0187778_10440652All Organisms → cellular organisms → Bacteria → Terrabacteria group859Open in IMG/M
3300017973|Ga0187780_10197992All Organisms → cellular organisms → Bacteria → Terrabacteria group1400Open in IMG/M
3300018056|Ga0184623_10298464All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300018058|Ga0187766_10280054All Organisms → cellular organisms → Bacteria → Terrabacteria group1075Open in IMG/M
3300018089|Ga0187774_10178849All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300018468|Ga0066662_10461159All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300022756|Ga0222622_10308511All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300022893|Ga0247787_1004255All Organisms → cellular organisms → Bacteria → Terrabacteria group1599Open in IMG/M
3300024179|Ga0247695_1051349Not Available602Open in IMG/M
3300024186|Ga0247688_1080031All Organisms → cellular organisms → Bacteria → Terrabacteria group552Open in IMG/M
3300024287|Ga0247690_1012039All Organisms → cellular organisms → Bacteria → Terrabacteria group984Open in IMG/M
3300025326|Ga0209342_11174978All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300025898|Ga0207692_10017091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3227Open in IMG/M
3300025908|Ga0207643_10036163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2769Open in IMG/M
3300025912|Ga0207707_10690930All Organisms → cellular organisms → Bacteria → Terrabacteria group857Open in IMG/M
3300025912|Ga0207707_10757930All Organisms → cellular organisms → Bacteria → Terrabacteria group811Open in IMG/M
3300025921|Ga0207652_10363481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1306Open in IMG/M
3300025923|Ga0207681_11408975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium585Open in IMG/M
3300025929|Ga0207664_10041891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3570Open in IMG/M
3300025929|Ga0207664_11369798All Organisms → cellular organisms → Bacteria → Terrabacteria group628Open in IMG/M
3300025932|Ga0207690_11501573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium563Open in IMG/M
3300025935|Ga0207709_10510407All Organisms → cellular organisms → Bacteria → Terrabacteria group940Open in IMG/M
3300025935|Ga0207709_11286284All Organisms → cellular organisms → Bacteria → Terrabacteria group604Open in IMG/M
3300025937|Ga0207669_10916505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium733Open in IMG/M
3300025937|Ga0207669_10933407All Organisms → cellular organisms → Bacteria → Terrabacteria group726Open in IMG/M
3300025944|Ga0207661_10228698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1646Open in IMG/M
3300025961|Ga0207712_10455446All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300025961|Ga0207712_10786257All Organisms → cellular organisms → Bacteria → Terrabacteria group836Open in IMG/M
3300025961|Ga0207712_12065941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium510Open in IMG/M
3300025972|Ga0207668_12138224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium504Open in IMG/M
3300026067|Ga0207678_10154460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1960Open in IMG/M
3300026067|Ga0207678_10442447All Organisms → cellular organisms → Bacteria → Terrabacteria group1129Open in IMG/M
