| Basic Information | |
|---|---|
| Family ID | F059139 |
| Family Type | Metagenome |
| Number of Sequences | 134 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LEQADKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEGM |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 61.94 % |
| % of genes near scaffold ends (potentially truncated) | 35.82 % |
| % of genes from short scaffolds (< 2000 bps) | 68.66 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.119 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.940 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.612 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.299 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF11171 | DUF2958 | 41.79 |
| PF00589 | Phage_integrase | 35.07 |
| PF00899 | ThiF | 3.73 |
| PF13408 | Zn_ribbon_recom | 2.24 |
| PF13814 | Replic_Relax | 1.49 |
| PF04266 | ASCH | 0.75 |
| PF10412 | TrwB_AAD_bind | 0.75 |
| PF13620 | CarboxypepD_reg | 0.75 |
| PF05368 | NmrA | 0.75 |
| PF12696 | TraG-D_C | 0.75 |
| PF11737 | DUF3300 | 0.75 |
| PF05063 | MT-A70 | 0.75 |
| PF14464 | Prok-JAB | 0.75 |
| PF12728 | HTH_17 | 0.75 |
| PF13439 | Glyco_transf_4 | 0.75 |
| PF01867 | Cas_Cas1 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 1.49 |
| COG1518 | CRISPR-Cas system-associated integrase Cas1 | Defense mechanisms [V] | 0.75 |
| COG2411 | Predicted RNA-binding protein, contains PUA-like ASCH domain | General function prediction only [R] | 0.75 |
| COG3097 | Uncharacterized conserved protein YqfB, UPF0267 family | Function unknown [S] | 0.75 |
| COG4405 | Predicted RNA-binding protein YhfF, contains PUA-like ASCH domain | General function prediction only [R] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.12 % |
| Unclassified | root | N/A | 23.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908028|beta3_all_NODE_6560_len_1963_cov_6_713704 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 2013 | Open in IMG/M |
| 3300002569|JGI24136J36422_10053407 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300004092|Ga0062389_104719528 | Not Available | 513 | Open in IMG/M |
| 3300005529|Ga0070741_10680082 | Not Available | 910 | Open in IMG/M |
| 3300005529|Ga0070741_11088596 | Not Available | 680 | Open in IMG/M |
| 3300005533|Ga0070734_10083588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1886 | Open in IMG/M |
| 3300005534|Ga0070735_10000292 | All Organisms → cellular organisms → Bacteria | 59325 | Open in IMG/M |
| 3300005534|Ga0070735_10801001 | Not Available | 555 | Open in IMG/M |
| 3300005538|Ga0070731_11061195 | Not Available | 536 | Open in IMG/M |
| 3300005563|Ga0068855_100768892 | Not Available | 1026 | Open in IMG/M |
| 3300005577|Ga0068857_101004169 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 803 | Open in IMG/M |
| 3300005616|Ga0068852_102170173 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005836|Ga0074470_11790791 | Not Available | 633 | Open in IMG/M |
| 3300005921|Ga0070766_10048814 | All Organisms → cellular organisms → Bacteria | 2371 | Open in IMG/M |
| 3300006086|Ga0075019_10014395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4417 | Open in IMG/M |
| 3300006162|Ga0075030_100666561 | Not Available | 824 | Open in IMG/M |
| 3300006176|Ga0070765_102300662 | Not Available | 502 | Open in IMG/M |
| 3300006640|Ga0075527_10141038 | Not Available | 679 | Open in IMG/M |
| 3300006893|Ga0073928_10008045 | All Organisms → cellular organisms → Bacteria | 13384 | Open in IMG/M |
| 3300009038|Ga0099829_11395551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 579 | Open in IMG/M |
