NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F059139

Metagenome Family F059139

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059139
Family Type Metagenome
Number of Sequences 134
Average Sequence Length 39 residues
Representative Sequence LEQADKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEGM
Number of Associated Samples 115
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 61.94 %
% of genes near scaffold ends (potentially truncated) 35.82 %
% of genes from short scaffolds (< 2000 bps) 68.66 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.119 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.940 % of family members)
Environment Ontology (ENVO) Unclassified
(27.612 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.299 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 54.55%    β-sheet: 0.00%    Coil/Unstructured: 45.45%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF11171DUF2958 41.79
PF00589Phage_integrase 35.07
PF00899ThiF 3.73
PF13408Zn_ribbon_recom 2.24
PF13814Replic_Relax 1.49
PF04266ASCH 0.75
PF10412TrwB_AAD_bind 0.75
PF13620CarboxypepD_reg 0.75
PF05368NmrA 0.75
PF12696TraG-D_C 0.75
PF11737DUF3300 0.75
PF05063MT-A70 0.75
PF14464Prok-JAB 0.75
PF12728HTH_17 0.75
PF13439Glyco_transf_4 0.75
PF01867Cas_Cas1 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG4725N6-adenosine-specific RNA methylase IME4Translation, ribosomal structure and biogenesis [J] 1.49
COG1518CRISPR-Cas system-associated integrase Cas1Defense mechanisms [V] 0.75
COG2411Predicted RNA-binding protein, contains PUA-like ASCH domainGeneral function prediction only [R] 0.75
COG3097Uncharacterized conserved protein YqfB, UPF0267 familyFunction unknown [S] 0.75
COG4405Predicted RNA-binding protein YhfF, contains PUA-like ASCH domainGeneral function prediction only [R] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.12 %
UnclassifiedrootN/A23.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908028|beta3_all_NODE_6560_len_1963_cov_6_713704All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium2013Open in IMG/M
3300002569|JGI24136J36422_10053407All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300004092|Ga0062389_104719528Not Available513Open in IMG/M
3300005529|Ga0070741_10680082Not Available910Open in IMG/M
3300005529|Ga0070741_11088596Not Available680Open in IMG/M
3300005533|Ga0070734_10083588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1886Open in IMG/M
3300005534|Ga0070735_10000292All Organisms → cellular organisms → Bacteria59325Open in IMG/M
3300005534|Ga0070735_10801001Not Available555Open in IMG/M
3300005538|Ga0070731_11061195Not Available536Open in IMG/M
3300005563|Ga0068855_100768892Not Available1026Open in IMG/M
3300005577|Ga0068857_101004169All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium803Open in IMG/M
3300005616|Ga0068852_102170173All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005836|Ga0074470_11790791Not Available633Open in IMG/M
3300005921|Ga0070766_10048814All Organisms → cellular organisms → Bacteria2371Open in IMG/M
3300006086|Ga0075019_10014395All Organisms → cellular organisms → Bacteria → Acidobacteria4417Open in IMG/M
3300006162|Ga0075030_100666561Not Available824Open in IMG/M
3300006176|Ga0070765_102300662Not Available502Open in IMG/M
3300006640|Ga0075527_10141038Not Available679Open in IMG/M
3300006893|Ga0073928_10008045All Organisms → cellular organisms → Bacteria13384Open in IMG/M
3300009038|Ga0099829_11395551All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium579Open in IMG/M
3300009090|Ga0099827_11036226Not Available712Open in IMG/M
3300009093|Ga0105240_10010307All Organisms → cellular organisms → Bacteria → Acidobacteria13157Open in IMG/M
3300009137|Ga0066709_104343118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300009175|Ga0073936_10439960Not Available784Open in IMG/M