3300026142|Ga0207698_10509667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1172Open in IMG/M
3300027561|Ga0209887_1025308All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300027909|Ga0209382_10867473All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300028380|Ga0268265_12511529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium521Open in IMG/M
3300028592|Ga0247822_11036650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium679Open in IMG/M
3300028705|Ga0307276_10072535All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300028711|Ga0307293_10026676All Organisms → cellular organisms → Bacteria1730Open in IMG/M
3300028720|Ga0307317_10035896All Organisms → cellular organisms → Bacteria1560Open in IMG/M
3300028791|Ga0307290_10185822All Organisms → cellular organisms → Bacteria → Terrabacteria group762Open in IMG/M
3300028819|Ga0307296_10026246All Organisms → cellular organisms → Bacteria3075Open in IMG/M
3300030336|Ga0247826_11456341All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300031170|Ga0307498_10246584All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300031226|Ga0307497_10072435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1273Open in IMG/M
3300031748|Ga0318492_10766603Not Available518Open in IMG/M
3300031847|Ga0310907_10209244All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300031897|Ga0318520_10059526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2037Open in IMG/M
3300031938|Ga0308175_102683134All Organisms → cellular organisms → Bacteria → Terrabacteria group557Open in IMG/M
3300031943|Ga0310885_10218080All Organisms → cellular organisms → Bacteria → Terrabacteria group952Open in IMG/M
3300031944|Ga0310884_10394994All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300031996|Ga0308176_10829580All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300032782|Ga0335082_10043867All Organisms → cellular organisms → Bacteria4670Open in IMG/M
3300033433|Ga0326726_11333934All Organisms → cellular organisms → Bacteria → Terrabacteria group698Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.22%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.22%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.99%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.24%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.49%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.49%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.49%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.49%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.49%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.75%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.75%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