| 3300009090|Ga0099827_11036226 | Not Available | 712 | Open in IMG/M |
| 3300009093|Ga0105240_10010307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13157 | Open in IMG/M |
| 3300009137|Ga0066709_104343118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300009175|Ga0073936_10439960 | Not Available | 784 | Open in IMG/M |
| 3300009400|Ga0116854_1062197 | All Organisms → cellular organisms → Bacteria | 3549 | Open in IMG/M |
| 3300009545|Ga0105237_12050326 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 581 | Open in IMG/M |
| 3300009547|Ga0116136_1038232 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300009547|Ga0116136_1151517 | Not Available | 587 | Open in IMG/M |
| 3300009551|Ga0105238_10384213 | Not Available | 1396 | Open in IMG/M |
| 3300009552|Ga0116138_1241560 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 500 | Open in IMG/M |
| 3300009616|Ga0116111_1045921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1291 | Open in IMG/M |
| 3300009637|Ga0116118_1016043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2852 | Open in IMG/M |
| 3300009640|Ga0116126_1061525 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1430 | Open in IMG/M |
| 3300009643|Ga0116110_1025934 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
| 3300009698|Ga0116216_10906674 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300009762|Ga0116130_1134319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300009824|Ga0116219_10151017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1344 | Open in IMG/M |
| 3300009824|Ga0116219_10482865 | Not Available | 686 | Open in IMG/M |
| 3300009839|Ga0116223_10279034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300010043|Ga0126380_11134577 | Not Available | 669 | Open in IMG/M |
| 3300010373|Ga0134128_10000877 | All Organisms → cellular organisms → Bacteria | 40981 | Open in IMG/M |
| 3300010373|Ga0134128_11673727 | Not Available | 700 | Open in IMG/M |
| 3300010379|Ga0136449_102726609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300010379|Ga0136449_102769843 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 693 | Open in IMG/M |
| 3300010396|Ga0134126_10018694 | Not Available | 8789 | Open in IMG/M |
| 3300012096|Ga0137389_10776375 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300012096|Ga0137389_10817263 | Not Available | 800 | Open in IMG/M |
| 3300012201|Ga0137365_10575523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 826 | Open in IMG/M |
| 3300012204|Ga0137374_11100625 | Not Available | 565 | Open in IMG/M |
| 3300012210|Ga0137378_10050387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3748 | Open in IMG/M |
| 3300012353|Ga0137367_10567078 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300012533|Ga0138256_10034093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5231 | Open in IMG/M |
| 3300012917|Ga0137395_11007883 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012925|Ga0137419_11663473 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012929|Ga0137404_10160227 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
| 3300012929|Ga0137404_11684336 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012931|Ga0153915_10215600 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 2113 | Open in IMG/M |
| 3300012944|Ga0137410_10852863 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300014151|Ga0181539_1237727 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300014167|Ga0181528_10045150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2452 | Open in IMG/M |