3300009400|Ga0116854_1062197All Organisms → cellular organisms → Bacteria3549Open in IMG/M
3300009545|Ga0105237_12050326All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium581Open in IMG/M
3300009547|Ga0116136_1038232All Organisms → cellular organisms → Bacteria1412Open in IMG/M
3300009547|Ga0116136_1151517Not Available587Open in IMG/M
3300009551|Ga0105238_10384213Not Available1396Open in IMG/M
3300009552|Ga0116138_1241560All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium500Open in IMG/M
3300009616|Ga0116111_1045921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1291Open in IMG/M
3300009637|Ga0116118_1016043All Organisms → cellular organisms → Bacteria → Acidobacteria2852Open in IMG/M
3300009640|Ga0116126_1061525All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium1430Open in IMG/M
3300009643|Ga0116110_1025934All Organisms → cellular organisms → Bacteria2229Open in IMG/M
3300009698|Ga0116216_10906674All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300009762|Ga0116130_1134319All Organisms → cellular organisms → Bacteria → Acidobacteria779Open in IMG/M
3300009824|Ga0116219_10151017All Organisms → cellular organisms → Bacteria → Acidobacteria1344Open in IMG/M
3300009824|Ga0116219_10482865Not Available686Open in IMG/M
3300009839|Ga0116223_10279034All Organisms → cellular organisms → Bacteria → Acidobacteria1002Open in IMG/M
3300010043|Ga0126380_11134577Not Available669Open in IMG/M
3300010373|Ga0134128_10000877All Organisms → cellular organisms → Bacteria40981Open in IMG/M
3300010373|Ga0134128_11673727Not Available700Open in IMG/M
3300010379|Ga0136449_102726609All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300010379|Ga0136449_102769843All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium693Open in IMG/M
3300010396|Ga0134126_10018694Not Available8789Open in IMG/M
3300012096|Ga0137389_10776375All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300012096|Ga0137389_10817263Not Available800Open in IMG/M
3300012201|Ga0137365_10575523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium826Open in IMG/M
3300012204|Ga0137374_11100625Not Available565Open in IMG/M
3300012210|Ga0137378_10050387All Organisms → cellular organisms → Bacteria → Acidobacteria3748Open in IMG/M
3300012353|Ga0137367_10567078All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300012533|Ga0138256_10034093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5231Open in IMG/M
3300012917|Ga0137395_11007883All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300012925|Ga0137419_11663473All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300012929|Ga0137404_10160227All Organisms → cellular organisms → Bacteria1879Open in IMG/M
3300012929|Ga0137404_11684336All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012931|Ga0153915_10215600All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium2113Open in IMG/M
3300012944|Ga0137410_10852863All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300014151|Ga0181539_1237727All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300014167|Ga0181528_10045150All Organisms → cellular organisms → Bacteria → Acidobacteria2452Open in IMG/M
3300014199|Ga0181535_10451379All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300014200|Ga0181526_11084445All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300014489|Ga0182018_10067546All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium2144Open in IMG/M
3300014490|Ga0182010_10401163Not Available748Open in IMG/M
3300014491|Ga0182014_10123163All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1511Open in IMG/M
3300014491|Ga0182014_10223102All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300014492|Ga0182013_10080650All Organisms → cellular organisms → Bacteria → Acidobacteria2283Open in IMG/M
3300014501|Ga0182024_10031321All Organisms → cellular organisms → Bacteria9099Open in IMG/M
3300014501|Ga0182024_10045537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia7082Open in IMG/M