Switchgrass, Maize And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Switchgrass, Maize And Miscanthus Rhizosphere0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.75%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.75%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.75%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.75%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2044078003Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, ILEnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005507Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012475Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610Host-AssociatedOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300024287Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027561Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MGB_377502044078003Switchgrass, Maize And Miscanthus RhizosphereVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG
FG2_086636702189573004Grass SoilAQLDDIFTKLDESRNHILSEGELLPEWAAAPATAV
F12B_1019444823300000443SoilAVKRNGELVGANLDNVFAKLDESRNHIRAAGELLPDWAAEPMAAV*
F14TB_10117855723300001431SoilVRKHLDNVFAKLDESRNHILAAGELLPDWAAEPMAAV*
Ga0062590_10300987223300004157SoilFVAGRAVKRRGKLVDGNLDSVFAKLDESRNHILSAGGLLPDWAAETVAAG*
Ga0066679_1018315633300005176SoilRNGELVNVDLDDALRKLDESRNHILSRGELLPNWAAEPVAAA*
Ga0066684_1034420413300005179SoilVAGNAVKRNGELVGHDLKSIYRRLEESRNHILSRGELLPDWCAEPVAAV*
Ga0066684_1036809723300005179SoilRHGQLVDADLDSLFRKLDESRNHILSRGELLPDWASKPMATV*
Ga0070676_1145381813300005328Miscanthus RhizosphereVFVAGRAVKRNGELVIADLDNVFAKLDESRNHILSAGELLPDWAAEPMAAV*
Ga0068868_10086445613300005338Miscanthus RhizosphereFVAGRAVKRNGELVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA*
Ga0070661_10047642813300005344Corn RhizosphereNAVKRHGQLVGADLQKAFRQLEESRNHILGQGELLPDWAAETSAAV*
Ga0070669_10111766213300005353Switchgrass RhizosphereNGQLVDVDLDNVFKKLDESRKHILSRGELLPDWAAEPMAAV*
Ga0070710_1101975113300005437Corn, Switchgrass And Miscanthus RhizosphereGNAVKRNGQLVGHDLKSIYRKLEDSRNHILSRGELLPDWCAESVAAV*
Ga0070701_1006555443300005438Corn, Switchgrass And Miscanthus RhizosphereGNAVKRHGQLVGADLPKAFRQLEESRNHILGQGELLPDWAAETSAAV*
Ga0070694_10123569113300005444Corn, Switchgrass And Miscanthus RhizosphereGRAVKRNGELVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA*
Ga0070663_10066182113300005455Corn RhizosphereGKLLDADLDSVFAKLDASRNHILGQGELLPDWAAEPAAAV*
Ga0068867_10223258313300005459Miscanthus RhizosphereKLVDADLNRTFQKLDESRNHILGEGELLPDWAAASAAAV*
Ga0074259_1148850023300005507Arabidopsis RhizosphereVFVAGKAVKRGGQLVGADLDKIFQKLDESRNHILGEGGLLPDWAAETSATV*
Ga0070699_10145348723300005518Corn, Switchgrass And Miscanthus RhizosphereRLVDVDVDGVVRKLEESRNHILSRGGLLPEWAAEPMAAV*
Ga0068853_10160570113300005539Corn RhizosphereGKLVDVDVKSVIRKLEESRNHILSQGGLLPDWCAEPAAV*
Ga0066697_1071969623300005540SoilAVKRNGELVNVDLDDVIRKLDESRNHILSHGELLPNWAAEPVAAA*
Ga0068859_10184488223300005617Switchgrass RhizosphereKRHGQLVGADLPKAFRQLEESRNHILGQGELLPDWAAETSAAV*
Ga0068861_10066399623300005719Switchgrass RhizosphereGGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG*
Ga0068861_10148954123300005719Switchgrass RhizosphereGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG*
Ga0068870_1022715333300005840Miscanthus RhizosphereKLVDGNLDRVYAKLDESRNHILSQGGLLPDWAAEAVAAA*
Ga0068862_10097105613300005844Switchgrass RhizosphereDGNLDRVYAKLDESRNHILSQGGLLPDWAAEAVAAA*
Ga0070712_10046050713300006175Corn, Switchgrass And Miscanthus RhizosphereGRAVKRNGELVGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG*
Ga0068871_10107860323300006358Miscanthus RhizosphereVDVKSVVQKLEESRNHILSKGGLLPDWAAEPVAAT*
Ga0075428_10229844523300006844Populus RhizosphereVAGQAVKRGGELVDVDLTRTFAQLDESRDAILSKGGLLPEWADQPTAAA*