| 3300014199|Ga0181535_10451379 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300014200|Ga0181526_11084445 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300014489|Ga0182018_10067546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 2144 | Open in IMG/M |
| 3300014490|Ga0182010_10401163 | Not Available | 748 | Open in IMG/M |
| 3300014491|Ga0182014_10123163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1511 | Open in IMG/M |
| 3300014491|Ga0182014_10223102 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300014492|Ga0182013_10080650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2283 | Open in IMG/M |
| 3300014501|Ga0182024_10031321 | All Organisms → cellular organisms → Bacteria | 9099 | Open in IMG/M |
| 3300014501|Ga0182024_10045537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7082 | Open in IMG/M |
| 3300014501|Ga0182024_10334817 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1984 | Open in IMG/M |
| 3300014501|Ga0182024_10999917 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300014502|Ga0182021_13384658 | Not Available | 531 | Open in IMG/M |
| 3300014838|Ga0182030_10070206 | All Organisms → cellular organisms → Bacteria | 5209 | Open in IMG/M |
| 3300014839|Ga0182027_10253918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2009 | Open in IMG/M |
| 3300015245|Ga0137409_10713285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 838 | Open in IMG/M |
| 3300015264|Ga0137403_10099920 | All Organisms → cellular organisms → Bacteria | 2910 | Open in IMG/M |
| 3300015374|Ga0132255_100502686 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300017925|Ga0187856_1003732 | All Organisms → cellular organisms → Bacteria | 10473 | Open in IMG/M |
| 3300017925|Ga0187856_1105590 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300017931|Ga0187877_1165568 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300017934|Ga0187803_10342633 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300017941|Ga0187850_10052150 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 2108 | Open in IMG/M |
| 3300017970|Ga0187783_11374746 | Not Available | 509 | Open in IMG/M |
| 3300017998|Ga0187870_1052479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1738 | Open in IMG/M |
| 3300018002|Ga0187868_1112394 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300018013|Ga0187873_1209413 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300018015|Ga0187866_1002253 | All Organisms → cellular organisms → Bacteria | 16364 | Open in IMG/M |
| 3300018023|Ga0187889_10275238 | Not Available | 751 | Open in IMG/M |
| 3300018025|Ga0187885_10128435 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300018026|Ga0187857_10145711 | Not Available | 1128 | Open in IMG/M |
| 3300018043|Ga0187887_10113783 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1626 | Open in IMG/M |
| 3300018088|Ga0187771_11847026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 513 | Open in IMG/M |
| 3300019487|Ga0187893_10019324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8634 | Open in IMG/M |
| 3300020583|Ga0210401_10016916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7031 | Open in IMG/M |
| 3300020583|Ga0210401_11051773 | Not Available | 673 | Open in IMG/M |
| 3300020583|Ga0210401_11082076 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300021170|Ga0210400_10002851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15587 | Open in IMG/M |
| 3300021420|Ga0210394_10138296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2113 | Open in IMG/M |