3300014501|Ga0182024_10334817All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium1984Open in IMG/M
3300014501|Ga0182024_10999917All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300014502|Ga0182021_13384658Not Available531Open in IMG/M
3300014838|Ga0182030_10070206All Organisms → cellular organisms → Bacteria5209Open in IMG/M
3300014839|Ga0182027_10253918All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2009Open in IMG/M
3300015245|Ga0137409_10713285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium838Open in IMG/M
3300015264|Ga0137403_10099920All Organisms → cellular organisms → Bacteria2910Open in IMG/M
3300015374|Ga0132255_100502686All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300017925|Ga0187856_1003732All Organisms → cellular organisms → Bacteria10473Open in IMG/M
3300017925|Ga0187856_1105590All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300017931|Ga0187877_1165568All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300017934|Ga0187803_10342633All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300017941|Ga0187850_10052150All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium2108Open in IMG/M
3300017970|Ga0187783_11374746Not Available509Open in IMG/M
3300017998|Ga0187870_1052479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1738Open in IMG/M
3300018002|Ga0187868_1112394All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300018013|Ga0187873_1209413All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300018015|Ga0187866_1002253All Organisms → cellular organisms → Bacteria16364Open in IMG/M
3300018023|Ga0187889_10275238Not Available751Open in IMG/M
3300018025|Ga0187885_10128435All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300018026|Ga0187857_10145711Not Available1128Open in IMG/M
3300018043|Ga0187887_10113783All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium1626Open in IMG/M
3300018088|Ga0187771_11847026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium513Open in IMG/M
3300019487|Ga0187893_10019324All Organisms → cellular organisms → Bacteria → Acidobacteria8634Open in IMG/M
3300020583|Ga0210401_10016916All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia7031Open in IMG/M
3300020583|Ga0210401_11051773Not Available673Open in IMG/M
3300020583|Ga0210401_11082076All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300021170|Ga0210400_10002851All Organisms → cellular organisms → Bacteria → Acidobacteria15587Open in IMG/M
3300021420|Ga0210394_10138296All Organisms → cellular organisms → Bacteria → Acidobacteria2113Open in IMG/M
3300021420|Ga0210394_10364487All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1270Open in IMG/M
3300021559|Ga0210409_10478152All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300022555|Ga0212088_10118806All Organisms → cellular organisms → Bacteria2347Open in IMG/M
3300022557|Ga0212123_10019117All Organisms → cellular organisms → Bacteria8012Open in IMG/M
3300023088|Ga0224555_1004033All Organisms → cellular organisms → Bacteria14028Open in IMG/M
3300025154|Ga0209417_1170897Not Available851Open in IMG/M
3300025316|Ga0209697_10563604All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300025891|Ga0209585_10475279All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300025913|Ga0207695_10017146All Organisms → cellular organisms → Bacteria8442Open in IMG/M
3300025934|Ga0207686_10873388Not Available724Open in IMG/M
3300025938|Ga0207704_11410054All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300025949|Ga0207667_12117302Not Available521Open in IMG/M
3300026116|Ga0207674_11023738All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium795Open in IMG/M
3300026273|Ga0209881_1118590Not Available660Open in IMG/M
3300026555|Ga0179593_1025434All Organisms → cellular organisms → Bacteria3181Open in IMG/M