Ga0075425_10280427013300006854Populus RhizosphereLVGVDLKQVFQKLDESRNHILGEGGLLPDWAAESATAA*
Ga0068865_10140246513300006881Miscanthus RhizosphereVKRNCELVGANLDNVFAKLDESRNHILSRGELLPDWASEPMAAV*
Ga0075424_10128136613300006904Populus RhizosphereVGADLEKAFRQLDESRNHILGAGELLPDWAAAPATAV*
Ga0111539_1112071613300009094Populus RhizosphereLVIADLDNVFAKLDESRNHILSAGELLPDWAAEPMAAV*
Ga0105243_1180865023300009148Miscanthus RhizosphereVFVAGNAVKRGGKLVGADLGQTFGKLDESRNHILGEGGLLPEWASASTAVI*
Ga0111538_1128221113300009156Populus RhizosphereDLDNVFAKLDESRNHILSAGELLPDWAAEPMAAV*
Ga0075423_1294699513300009162Populus RhizosphereGRAVKRHGQLVDADLDRTFRKLDESRNHILGEGGLLPDWASQSAAV*
Ga0105241_1045529523300009174Corn RhizosphereAVKRGGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG*
Ga0105241_1051415933300009174Corn RhizosphereVGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG*
Ga0105237_1069495633300009545Corn RhizosphereNLDNVFAKLDESRNHILSAGGLLPDWAAETVAAG*
Ga0126315_1006445933300010038Serpentine SoilDLDNVFKKLEESRNHILSRGELLPDWAVEPMAAV*
Ga0127503_1122966913300010154SoilSVFVAGNAVKRHGQLVGTDLEKTFRQLDESRNHILGEGELLPEWCAAPAAAI*
Ga0134071_1017605433300010336Grasslands SoilGQLVDADLGQIYRKLDDSRNHILGEGGLLPDWAAEPAAAI*
Ga0105239_1150295623300010375Corn RhizosphereDVDVKSVIRKLEESRNHILSQGGLLPDWCAEPAAV*
Ga0134126_1255440713300010396Terrestrial SoilDTDLEGVFRKLEESRNHILSRGELLPDWASKPMAAV*
Ga0134124_1078628613300010397Terrestrial SoilAGRAVKRGGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG*
Ga0134121_1247105723300010401Terrestrial SoilFVAGNAVKRHGQLVGADLQKAFRQLEESRNHILGQGELLPDWAAETSAAV*
Ga0105246_1055293813300011119Miscanthus RhizosphereAVKRNGQLVGHDLKSVFQKLDESRNHVLGEGGLLPDWAAESATPA*
Ga0137393_1132134113300011271Vadose Zone SoilGRLVDVDVDRVVQNLDESRNHILSRGGLLPEWAAEPMAAV*
Ga0137389_1022996613300012096Vadose Zone SoilVKRNGELVDADLDDIFSKLDESRNHILSRGDLLPEWASEPVAAV*
Ga0137364_1065465223300012198Vadose Zone SoilDLGDIFRRLDESRDHILSRGELLPDWASEPVATA*
Ga0137374_1111303923300012204Vadose Zone SoilDVDRVVQKLDESRNHILSRGGLLPEWAAEPMAAV*
Ga0137380_1025963713300012206Vadose Zone SoilNGELVDANLADIFRRLDESRNHILFHGGLLPEWASESVAAV*
Ga0137381_1104119513300012207Vadose Zone SoilRNGELVDANLADIFRRLDESRNHILSHGGLLPEWASESVAAV*
Ga0137379_1045763523300012209Vadose Zone SoilRAVKRNGELVDADLDDIFRKLDESRNHILSRGELLPDWASEPVAAA*
Ga0150985_10412941833300012212Avena Fatua RhizosphereGRAVKRNGVLVDVDVKSVVRKLEESRNHILSKGGLLPDWAAEPVAAI*
Ga0137375_1058625123300012360Vadose Zone SoilDVDVDRVVQKLDESRNHILSRGGLLPDWASEPMAAV*
Ga0157317_103353923300012475Arabidopsis RhizosphereGRAIKRNGQLVDHNLQNVFQKLDESRNYILSRGELLPEWASEPMAAV*
Ga0157339_105885013300012505Arabidopsis RhizosphereVKRNGELVGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG*
Ga0157303_1003514613300012896SoilAVKRDGKLVDGNLDRVYAKLDESRNHILSQGGLLPDWAAETVAAA*
Ga0157308_1007090623300012910SoilDSVFVAGNALKRDGKLVDVDLRKTFDQLDASRNSILGQGGLLPDWAAEATATTA*
Ga0157298_1033684213300012913SoilADLPKAFTQLEESRNHILGQGELLPDWAAETSAAV*
Ga0157302_1041624513300012915SoilANLDDIFRRLDESRNHILSRGELLPDWASEPVAAV*
Ga0164299_1040966323300012958SoilGADLEKAFRQLDESRNHILGAGELLPDWAAAPAAAVQR*
Ga0157373_1034465513300013100Corn RhizosphereRAVKRNGALVGIDLKSVFGKLEESRNHILSHGELLPDWCAEPVAAV*