| 3300021420|Ga0210394_10364487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1270 | Open in IMG/M |
| 3300021559|Ga0210409_10478152 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300022555|Ga0212088_10118806 | All Organisms → cellular organisms → Bacteria | 2347 | Open in IMG/M |
| 3300022557|Ga0212123_10019117 | All Organisms → cellular organisms → Bacteria | 8012 | Open in IMG/M |
| 3300023088|Ga0224555_1004033 | All Organisms → cellular organisms → Bacteria | 14028 | Open in IMG/M |
| 3300025154|Ga0209417_1170897 | Not Available | 851 | Open in IMG/M |
| 3300025316|Ga0209697_10563604 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300025891|Ga0209585_10475279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300025913|Ga0207695_10017146 | All Organisms → cellular organisms → Bacteria | 8442 | Open in IMG/M |
| 3300025934|Ga0207686_10873388 | Not Available | 724 | Open in IMG/M |
| 3300025938|Ga0207704_11410054 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300025949|Ga0207667_12117302 | Not Available | 521 | Open in IMG/M |
| 3300026116|Ga0207674_11023738 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 795 | Open in IMG/M |
| 3300026273|Ga0209881_1118590 | Not Available | 660 | Open in IMG/M |
| 3300026555|Ga0179593_1025434 | All Organisms → cellular organisms → Bacteria | 3181 | Open in IMG/M |
| 3300027889|Ga0209380_10170298 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300027898|Ga0209067_10008213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5605 | Open in IMG/M |
| 3300027986|Ga0209168_10000006 | All Organisms → cellular organisms → Bacteria | 244093 | Open in IMG/M |
| 3300027986|Ga0209168_10041631 | All Organisms → cellular organisms → Bacteria | 2491 | Open in IMG/M |
| 3300028562|Ga0302151_10037148 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300028873|Ga0302197_10534921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300028906|Ga0308309_11138613 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031234|Ga0302325_10011973 | All Organisms → cellular organisms → Bacteria | 18656 | Open in IMG/M |
| 3300031236|Ga0302324_101203717 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300031236|Ga0302324_103498020 | Not Available | 509 | Open in IMG/M |
| 3300031474|Ga0170818_104728100 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031595|Ga0265313_10034195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2573 | Open in IMG/M |
| 3300031708|Ga0310686_104564671 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300031962|Ga0307479_11888903 | Not Available | 548 | Open in IMG/M |
| 3300031965|Ga0326597_10168358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2600 | Open in IMG/M |
| 3300032770|Ga0335085_10001175 | All Organisms → cellular organisms → Bacteria | 59575 | Open in IMG/M |
| 3300032770|Ga0335085_11392309 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300032892|Ga0335081_11964466 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300032893|Ga0335069_12144429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300033888|Ga0334792_147752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300033977|Ga0314861_0216771 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.22% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.73% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.99% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.99% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.99% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 2.