3300027889|Ga0209380_10170298All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300027898|Ga0209067_10008213All Organisms → cellular organisms → Bacteria → Acidobacteria5605Open in IMG/M
3300027986|Ga0209168_10000006All Organisms → cellular organisms → Bacteria244093Open in IMG/M
3300027986|Ga0209168_10041631All Organisms → cellular organisms → Bacteria2491Open in IMG/M
3300028562|Ga0302151_10037148All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300028873|Ga0302197_10534921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300028906|Ga0308309_11138613All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300031234|Ga0302325_10011973All Organisms → cellular organisms → Bacteria18656Open in IMG/M
3300031236|Ga0302324_101203717All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300031236|Ga0302324_103498020Not Available509Open in IMG/M
3300031474|Ga0170818_104728100All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031595|Ga0265313_10034195All Organisms → cellular organisms → Bacteria → Acidobacteria2573Open in IMG/M
3300031708|Ga0310686_104564671All Organisms → cellular organisms → Bacteria2093Open in IMG/M
3300031962|Ga0307479_11888903Not Available548Open in IMG/M
3300031965|Ga0326597_10168358All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172600Open in IMG/M
3300032770|Ga0335085_10001175All Organisms → cellular organisms → Bacteria59575Open in IMG/M
3300032770|Ga0335085_11392309All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300032892|Ga0335081_11964466All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300032893|Ga0335069_12144429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300033888|Ga0334792_147752All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300033977|Ga0314861_0216771All Organisms → cellular organisms → Bacteria896Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland8.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.97%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil5.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.22%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.48%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.73%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.99%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.99%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost2.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.99%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion2.24%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.24%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.24%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.24%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.24%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.24%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.49%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.49%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.49%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.49%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.75%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.75%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.75%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.75%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.75%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.75%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.75%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908028Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
3300002569Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009175Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaGEnvironmentalOpen in IMG/M
3300009400Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012533Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MGEngineeredOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300025154Soil microbial communities from Rifle, Colorado, USA - Groundwater F2EnvironmentalOpen in IMG/M