Ga0157378_1219971123300013297Miscanthus RhizosphereGQLVDVDLDNVFKKLDESRNHILSRGELLPDWAAEPMAAV*
Ga0157378_1294259513300013297Miscanthus RhizosphereVAGNAVKRGGKLVGADLGQTFGKLDESRNHILGEGGLLPEWASASTAVI*
Ga0163162_1009898813300013306Switchgrass RhizosphereRGGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG*
Ga0163162_1205127223300013306Switchgrass RhizosphereSVFVAGRAVKRNGELVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA*
Ga0157372_1227703223300013307Corn RhizosphereVAGNAVKRAGELVGVDVKSVIRKLEESRNHILSQGGLLPDWCAEPAAV*
Ga0157375_1076923113300013308Miscanthus RhizosphereKRDGKLVEGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG*
Ga0157375_1308834013300013308Miscanthus RhizosphereLVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA*
Ga0075351_115400313300014318Natural And Restored WetlandsANLDQIFRKLDESRNHILGAGGLLPEWAAESATAV*
Ga0157376_1011667743300014969Miscanthus RhizosphereGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG*
Ga0173483_1016158913300015077SoilGRAVKRNGTLVDVDLGKTFQKLDESRNHILGEGELLPEWAAAPAAAI*
Ga0132258_1351776123300015371Arabidopsis RhizosphereGNAVKRNGQLVGADLKDIFQKLDESRNHILGEGELLPDWAAEPATAV*
Ga0132256_10044850513300015372Arabidopsis RhizosphereGELVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA*
Ga0132257_10231135923300015373Arabidopsis RhizosphereFVAGNAVKRHGQLVGADLEKAFRQLDESRNHILGEGQLLPEWAAARAAAV*
Ga0132255_10621672413300015374Arabidopsis RhizosphereQLVGADLEKAFRQLDESRNHILGAGELLPDWAAAPAAAV*
Ga0187786_1057122913300017944Tropical PeatlandGVDMKSVVQKLEESRNSILGQGGLLPDWAAETAGAHSH
Ga0187785_1061074623300017947Tropical PeatlandVAGKAVKRNGELVGADLDSVFAKLDASRNHILGQGELLPDWAAESAAAV
Ga0187778_1044065213300017961Tropical PeatlandVDIKSVIGKLEESRNHILSQGGLLPDWCAEPAAAV
Ga0187780_1019799213300017973Tropical PeatlandAKRNGQLVGVDLKSVIQKLEESRNHILGQGGLLPEWAQETVGAHSH
Ga0184623_1029846423300018056Groundwater SedimentELVDADLSEIFRKLDESRNHTLSRGELLPEWASEPVAAPVAAL
Ga0187766_1028005433300018058Tropical PeatlandDMTSVIQKLEESRNHILGQGGLLPEWAQETVGAHSH
Ga0187774_1017884913300018089Tropical PeatlandRAVKRNGRLVDADLNAVFRKLEESRNHILSRGELLPDWASEQVAAG
Ga0066662_1046115933300018468Grasslands SoilNAVKRNGKLQGVDRNSVFGKLGASRNHILSRGELLPDWCAEPVAAV
Ga0222622_1030851123300022756Groundwater SedimentKRNGQLVDANLDQIFHKLDESRNHILSRGELLPDWAAEPVAAA
Ga0247787_100425533300022893SoilVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA
Ga0247695_105134913300024179SoilKRNGQLVDTDLEGVFRKLEESRNHILSRGELLPDWAAAPVAAA
Ga0247688_108003123300024186SoilVGVDLKAVIEKLEESRNHILSQGGLLPEWCAEESAATV
Ga0247690_101203913300024287SoilLVGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG
Ga0209342_1117497823300025326SoilFVAGQAVKRNGQLVGADLGQIFRKLDESRNHILGEGELLPDWAAEPAAAV
Ga0207692_1001709153300025898Corn, Switchgrass And Miscanthus RhizosphereAGRAVKRNGELVGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG
Ga0207643_1003616313300025908Miscanthus RhizosphereGRAVKRGGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG
Ga0207707_1069093023300025912Corn RhizosphereELVGVDLKQTFQRLEESRNHILGEGGLLPDWAAESAAPA
Ga0207707_1075793013300025912Corn RhizosphereLLGVDMKSVIGKLEESRNHILSAGNLLPDWCAEHAAHA
Ga0207652_1036348133300025921Corn RhizosphereAVKRNGQLVGHDLKSVFQKLDESRNHVLGEGGLLPDWAAESATPA
Ga0207681_1140897513300025923Switchgrass RhizosphereVKRDGKLVEGNLDRVFAKLDESRNHILSAGDLLPDWAAETVAAG