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.24% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.24% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.24% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.24% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.24% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.49% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.49% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.49% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.49% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.75% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.75% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.75% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.75% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.75% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908028 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 3300002569 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009400 | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300025154 | Soil microbial communities from Rifle, Colorado, USA - Groundwater F2 | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| beta3_all_01256200 | 2124908028 | Soil | VVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEARKLFEGM |
| JGI24136J36422_100534072 | 3300002569 | Arctic Peat Soil | VVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEARKLFEGM* |
| Ga0062389_1047195282 | 3300004092 | Bog Forest Soil | EVVLEQADKLKAEIAEMEEEIKTKRKQLVKFEEARKLFEGM* |
| Ga0070741_106800821 | 3300005529 | Surface Soil | VVLEQADKLRAEILEAEEELKAKRRQLEKFEAAKKLFEAS* |
| Ga0070741_110885961 | 3300005529 | Surface Soil | EVVLEQADKLKAEIAEMEEELKSKRRQLQKFEEARKLFEGV* |
| Ga0070734_100835881 | 3300005533 | Surface Soil | VLEQADKLRAEIAEMEEELKAKKRQLQKFEEAKKLFEAV* |
| Ga0070735_1000029239 | 3300005534 | Surface Soil | VEVVLEQADKLKAEIAELEEEIKAKRRQLQKFEEARKLFEAV* |
| Ga0070735_108010011 | 3300005534 | Surface Soil | EVVMEQADKLKTEIAEAEEELKAKRRQLEKFEQAKKLFEGV* |
| Ga0070731_110611951 | 3300005538 | Surface Soil | EQADKLKAEIAEMEEELKAKRKQLQKFEEARKLFESA* |
| Ga0068855_1007688924 | 3300005563 | Corn Rhizosphere | EQADKLKAEIAEAEEEIKAKRRQLEKFEQAKKLFEGV* |
| Ga0068857_1010041692 | 3300005577 | Corn Rhizosphere | VVLEQAEKLKAEIAEGEEALKAKRRQLEKFEQAKKLF |
| Ga0068852_1021701732 | 3300005616 | Corn Rhizosphere | MEQADKLKAEIADAEEDLKAKRRQLEKFEQAKKLFEGV* |
| Ga0074470_117907911 | 3300005836 | Sediment (Intertidal) | EVVMEQADKLKAEIAEDEELLKAKKKQLQKFEEAKKIFETS* |
| Ga0070766_100488144 | 3300005921 | Soil | VVLEQADKLKAEIAEMEEEIKTKRKQLVKFEEARKLFEGM* |
| Ga0075019_100143956 | 3300006086 | Watersheds | VVLEQAEKLKAEIAEAEEELKAKRRQLEKFEQARKLFEGV* |
| Ga0075030_1006665611 | 3300006162 | Watersheds | LEQADKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEGM* |
| Ga0070765_1023006621 | 3300006176 | Soil | KKSPVEVVLEQADKLKAEIAEMEEEIKTKRKQLVKFEEARKLFEGM* |
| Ga0075527_101410381 | 3300006640 | Arctic Peat Soil | KSPVEVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEARKLFEGM* |
| Ga0073928_1000804517 | 3300006893 | Iron-Sulfur Acid Spring | VVLEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEAV* |
| Ga0099829_113955511 | 3300009038 | Vadose Zone Soil | LEQADKLKDEITEMEEDLKAKRRQLQKFEEARKLF |
| Ga0099827_110362261 | 3300009090 | Vadose Zone Soil | PVEVVLEQADKLKTEIAEMEEELKTKRRQLQKFEEARKLFESV* |
| Ga0105240_1001030710 | 3300009093 | Corn Rhizosphere | MEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV* |
| Ga0066709_1043431181 | 3300009137 | Grasslands Soil | TEKLKAQIAEREDEIKELRKQLQKFEEARKIFESA* |
| Ga0073936_104399603 | 3300009175 | Freshwater Lake Hypolimnion | VLEQADKLKAEIAEAEEELKAKRKQLQKFEEAKKIFEAI* |