3300025316Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025891Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026273Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028562Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
beta3_all_012562002124908028SoilVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEARKLFEGM
JGI24136J36422_1005340723300002569Arctic Peat SoilVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEARKLFEGM*
Ga0062389_10471952823300004092Bog Forest SoilEVVLEQADKLKAEIAEMEEEIKTKRKQLVKFEEARKLFEGM*
Ga0070741_1068008213300005529Surface SoilVVLEQADKLRAEILEAEEELKAKRRQLEKFEAAKKLFEAS*
Ga0070741_1108859613300005529Surface SoilEVVLEQADKLKAEIAEMEEELKSKRRQLQKFEEARKLFEGV*
Ga0070734_1008358813300005533Surface SoilVLEQADKLRAEIAEMEEELKAKKRQLQKFEEAKKLFEAV*
Ga0070735_10000292393300005534Surface SoilVEVVLEQADKLKAEIAELEEEIKAKRRQLQKFEEARKLFEAV*
Ga0070735_1080100113300005534Surface SoilEVVMEQADKLKTEIAEAEEELKAKRRQLEKFEQAKKLFEGV*
Ga0070731_1106119513300005538Surface SoilEQADKLKAEIAEMEEELKAKRKQLQKFEEARKLFESA*
Ga0068855_10076889243300005563Corn RhizosphereEQADKLKAEIAEAEEEIKAKRRQLEKFEQAKKLFEGV*
Ga0068857_10100416923300005577Corn RhizosphereVVLEQAEKLKAEIAEGEEALKAKRRQLEKFEQAKKLF
Ga0068852_10217017323300005616Corn RhizosphereMEQADKLKAEIADAEEDLKAKRRQLEKFEQAKKLFEGV*
Ga0074470_1179079113300005836Sediment (Intertidal)EVVMEQADKLKAEIAEDEELLKAKKKQLQKFEEAKKIFETS*
Ga0070766_1004881443300005921SoilVVLEQADKLKAEIAEMEEEIKTKRKQLVKFEEARKLFEGM*
Ga0075019_1001439563300006086WatershedsVVLEQAEKLKAEIAEAEEELKAKRRQLEKFEQARKLFEGV*
Ga0075030_10066656113300006162WatershedsLEQADKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEGM*
Ga0070765_10230066213300006176SoilKKSPVEVVLEQADKLKAEIAEMEEEIKTKRKQLVKFEEARKLFEGM*
Ga0075527_1014103813300006640Arctic Peat SoilKSPVEVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEARKLFEGM*
Ga0073928_10008045173300006893Iron-Sulfur Acid SpringVVLEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEAV*
Ga0099829_1139555113300009038Vadose Zone SoilLEQADKLKDEITEMEEDLKAKRRQLQKFEEARKLF
Ga0099827_1103622613300009090Vadose Zone SoilPVEVVLEQADKLKTEIAEMEEELKTKRRQLQKFEEARKLFESV*
Ga0105240_10010307103300009093Corn RhizosphereMEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV*
Ga0066709_10434311813300009137Grasslands SoilTEKLKAQIAEREDEIKELRKQLQKFEEARKIFESA*
Ga0073936_1043996033300009175Freshwater Lake HypolimnionVLEQADKLKAEIAEAEEELKAKRKQLQKFEEAKKIFEAI*
Ga0116854_106219723300009400SoilVVLEQADKLKAEIAETEEELKAKRRQLQKFEEARKLFEGM*
Ga0105237_1205032623300009545Corn RhizosphereVVLEQADKLKAEIADMEEEIKAKRRQLVKFEEAKKLFEGM*
Ga0116136_103823223300009547PeatlandMEQADKLKAEIAEAEEELKAKRHQLEKFEQAKKLFEGV*
Ga0116136_115151723300009547PeatlandKSPVEVVMEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV*
Ga0105238_1038421353300009551Corn RhizosphereDKLKSEIAEMEEEIKAKRKQLEKFEQAKKLFEAM*
Ga0116138_124156023300009552PeatlandLEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEGM*
Ga0116111_104592123300009616PeatlandLEQADKLKAEIAELEEELKAKRRQLEKFEQAKKLFEGV*
Ga0116118_101604323300009637PeatlandVVLEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV*
Ga0116126_106152543300009640PeatlandVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM*
Ga0116110_102593423300009643PeatlandMEQADKLKAEIAELEEELKAKRRQLEKFEQAKKLFEGV*
Ga0116216_1090667413300009698Peatlands SoilVVLEQADKLKAEITEMEEEIKAKRRQLAKFEEAKKLFEGM*
Ga0116130_113431913300009762PeatlandQADKLKAEIAEVEEELKAKRRQLEKFEQAKKLFEGL*
Ga0116219_1015101723300009824Peatlands SoilVVLEQAEKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEGM*
Ga0116219_1048286523300009824Peatlands SoilMEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGL*
Ga0116223_1027903413300009839Peatlands SoilKSPVDVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM*
Ga0126380_1113457713300010043Tropical Forest SoilKKSPVEIVLDQAEKLKTEIAEAEEELKAKKRQLEKFEQARKLFEAS*
Ga0134128_1000087733300010373Terrestrial SoilLEQADKLRAEIAEAEEDLKTKRKQLEKFEAAKKLFEGS*