Ga0207664_1004189113300025929Agricultural SoilELVGHDLDGVYRKLDESRNAILSKGGLLPDWAAEPVAAG
Ga0207664_1136979813300025929Agricultural SoilGADLKSVITKLEESRNHILSQGGLLPDWAAESVAV
Ga0207690_1150157323300025932Corn RhizosphereVGADLQKAFRQLEESRNHILGQGELLPDWAAETSAAV
Ga0207709_1051040723300025935Miscanthus RhizosphereGKLVEGNLDSVFAKLDESRNHILSAGGLLPDWAAETVAAG
Ga0207709_1128628423300025935Miscanthus RhizosphereDSVFVAGNAVKRGGKLVGADLGQTFGKLDESRNHILGEGGLLPEWASASTAVI
Ga0207669_1091650513300025937Miscanthus RhizosphereRDGKLVEGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG
Ga0207669_1093340713300025937Miscanthus RhizosphereGADLEKTFRKLDESRNHILGQGELLPEWAASSAAAV
Ga0207661_1022869843300025944Corn RhizosphereRGGQLLGVDMKSVIGKLEESRNHILSAGNLLPDWCAEHAAHA
Ga0207712_1045544633300025961Switchgrass RhizosphereVFVAGRAVKRNGELVGHDLRQVFRKLDESRNHILGEGGLLPEWAAESAATA
Ga0207712_1078625713300025961Switchgrass RhizosphereGGKLVDGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG
Ga0207712_1206594113300025961Switchgrass RhizosphereVDLKQVFQKLDESRNHILGEGGLLPDWAAESATAA
Ga0207668_1213822413300025972Switchgrass RhizosphereVAGNAVKRHGQLVGADLPKAFRQLEESRNHILGQGELLPDWAAETSAAV
Ga0207678_1015446013300026067Corn RhizosphereDGELVEGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG
Ga0207678_1044244723300026067Corn RhizosphereMRDLDSVFAKLDASRNHILGQGELLPDWAAEPAAAV
Ga0207698_1050966733300026142Corn RhizosphereVDMKSVIGKLEESRNHILSAGNLLPDWCAEHAAHA
Ga0209887_102530813300027561Groundwater SandHDQHHRRELVDADLSEIFRKLDESRNHILSRGELLPEWASEPVAAPVAAV
Ga0209382_1086747313300027909Populus RhizosphereAGRAVKRNGELVGANLDNVFAKLDESRNHILSAGELLPDWAAEPMAAV
Ga0268265_1251152923300028380Switchgrass RhizosphereKRHGQLVGADLPKAFRQLEESRNHILGQGELLPDWAAETSAAV
Ga0247822_1103665013300028592SoilFVAGRAVKRGGELVGVDLKQVFQKLDESRNHILGEGGLLPDWAAESATAA
Ga0307276_1007253523300028705SoilQLVGADLDNVFKKLDESRNHILSRGELLPEWASEPMAAV
Ga0307293_1002667633300028711SoilGRAVKRNGQLVDVELDSVFKKLDESRNHILSRGELLPEWASEPMAAV
Ga0307317_1003589613300028720SoilVFVAGQAVKRNGELVDTDLRKTFEKLDESRDHILRDGGLLPDWAAAQSAAV
Ga0307290_1018582213300028791SoilDTDLRKTFQKLDESRNHILGDGGLLPNWAAEASAAV
Ga0307296_1002624613300028819SoilVAGQAMKRNGKLVDTDLRKTFQKLDESRNHILGDGGLLPNWVAEASAAV
Ga0247826_1145634123300030336SoilTLVDVDLGKTFQKLDESRNHILGEGELLPEWAAAPAAAI
Ga0307498_1024658413300031170SoilVDVDGVVQKLEESRNHILSRGGLLPEWAAEPMATV
Ga0307497_1007243513300031226SoilGGKLVGVDLGQTFGKLDDSRNHILGEGGLLPEWATASTAVV
Ga0318492_1076660323300031748SoilRAVKRGGELLGVDMKSIVGQLEESRNSILGQGGLLPDWALEPAGAHSH
Ga0310907_1020924413300031847SoilGADLDNVFAKLDESRNHILSAGELLPDWAAEPMAAV
Ga0318520_1005952643300031897SoilVKRGGELLGVDMKSIVGQLEESRNSILGQGGLLPDWALEPAGAHSH
Ga0308175_10268313413300031938SoilGVDLKAVIRKLEESRNHILSQGGLLPDWCAEEPAAAV
Ga0310885_1021808023300031943SoilGRAVKRDGKLVEGNLDRVFAKLDESRNHILSAGGLLPDWAAETVAAG
Ga0310884_1039499423300031944SoilFIAGNAVKRHGQLVGADLPKAFRQLEESRNHILGQGELLPDWAAETSAAV
Ga0308176_1082958023300031996SoilGVDLKSVFGKLEESRNHILSRGELLPDWCAEPAAAV
Ga0335082_1004386773300032782SoilAGRALKRGGQLVGADMKSIVRKLEESRNSILGQGGLLPEWAMEPAGAHSH
Ga0326726_1133393413300033433Peat SoilSVFVAGNAVKRGGQLVGVDMKSVIQKLEESRNSILGQGGLLPDWAAETAGAHSH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.