| Ga0116854_10621972 | 3300009400 | Soil | VVLEQADKLKAEIAETEEELKAKRRQLQKFEEARKLFEGM* |
| Ga0105237_120503262 | 3300009545 | Corn Rhizosphere | VVLEQADKLKAEIADMEEEIKAKRRQLVKFEEAKKLFEGM* |
| Ga0116136_10382322 | 3300009547 | Peatland | MEQADKLKAEIAEAEEELKAKRHQLEKFEQAKKLFEGV* |
| Ga0116136_11515172 | 3300009547 | Peatland | KSPVEVVMEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV* |
| Ga0105238_103842135 | 3300009551 | Corn Rhizosphere | DKLKSEIAEMEEEIKAKRKQLEKFEQAKKLFEAM* |
| Ga0116138_12415602 | 3300009552 | Peatland | LEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEGM* |
| Ga0116111_10459212 | 3300009616 | Peatland | LEQADKLKAEIAELEEELKAKRRQLEKFEQAKKLFEGV* |
| Ga0116118_10160432 | 3300009637 | Peatland | VVLEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV* |
| Ga0116126_10615254 | 3300009640 | Peatland | VVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM* |
| Ga0116110_10259342 | 3300009643 | Peatland | MEQADKLKAEIAELEEELKAKRRQLEKFEQAKKLFEGV* |
| Ga0116216_109066741 | 3300009698 | Peatlands Soil | VVLEQADKLKAEITEMEEEIKAKRRQLAKFEEAKKLFEGM* |
| Ga0116130_11343191 | 3300009762 | Peatland | QADKLKAEIAEVEEELKAKRRQLEKFEQAKKLFEGL* |
| Ga0116219_101510172 | 3300009824 | Peatlands Soil | VVLEQAEKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEGM* |
| Ga0116219_104828652 | 3300009824 | Peatlands Soil | MEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGL* |
| Ga0116223_102790341 | 3300009839 | Peatlands Soil | KSPVDVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM* |
| Ga0126380_111345771 | 3300010043 | Tropical Forest Soil | KKSPVEIVLDQAEKLKTEIAEAEEELKAKKRQLEKFEQARKLFEAS* |
| Ga0134128_100008773 | 3300010373 | Terrestrial Soil | LEQADKLRAEIAEAEEDLKTKRKQLEKFEAAKKLFEGS* |
| Ga0134128_116737272 | 3300010373 | Terrestrial Soil | VEVVLEQAEKLKSEIAEAEEEIKAKRRQLEKFEQAKKLFEGV* |
| Ga0136449_1027266092 | 3300010379 | Peatlands Soil | LEQADKLKAEIGEMEEELKAKRRQLQKFEEAKKLFEGM* |
| Ga0136449_1027698432 | 3300010379 | Peatlands Soil | VVLEQAEKLKAEIAEAEEELKAKKRQLQKFEEAKKLFEGM* |
| Ga0134126_100186942 | 3300010396 | Terrestrial Soil | VVLEQAEKLKSEIAEAEEEIKAKRRQLEKFEQAKKLFEGA* |
| Ga0137389_107763752 | 3300012096 | Vadose Zone Soil | LEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM* |
| Ga0137389_108172632 | 3300012096 | Vadose Zone Soil | VVLEQADKLKAEIAETEEELKAKRKQLLKFEEARKLFEGM* |
| Ga0137365_105755232 | 3300012201 | Vadose Zone Soil | VVLEQAEKLKTEIAEGEEELKAKRRQLEKFEQAKKLFEGI* |
| Ga0137374_111006252 | 3300012204 | Vadose Zone Soil | VEVVLEQAEKLKSEIAEAEEELKSKKRQLAKFEEARKLFETM* |
| Ga0137378_100503872 | 3300012210 | Vadose Zone Soil | LEQAEKLKTEIAEGEEELKAKRRQLEKFEQARKLFEGI* |
| Ga0137367_105670782 | 3300012353 | Vadose Zone Soil | VLEQTDKLREQIAAKEEELKDLRHQLQKFEEARKIFEVA* |
| Ga0138256_100340936 | 3300012533 | Active Sludge | VVLEQADKLKAEIAEAEEELKAKRKQLQKFEEAKKIFEAI* |
| Ga0137395_110078832 | 3300012917 | Vadose Zone Soil | VVLEQADKLRQEITEAEEELKLKRKQLQKFEEAKKIFEGI* |
| Ga0137419_116634731 | 3300012925 | Vadose Zone Soil | VVLEQADKLKAEIAQGEEELKAKRKQLQKFEEARKI |
| Ga0137404_101602272 | 3300012929 | Vadose Zone Soil | VVLEQAEKLKVEIAEGEEELKAKRRQLEKFEQAKKLFEGI* |
| Ga0137404_116843362 | 3300012929 | Vadose Zone Soil | VVLEQADKLRAEIAETEEELKAKRKQLQKFEEAKKIFEAS* |
| Ga0153915_102156005 | 3300012931 | Freshwater Wetlands | MEQADKLKAEIAETEEELKAKRRQLQKLEEAKKIFEAN* |
| Ga0137410_108528632 | 3300012944 | Vadose Zone Soil | VVLKQADKLKAEIAEMEEEIKAKKRQLHKFEEAKKIFEAS* |
| Ga0181539_12377272 | 3300014151 | Bog | VVLEQADKLKAEIAELEEELKAKRRQLEKFEQAKKLFEGV* |