Ga0134128_1167372723300010373Terrestrial SoilVEVVLEQAEKLKSEIAEAEEEIKAKRRQLEKFEQAKKLFEGV*
Ga0136449_10272660923300010379Peatlands SoilLEQADKLKAEIGEMEEELKAKRRQLQKFEEAKKLFEGM*
Ga0136449_10276984323300010379Peatlands SoilVVLEQAEKLKAEIAEAEEELKAKKRQLQKFEEAKKLFEGM*
Ga0134126_1001869423300010396Terrestrial SoilVVLEQAEKLKSEIAEAEEEIKAKRRQLEKFEQAKKLFEGA*
Ga0137389_1077637523300012096Vadose Zone SoilLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM*
Ga0137389_1081726323300012096Vadose Zone SoilVVLEQADKLKAEIAETEEELKAKRKQLLKFEEARKLFEGM*
Ga0137365_1057552323300012201Vadose Zone SoilVVLEQAEKLKTEIAEGEEELKAKRRQLEKFEQAKKLFEGI*
Ga0137374_1110062523300012204Vadose Zone SoilVEVVLEQAEKLKSEIAEAEEELKSKKRQLAKFEEARKLFETM*
Ga0137378_1005038723300012210Vadose Zone SoilLEQAEKLKTEIAEGEEELKAKRRQLEKFEQARKLFEGI*
Ga0137367_1056707823300012353Vadose Zone SoilVLEQTDKLREQIAAKEEELKDLRHQLQKFEEARKIFEVA*
Ga0138256_1003409363300012533Active SludgeVVLEQADKLKAEIAEAEEELKAKRKQLQKFEEAKKIFEAI*
Ga0137395_1100788323300012917Vadose Zone SoilVVLEQADKLRQEITEAEEELKLKRKQLQKFEEAKKIFEGI*
Ga0137419_1166347313300012925Vadose Zone SoilVVLEQADKLKAEIAQGEEELKAKRKQLQKFEEARKI
Ga0137404_1016022723300012929Vadose Zone SoilVVLEQAEKLKVEIAEGEEELKAKRRQLEKFEQAKKLFEGI*
Ga0137404_1168433623300012929Vadose Zone SoilVVLEQADKLRAEIAETEEELKAKRKQLQKFEEAKKIFEAS*
Ga0153915_1021560053300012931Freshwater WetlandsMEQADKLKAEIAETEEELKAKRRQLQKLEEAKKIFEAN*
Ga0137410_1085286323300012944Vadose Zone SoilVVLKQADKLKAEIAEMEEEIKAKKRQLHKFEEAKKIFEAS*
Ga0181539_123772723300014151BogVVLEQADKLKAEIAELEEELKAKRRQLEKFEQAKKLFEGV*
Ga0181528_1004515063300014167BogSPVEVVMEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV*
Ga0181535_1045137923300014199BogLEQAEKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEGM*
Ga0181526_1108444513300014200BogMEQADKLKAEIAEMEEELKAKKRQLQKFEEAKKLFEAV*
Ga0182018_1006754663300014489PalsaMEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEGI*
Ga0182010_1040116333300014490FenEQADKLKAEIAEMEEEMKAKRRQLEKFEQAKKLFEGI*
Ga0182014_1012316323300014491BogVLFEQADKLRAEIAEAEEELNAKKRQLQKFDEAKKLFEAM*
Ga0182014_1022310223300014491BogVVFEQAEKLRAEIAEAEEELNAKKRQLQKFEEAKKLFEAM*
Ga0182013_1008065033300014492BogVLFEQADKLRAEIAEAEEELNAKRRQLQKFDEAKKLFEAL*
Ga0182024_1003132143300014501PermafrostVEVVLEQADKLRAEIAEAEEELKAKRKQLQKFEEAKKIFEGI*
Ga0182024_1004553753300014501PermafrostVVLEQADKLKSEIAEMEEEIKAKRKQLVKFEEARKLFAD*
Ga0182024_1033481733300014501PermafrostVVLEQADKLKAEIAEMEEEVKAKRRQLVKFEEARKLFEGM*
Ga0182024_1099991733300014501PermafrostVVLEQADKLKAEIAEMEEEIKTKRKQLVKFEEARKLFDGM*
Ga0182021_1338465813300014502FenLDQAKKLREEIAAAEEDLKQKRKQLEKFEQACKIFETS*
Ga0182030_1007020633300014838BogVVLEQADKLKAEIAETEEAIKAKRRQLEKFEQAKKLFEGI*
Ga0182027_1025391823300014839FenVVFEQADKLRAEIVEAEEVLNAKKRQLQKFEEAKKLFEAL*
Ga0137409_1071328523300015245Vadose Zone SoilVVLEQADKLKAEIAEMEEEIKAKKRQLHKFEEAKKIFEAS*
Ga0137403_1009992033300015264Vadose Zone SoilLEQAEKLKVEIAEGEEELKAKRRQLEKFEQAKKLFEGI*
Ga0132255_10050268643300015374Arabidopsis RhizosphereVDFEQTDKLREQIAEKEEELKALRKQLEKFEEARKIFEVAD*
Ga0187856_100373243300017925PeatlandVVLEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV
Ga0187856_110559023300017925PeatlandMEQADKLKAEIAELEEELKAKRRQLEKFEQAKKLFEGV
Ga0187877_116556823300017931PeatlandMEQADKLKAEIAEAEEELKAKRHQLEKFEQAKKLFEGV
Ga0187803_1034263323300017934Freshwater SedimentMEQADKLKAEIAEAEEELKAERRQLEKFEQAKKLFEGV
Ga0187850_1005215043300017941PeatlandLEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEGM
Ga0187783_1137474613300017970Tropical PeatlandADKLKSEIAEMEEEIRAKKRQLEKFEQARKLFEAS
Ga0187870_105247953300017998PeatlandADKLKAEIAEMEEALKAKRRQLEKFEQARKLFEGA
Ga0187868_111239423300018002PeatlandVVLEQADKLKAEIAELEEELKAKRRQLEKFEQAKKLFEGV
Ga0187873_120941323300018013PeatlandMEQADKLKAEIAEAEEELKAKRHQLEKFEQVKKLFEGV
Ga0187866_1002253123300018015PeatlandLEQADKLKAEIAEMEEALKAKRRQLEKFEQARKLFEGA