| Ga0181528_100451506 | 3300014167 | Bog | SPVEVVMEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV* |
| Ga0181535_104513792 | 3300014199 | Bog | LEQAEKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEGM* |
| Ga0181526_110844451 | 3300014200 | Bog | MEQADKLKAEIAEMEEELKAKKRQLQKFEEAKKLFEAV* |
| Ga0182018_100675466 | 3300014489 | Palsa | MEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEGI* |
| Ga0182010_104011633 | 3300014490 | Fen | EQADKLKAEIAEMEEEMKAKRRQLEKFEQAKKLFEGI* |
| Ga0182014_101231632 | 3300014491 | Bog | VLFEQADKLRAEIAEAEEELNAKKRQLQKFDEAKKLFEAM* |
| Ga0182014_102231022 | 3300014491 | Bog | VVFEQAEKLRAEIAEAEEELNAKKRQLQKFEEAKKLFEAM* |
| Ga0182013_100806503 | 3300014492 | Bog | VLFEQADKLRAEIAEAEEELNAKRRQLQKFDEAKKLFEAL* |
| Ga0182024_100313214 | 3300014501 | Permafrost | VEVVLEQADKLRAEIAEAEEELKAKRKQLQKFEEAKKIFEGI* |
| Ga0182024_100455375 | 3300014501 | Permafrost | VVLEQADKLKSEIAEMEEEIKAKRKQLVKFEEARKLFAD* |
| Ga0182024_103348173 | 3300014501 | Permafrost | VVLEQADKLKAEIAEMEEEVKAKRRQLVKFEEARKLFEGM* |
| Ga0182024_109999173 | 3300014501 | Permafrost | VVLEQADKLKAEIAEMEEEIKTKRKQLVKFEEARKLFDGM* |
| Ga0182021_133846581 | 3300014502 | Fen | LDQAKKLREEIAAAEEDLKQKRKQLEKFEQACKIFETS* |
| Ga0182030_100702063 | 3300014838 | Bog | VVLEQADKLKAEIAETEEAIKAKRRQLEKFEQAKKLFEGI* |
| Ga0182027_102539182 | 3300014839 | Fen | VVFEQADKLRAEIVEAEEVLNAKKRQLQKFEEAKKLFEAL* |
| Ga0137409_107132852 | 3300015245 | Vadose Zone Soil | VVLEQADKLKAEIAEMEEEIKAKKRQLHKFEEAKKIFEAS* |
| Ga0137403_100999203 | 3300015264 | Vadose Zone Soil | LEQAEKLKVEIAEGEEELKAKRRQLEKFEQAKKLFEGI* |
| Ga0132255_1005026864 | 3300015374 | Arabidopsis Rhizosphere | VDFEQTDKLREQIAEKEEELKALRKQLEKFEEARKIFEVAD* |
| Ga0187856_10037324 | 3300017925 | Peatland | VVLEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV |
| Ga0187856_11055902 | 3300017925 | Peatland | MEQADKLKAEIAELEEELKAKRRQLEKFEQAKKLFEGV |
| Ga0187877_11655682 | 3300017931 | Peatland | MEQADKLKAEIAEAEEELKAKRHQLEKFEQAKKLFEGV |
| Ga0187803_103426332 | 3300017934 | Freshwater Sediment | MEQADKLKAEIAEAEEELKAERRQLEKFEQAKKLFEGV |
| Ga0187850_100521504 | 3300017941 | Peatland | LEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEGM |
| Ga0187783_113747461 | 3300017970 | Tropical Peatland | ADKLKSEIAEMEEEIRAKKRQLEKFEQARKLFEAS |
| Ga0187870_10524795 | 3300017998 | Peatland | ADKLKAEIAEMEEALKAKRRQLEKFEQARKLFEGA |
| Ga0187868_11123942 | 3300018002 | Peatland | VVLEQADKLKAEIAELEEELKAKRRQLEKFEQAKKLFEGV |
| Ga0187873_12094132 | 3300018013 | Peatland | MEQADKLKAEIAEAEEELKAKRHQLEKFEQVKKLFEGV |
| Ga0187866_100225312 | 3300018015 | Peatland | LEQADKLKAEIAEMEEALKAKRRQLEKFEQARKLFEGA |
| Ga0187889_102752381 | 3300018023 | Peatland | QADKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEGM |
| Ga0187885_101284352 | 3300018025 | Peatland | LEQADKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEAL |
| Ga0187857_101457111 | 3300018026 | Peatland | TPVEVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM |
| Ga0187887_101137832 | 3300018043 | Peatland | VVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM |
| Ga0187771_118470262 | 3300018088 | Tropical Peatland | LEQAEKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEGI |
| Ga0187893_100193245 | 3300019487 | Microbial Mat On Rocks | VVLEQADKLKAEIAELEEELKAKRKQLQKFEEAKKIFEAS |
| Ga0210401_100169164 | 3300020583 | Soil | LEQAEKLKSEIAEGEEELKAKRRQLEKFEQARKLFEGV |
| Ga0210401_110517731 | 3300020583 | Soil | LEQADKLKAEIAEIEEELKAKRRQLQKFEEARKLFEAM |
| Ga0210401_110820762 | 3300020583 | Soil | VVLEQADKLKAEIAEMEEEVKAKRRQLVKFEEAKKLFEGM |
| Ga0210400_1000285115 | 3300021170 | Soil | VEVVLEQAEKLRREIAEGEEELRQKRKQLQKFEEAKKIFEAS |
| Ga0210394_101382966 | 3300021420 | Soil | LEQADKLKSEIAEMEEELKAKRRQLQKFEEARKLFEAV |
| Ga0210394_103644874 | 3300021420 | Soil | VVLEQAEKLKAEIAEQEEDLKAKRKQLQKFEEARKLFEGM |
| Ga0210409_104781522 | 3300021559 | Soil | VVLEQADKLKAEIAETEEELKAKRKQLLKFEEARKLFEGM |
| Ga0212088_101188063 | 3300022555 | Freshwater Lake Hypolimnion | VVLEQADKLKAEIAEAEEELKAKRKQLQKFEEAKKIFEAI |
| Ga0212123_1001911710 | 3300022557 | Iron-Sulfur Acid Spring | LEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEAV |
| Ga0224555_10040336 | 3300023088 | Soil | VLFEQADKLRAEIAEAEEELNAKKRQLQKFDEAKKLFEAM |
| Ga0209417_11708973 | 3300025154 | Soil | KKKSPVEVVFEQAEKLRAEIAEAEEELAAKKRQLQKFEEAKKLFEAL |
| Ga0209697_105636042 | 3300025316 | Freshwater Lake Hypolimnion | AERLRAEIAEEEEELNAKKRQLQKFEEAKKLFEAM |
| Ga0209585_104752791 | 3300025891 | Arctic Peat Soil | VLEQADKLKAEIAEMEEEIKAKRRQLVKFEEARKLFEGM |
| Ga0207695_100171463 | 3300025913 | Corn Rhizosphere | MEQADKLKAEIADAEEDLKAKRRQLEKFEQAKKLFEGV |
| Ga0207686_108733883 | 3300025934 | Miscanthus Rhizosphere | EQADKLKAEIAEAEEEIKAKKRQLEKFEQARKLFEVS |
| Ga0207704_114100541 | 3300025938 | Miscanthus Rhizosphere | VVLEQADKLKSEIAEMEEEIKAKRKQLEKFEQAKK |
| Ga0207667_121173023 | 3300025949 | Corn Rhizosphere | QADKLKAEIAEAEEEIKAKRRQLEKFEQAKKLFEGV |
| Ga0207674_110237381 | 3300026116 | Corn Rhizosphere | VVLEQAEKLKTEIAEGEEALKAKRRQLEKFEQAKKLFEG |
| Ga0209881_11185903 | 3300026273 | Soil | LEQADKLKAEIAEMEEEIKAKRRQLVKFEEARKLFEGM |
| Ga0179593_10254346 | 3300026555 | Vadose Zone Soil | VVLEQADKLRREIAEAEEDLKQKRKQLQKFEEAKKIFEAS |
| Ga0209380_101702982 | 3300027889 | Soil | VVLEQADKLKAEIAEMEEEIKTKRKQLVKFEEARKLFEGM |
| Ga0209067_100082132 | 3300027898 | Watersheds | VVLEQAEKLKAEIAEAEEELKAKRRQLEKFEQARKLFEGV |
| Ga0209168_10000006207 | 3300027986 | Surface Soil | VEVVLEQADKLKAEIAELEEEIKAKRRQLQKFEEARKLFEAV |
| Ga0209168_100416315 | 3300027986 | Surface Soil | VVLEQADKLKAEIAEMEEEIKAKRKQLQKFEEAKKLFEGM |
| Ga0302151_100371481 | 3300028562 | Bog | VVFEQADKLRAEIVEAEEVLNAKKRQLQKFEEAKKLFEAL |
| Ga0302197_105349212 | 3300028873 | Bog | DVVFEQADKLRAEIVEAEEVLNAKKRQLQKFEEAKKLFEAL |
| Ga0308309_111386132 | 3300028906 | Soil | MEQGDKLKAEIAELEEELKAKRKQLLKFEEARKLFEAV |
| Ga0302325_1001197320 | 3300031234 | Palsa | MEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEGI |
| Ga0302324_1012037172 | 3300031236 | Palsa | VVLEQADKLRAEIAETEEELKAKRKQLQKSEEAKKIFEAS |
| Ga0302324_1034980202 | 3300031236 | Palsa | LDVLLEQGEKLKAEIAQMENELKDKRRQLQKFEEARKLFEAL |
| Ga0170818_1047281002 | 3300031474 | Forest Soil | MEQADKLKAEIAEGEEELKSKRRQLEKFEQAKKLFEGS |
| Ga0265313_100341956 | 3300031595 | Rhizosphere | PVEVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM |
| Ga0310686_1045646713 | 3300031708 | Soil | VVLEQAEKLKAEIAETEEELKAKRKQLQKFEEAKKIFEAI |
| Ga0307479_118889032 | 3300031962 | Hardwood Forest Soil | PVEVVLEQADKLKSEIAEMEEELKQKRRQLQKFEEARKLFESA |
| Ga0326597_101683585 | 3300031965 | Soil | LEQADKLKAEIAEAEEELKAKKRQLQKFEEAKKLFEAI |
| Ga0335085_1000117514 | 3300032770 | Soil | MEQAEKLRAEIAEAEEEIKAKKRQLQKFEEARKLFEGA |
| Ga0335085_113923092 | 3300032770 | Soil | VVLEQADKLRAEIAEAEGELKAKRRQLAKFEEAKKLFE |
| Ga0335081_119644661 | 3300032892 | Soil | VVLEQADKLRAEIAETEEELKAKRKQLQKFEEAKKIFEAS |
| Ga0335069_121444291 | 3300032893 | Soil | LEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM |
| Ga0334792_147752_1_111 | 3300033888 | Soil | QAERLRSEIAEEEEELNAKKRQLQKFEEAKKLFEAM |
| Ga0314861_0216771_389_505 | 3300033977 | Peatland | MEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV |
| ⦗Top⦘ |