Ga0187889_1027523813300018023PeatlandQADKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEGM
Ga0187885_1012843523300018025PeatlandLEQADKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEAL
Ga0187857_1014571113300018026PeatlandTPVEVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM
Ga0187887_1011378323300018043PeatlandVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM
Ga0187771_1184702623300018088Tropical PeatlandLEQAEKLKAEIAEAEEELKAKRRQLQKFEEAKKLFEGI
Ga0187893_1001932453300019487Microbial Mat On RocksVVLEQADKLKAEIAELEEELKAKRKQLQKFEEAKKIFEAS
Ga0210401_1001691643300020583SoilLEQAEKLKSEIAEGEEELKAKRRQLEKFEQARKLFEGV
Ga0210401_1105177313300020583SoilLEQADKLKAEIAEIEEELKAKRRQLQKFEEARKLFEAM
Ga0210401_1108207623300020583SoilVVLEQADKLKAEIAEMEEEVKAKRRQLVKFEEAKKLFEGM
Ga0210400_10002851153300021170SoilVEVVLEQAEKLRREIAEGEEELRQKRKQLQKFEEAKKIFEAS
Ga0210394_1013829663300021420SoilLEQADKLKSEIAEMEEELKAKRRQLQKFEEARKLFEAV
Ga0210394_1036448743300021420SoilVVLEQAEKLKAEIAEQEEDLKAKRKQLQKFEEARKLFEGM
Ga0210409_1047815223300021559SoilVVLEQADKLKAEIAETEEELKAKRKQLLKFEEARKLFEGM
Ga0212088_1011880633300022555Freshwater Lake HypolimnionVVLEQADKLKAEIAEAEEELKAKRKQLQKFEEAKKIFEAI
Ga0212123_10019117103300022557Iron-Sulfur Acid SpringLEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEAV
Ga0224555_100403363300023088SoilVLFEQADKLRAEIAEAEEELNAKKRQLQKFDEAKKLFEAM
Ga0209417_117089733300025154SoilKKKSPVEVVFEQAEKLRAEIAEAEEELAAKKRQLQKFEEAKKLFEAL
Ga0209697_1056360423300025316Freshwater Lake HypolimnionAERLRAEIAEEEEELNAKKRQLQKFEEAKKLFEAM
Ga0209585_1047527913300025891Arctic Peat SoilVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEARKLFEGM
Ga0207695_1001714633300025913Corn RhizosphereMEQADKLKAEIADAEEDLKAKRRQLEKFEQAKKLFEGV
Ga0207686_1087338833300025934Miscanthus RhizosphereEQADKLKAEIAEAEEEIKAKKRQLEKFEQARKLFEVS
Ga0207704_1141005413300025938Miscanthus RhizosphereVVLEQADKLKSEIAEMEEEIKAKRKQLEKFEQAKK
Ga0207667_1211730233300025949Corn RhizosphereQADKLKAEIAEAEEEIKAKRRQLEKFEQAKKLFEGV
Ga0207674_1102373813300026116Corn RhizosphereVVLEQAEKLKTEIAEGEEALKAKRRQLEKFEQAKKLFEG
Ga0209881_111859033300026273SoilLEQADKLKAEIAEMEEEIKAKRRQLVKFEEARKLFEGM
Ga0179593_102543463300026555Vadose Zone SoilVVLEQADKLRREIAEAEEDLKQKRKQLQKFEEAKKIFEAS
Ga0209380_1017029823300027889SoilVVLEQADKLKAEIAEMEEEIKTKRKQLVKFEEARKLFEGM
Ga0209067_1000821323300027898WatershedsVVLEQAEKLKAEIAEAEEELKAKRRQLEKFEQARKLFEGV
Ga0209168_100000062073300027986Surface SoilVEVVLEQADKLKAEIAELEEEIKAKRRQLQKFEEARKLFEAV
Ga0209168_1004163153300027986Surface SoilVVLEQADKLKAEIAEMEEEIKAKRKQLQKFEEAKKLFEGM
Ga0302151_1003714813300028562BogVVFEQADKLRAEIVEAEEVLNAKKRQLQKFEEAKKLFEAL
Ga0302197_1053492123300028873BogDVVFEQADKLRAEIVEAEEVLNAKKRQLQKFEEAKKLFEAL
Ga0308309_1113861323300028906SoilMEQGDKLKAEIAELEEELKAKRKQLLKFEEARKLFEAV
Ga0302325_10011973203300031234PalsaMEQADKLKAEIAEMEEELKAKRRQLQKFEEAKKLFEGI
Ga0302324_10120371723300031236PalsaVVLEQADKLRAEIAETEEELKAKRKQLQKSEEAKKIFEAS
Ga0302324_10349802023300031236PalsaLDVLLEQGEKLKAEIAQMENELKDKRRQLQKFEEARKLFEAL
Ga0170818_10472810023300031474Forest SoilMEQADKLKAEIAEGEEELKSKRRQLEKFEQAKKLFEGS
Ga0265313_1003419563300031595RhizospherePVEVVLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM
Ga0310686_10456467133300031708SoilVVLEQAEKLKAEIAETEEELKAKRKQLQKFEEAKKIFEAI
Ga0307479_1188890323300031962Hardwood Forest SoilPVEVVLEQADKLKSEIAEMEEELKQKRRQLQKFEEARKLFESA
Ga0326597_1016835853300031965SoilLEQADKLKAEIAEAEEELKAKKRQLQKFEEAKKLFEAI
Ga0335085_10001175143300032770SoilMEQAEKLRAEIAEAEEEIKAKKRQLQKFEEARKLFEGA
Ga0335085_1139230923300032770SoilVVLEQADKLRAEIAEAEGELKAKRRQLAKFEEAKKLFE
Ga0335081_1196446613300032892SoilVVLEQADKLRAEIAETEEELKAKRKQLQKFEEAKKIFEAS
Ga0335069_1214442913300032893SoilLEQADKLKAEIAEMEEEIKAKRRQLVKFEEAKKLFEGM
Ga0334792_147752_1_1113300033888SoilQAERLRSEIAEEEEELNAKKRQLQKFEEAKKLFEAM
Ga0314861_0216771_389_5053300033977PeatlandMEQADKLKAEIAEAEEELKAKRRQLEKFEQAKKLFEGV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.